0% found this document useful (0 votes)
10 views22 pages

Protein Folding and Threading Techniques

Protein threading is a method used to align a query protein sequence to a template structure based on the limited number of unique structural folds in nature. The process involves minimizing an energy function that considers factors like residue proximity and structural environment to achieve optimal alignment. Techniques such as contact maps and Voronoi maps are utilized to predict protein structures and analyze interactions between residues.
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
10 views22 pages

Protein Folding and Threading Techniques

Protein threading is a method used to align a query protein sequence to a template structure based on the limited number of unique structural folds in nature. The process involves minimizing an energy function that considers factors like residue proximity and structural environment to achieve optimal alignment. Techniques such as contact maps and Voronoi maps are utilized to predict protein structures and analyze interactions between residues.
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

Protein Folding

and
Protein Threading
Protein threading

Structure is better conserved than sequence

Structure can adopt a


wide range of mutations.

Physical forces favor


certain structures.

Number of folds is limited.


Currently ~700
Total: 1,000 ~10,000 TIM barrel

Tolga Can, METU, CENG 465


Protein Threading
• Basic premise

The number of unique structural (domain) folds in nature


is fairly small (possibly a few thousand)

• Statistics from Protein Data Bank (~35,000 structures)

90% of new structures submitted to PDB in the past


three years have similar structural folds in PDB

Tolga Can, METU, CENG 465


Concept of Threading
o Thread (align or place) a query protein sequence
onto a template structure in “optimal” way
o Good alignment gives approximate backbone
structure

Query sequence
MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE

Template set

Tolga Can, METU, CENG 465


Protein Threading – energy function
MTYKLILNGKTKGETTTEAVDAATAEKVFQYANDNGVDGEWTYTE

how preferable to put


two particular residues
nearby: E_p how well a residue fits
a structural
environment: E_s
alignment gap
penalty: E_g

total energy: E_p + E_s + E_g

find a sequence-structure alignment


to minimize the energy function

Tolga Can, METU, CENG 465


Prediction of Protein Structures
• Examples – a few good examples

actual predicted actual predicted

actual predicted actual predicted

Tolga Can, METU, CENG 465


Prediction of Protein Structures
• Not so good example

Tolga Can, METU, CENG 465


CASP/CAFASP
• CASP: Critical CASP
Assessment of Predictor
Structure Prediction

• CAFASP: Critical
Assessment of Fully CAFASP
Automated Structure Predictor
Prediction
1. Won’t get tired
2. High-throughput

Tolga Can, METU, CENG 465


Protein Threading

Kristen Huber, UMass, EC 697S


Protein Threading

Kristen Huber, UMass, EC 697S


Protein Threading
❑ Jinbo Xu, Ying Xu, Dongsup Kim, Ming Li.
RAPTOR: Optimal Protein Threading by Linear Programming
Journal of Bioinformatics and Computational Biology, April 2003

❑ Given a query sequence S = (s1, s2, s3, …sn) and a template (library)
sequence T = (t1, t2, t3, …tm), pair up elements from S and T, by possibly
inserting gaps, while minimizing an energy function

❑ Assumptions
➢ the template is a sequence of cores (conserved segments – α-helix or β-
sheet) connected by loops

➢ gaps are allowed only within the loops

➢ only interactions between residues in the cores


are considered;

➢ interaction between residues is assumed to exist


if they are within 7 Ǻ and at least 4 positions away
Protein Threading
❑ Steps of the RAPTOR algorithm:
➢ build a contact map for the template structure

➢ find all possible alignments for each core within the query sequence

➢ build a contact map for the query sequence and template structure

➢ define energy function and carry out minimization

E =WmEm +Ws Es +W p E p +Wg Eg +Wss Ess

Em – mutation score
Es – environment fitness score
Ep – pairwise interaction score
Eg – gap penalty score
Ess – secondary structure compatibility

Wx – weights (determined experimentally)


Applications to Protein Contact maps

12 A Ca contact map for 2csn, casein


kinase-1

• contact maps specify


both secondary
structure and inter-
residue contacts

• a detailed contact map


provides sufficient
information to
reconstruct a 3-D
structure

• generation of a large
set of feasible contact
maps can reproduce
near native structures

(Smith et al, 1997)


Protein structure prediction: Contact maps

Some issues with distance based contact maps:

• typically use Ca-Ca distances


- dependent on appropriate choice of cutoff

• short cutoff distance biases map towards contacts within


secondary structures

• longer cutoff distance results in more contacts, and a noisy


data set

• Ca atoms in close proximity may have little interaction


- e.g. n, n+2 residues in an alpha helix

• contact with solvent not readily integrated

A tessellation procedure based on residue sidechains can


circumvent some of these issues
Voronoi Contact maps

• similar to Ca-Ca distance-based maps

• uses a tesselation procedure to determine if residues are in


contact

• contacts can be subdivided by type:


- sidechain contacts
- backbone contacts
- both sidechain and backbone

• results in recognizable patterns of interaction for within and


between secondary structures

• it is possible to integrate solvent contact into this scheme


as well
Voronoi Contact maps
Voronoi Contact maps

Voronoi map Ca distance map


Voronoi Contact map feature recognition

Using the contact preferences from residue-residue scores, it is possible


to recognize regions of secondary structure, and interactions between
secondary structure elements:

alpha helix:
alpha-alpha:

antiparallel
beta-beta

beta-alpha:
parallel
beta-beta
Future work

• Further refinement of binary contact scoring functions

- incorporate different contact types

- beta sheet vs. alpha helix

• Development of search procedures to explore contact map


space

• Other unrelated stuff

- proteomics

- gene expression and divergence

- physicochemical pattern recognition


Protein Threading
❑ Step 1: Build a contact map for the template structure
➢ contact map indicates interactions between cores, i.e. if any two residues
within the cores interact

Xu et al., JBCB, 2003


Protein Threading
❑ Step 3: Build a contact map for the query and template

Xu et al., JBCB, 2003


Protein Threading
❑ Step 4: define energy function and carry out minimization

Xu et al., JBCB, 2003

You might also like