Introduction to Video Editing Basics
Introduction to Video Editing Basics
Developed by
Allama Iqbal Open University, Islamabad, Pakistan
In association with
Commonwealth Educational Media Centre for Asia (CEMCA), New Delhi
2016
Introduction
Objective
1. Video Editing
2. History of Editing
4. Hardware Requirements
Reference
INTRODUCTION
Editing is a language that uses pictures & sounds instead of words. Learning to edit is like learning
to play a musical instrument. It’s craft and practice is important. The more you edit the more it
becomes easier it becomes to please yourself and the audience. Music & Editing share another trait.
Both can create deep emotional responses from audiences. There are few things in life more
rewarding than sitting in the back of a room and watching other people be profoundly moved by
No matter what the story is, the Editor’s job is to tell well to us, that means editing that’s invisible.
Anything be acting , Camera Work , Lighting , Music or editing that calls the attention to itself
Editing digital video is easier than it looks. Everyone starts out confused and fearful. You can learn
as you edit. However, once you grasp the underlying concepts of digital editing, the process will
cease to be a mystery breakthrough sooner or later. Afterwards, all the aspects of editing will
become clear to you. Nothing will stand in your way; we’ve seen this happen hundreds of time
with our students. Our method will help you achieve your breakthrough faster.
OBJECTIVES:
After the successful completion of this unit, the students will be able to understand the:
Students will learn about which aspect ratio is appropriate for the project
Why we do editing?
Definition of an Editor.
The ultimate goal of editing is to tell stories. Writers use words and sentences to craft stories,
editors use pictures and sound. Joining disparate shots together in fundamental to editing. In one of
the oddities that persist in the film and video industry, the simplest way to join two shots together
is to cut from one shot to another. It’s called a cut because film editors once had to cut and splice
together strands of film to join two shots. What’s important to know is that the act of placing one
shot next to another can create an emotional impression that’s greater than the sum of the parts.
The Shot is the basic visual element in a television production. A shot is a single, continuous
image taken by a camera. It can be as short one-thirtieth of a second (the length of a single video
frame) or as long as the length of the entire program. We almost never use a single shot for an
entire program. Rather, we assemble a number of different shots together into a sequence to show
the viewer the action from the best possible angle, distance and viewpoint.
Individual shots must be edited, or joined together, into a meaningful sequence. The director edits
1. the juxtaposition of shots – the sequence and order of individual shots have a definite
1. The cut
2. The fade
3. The dissolve
4. The wipe
The timing of the transition and knowing when and when not to change shots are important
directional decisions. In general, we change shots when we want viewer something new or
different or more effective angle or view of the scene, or when there is obvious motivation for the
cut. Jump cuts are abrupt or radical changes from one shot to another and usually startle or
disorient the viewer. Among the most common jump cuts are radical changes in shot or subject
size, severe change in camera angle or point of view, jump in screen direction, discontinuity, and
The most efficient approach to telling stories with a camera is to follow the Hollywood model.
Shoot what you want, in the order you want to shoot it, and then assemble those elements into a
story. Filmmakers realized that joining disparate shots together gave them more control over how
the story was told and on the impact their stories had on the audience, turning editing into an
important tool. Another early realization was that editing could alter how an audience perceives
time and space. Although the reason comes in mind, is to create stories, it’s actually only one of
4. To combine multiple stories or videotapes on one tape. This could mean adding
Examine the list. You’ll notice that three of the four reasons are not creative; most editing tasks are
technical. Fixing mistakes, cutting for length, or combining things are what most editor do day in
and day out. It’s an interesting fact that when an editor finally has the opportunity to build a story,
he or she often ends up fixing mistakes, adjusting the length, and combining things.
The definition of an editor is, hanging in editing rooms around the world, is the person who takes
out-of-focus, badly framed, and poorly shot footage of people mumbling, bumping into furniture,
and forgetting what to say, turns that footage into a compelling story with lasting value for which
the director will take all the credit. There’s a kernel of truth definition, although we prefer to say
that editing is about taking the best of what you have at hand and telling the most compelling story
Digital video editing gives you ability to change the digital video files stored in your editing
system in any shape, any way, or fashion. The information in those files is stored as binary data,
which means that the file contains a series of numbers that can be either ones or zeros. The power
of digital video editing beyond simply changing the order of a series of shots. You can change the
colors, luminance, contrast, and even the size and shape of the image itself down to the smallest
part of the picture information, which is called a pixel. A typical editing system enables the
operator to manipulate multiple layers of video, audio, text and graphics in a completely non-
destructive way. Digital editing is the umbrella term for this new way of doing things. The person
who operates these editing systems in a professional environment often becomes a super user
because its no longer enough to be just an editor. You need to be an expert in graphics, audio,
effects, editing, composition, and compression because it all falls under the umbrella of digital.
2. HISTORY OF EDITING
Usually fairy tales that begin with "once upon a time" take place hundreds, if not thousands, of
years ago. This tale begins just 40 years ago. Imagine a world with no edit controllers, no editing
monitors, no computer-based editors and no time code. Imagine a world without electronic editing
or video and audio dubbing. A look back at the last 40 years of video editing is a look back at a
world that has changed very fast and a set of technologies that has come a long way.
In tracking the history of videotape editing, well discover that many of the so-called standard
features of today’s camcorders and VCRs were once nothing but a pipe dream to the early
founders of the craft. Then, maybe we’ll learn to appreciate the wonders of even the simplest
During the early 1950s, the broadcast industry used film to record programming for later
broadcast. In a process called kinescope, a cameraman would aim a film camera at a video monitor
to record a TV program. This kinescope process proved to be time consuming and expensive. The
industry needed a new medium to replace film, and that medium was videotape.
Kinescope
In 1956, Ampex Corporation introduced the first practical black-and-white videotape recorder
(VTR), the VR-1000. (It wasn't a VCR-video cassette recorder--because the tape wound on open
reels, not enclosed in a cassette.) 3M Company introduced the videotape used in the machine. It
was two inches wide and had a four-part record pattern, and was therefore known as two-inch
Ampex VTR
Quadraplex tape. In April, at the National Association of Broadcasters (NAB) show, Ampex took
orders for more than 75 recorders. In just a few weeks, the three networks essentially stopped
using the kinescope method of recording television programs. While videotape proved valuable in
its ability to play back immediately after recording, it proved to be very difficult to edit.
Electronic Editing
In 1963, Ampex introduced the Editec and Helical Scan VTRs, the first commercial electronic
videotape editor. A small computer gave the editors the ability to set edit points that were almost
frame-accurate.
Helical Period
The editor pressed a button on the control panel to record a single-frame audio tone on the
secondary cue channel of the two-inch videotape. This tone established the in and out points of the
edit. If the editor recorded the tones at the wrong place, he could go back and re-record them.
Helical System
This process, though time consuming, eliminated tape handling and physical splicing. The editor
no longer had to cut the original. The editor created an edit master by electronically splicing one
shot to the next onto a blank edit master. If he made a mistake during the edit, he could do it over
again. This transferring of material from one VTR to the next was called transfer editing, and it is
Time Code
In 1967, the Electronics Engineering Company (EECO) developed the first time code for
electronic editing. The edit machine added a kind of clock timing to each frame of the secondary
cue channel of the videotape. This time code gave the editor the ability to accomplish precise
frame-accurate edits. With the success of the EECO system, other companies began developing
their own systems. These various forms of time code were incompatible, and chaos soon prevailed.
The Society of Motion Picture and Television Engineers (SMPTE) finally developed a standard
The end of the two-inch era came as engineers developed and improved the helical-scan recorder.
Today, almost all VCRs use the helical scan to lay down long video tracks at an angle on the tape.
This system allows editors to watch their source tapes in slow or fast motion and choose edit points
more precisely.
The first helical machines used the two-inch tape. In 1963, the constantly improving technology
made it possible to change the width to one inch. In 1978, one-inch Type C machines set the
standard for quality. It offered high- quality still-frame, slow-motion and fast-motion playback. By
the mid '80s, Type C had replaced the two-inch quad format as the standard for making studio
masters. By the late '80s, however, the Type C began to fade due to the advent of the digital
formats.
In 1973, a technological breakthrough was to change the video world completely. The time-base
corrector (TBC) was able to take the signals from non-broadcast quality VCRs and correct the
variations in the high speed scanning and timing pulses. With the TBC, small videocassette
formats were able to meet the strict FCC requirements. Broadcast stations quickly adopted formats
such as the 3/4-inch U-matic cassette, developed by Sony Corporation. Thus the videocassette was
introduced to the broadcast and production worlds. The self-loading tape and smaller size were
welcome changes to the fast-paced world of broadcast news. But, because of its high price, the U-
Sony Corporation introduced the first purely consumer VCR format in 1976. Although the public
widely accepted the Betamax format, it soon met its demise to an upstart introduced one year later,
the Video Home System (VHS) format. This format had the distinct advantage in that it could
record two hours of programming on one tape. By the time Sony developed a longer Beta tape, it
was too late. VHS had won the playback-time war. By 1990, even Sony began to manufacture
VHS machines.
VHS machines
In 1984, Kodak introduced the first 8mm camcorder. Others soon followed suit with Sony
Corporation having the most success with their version of this format, called Video8. This format
offered a good-quality video signal on a cassette about one-quarter of the size of the VHS cassette.
8mm Film
In 1987, Matsushita introduced a much-improved version of VHS, called S-VHS. This high-
quality format found its niche in smaller broadcast stations, business and industry, and soon began
In 1989, Sony Corporation countered with a much-improved version of 8mm, called Hi8. This
high-quality video format became the choice for many at the prosumer level, and is being used as
an acquisition format for many corporate and broadcast facilities. The rest, as they say, is history.
Now we are constantly hearing about digital video and the tiny DV cassettes with their beautiful
picture quality. Time will tell how the digital formats fare and which format becomes the king of
the hill. But let's not digress too much. As the formats have changed, so too has the world of video
editing.
Betacam VTR
Electronic Editing II
One advantage of the 3/4-inch U-matic format was its recognition as a standard format by all VCR
manufacturers. This was the first time this had happened, and it paved the way for the development
of advanced cassette-based editing systems. New formats such as Betacam (1981), Betacam SP
(1986) and MII (1985), which offered extremely high-quality video, soon supplanted the reel-
based Type-C and two-inch machines. The advent of the digital formats in the late '80s took
quality and editor's choices to a new level. And manufacturers began developing editing systems
The digital video editing revolution began in 1971 with the release of the CMX 600. This
magnetic disk drives. It allowed the operator to access video scenes from the magnetic disk drives,
immediately and in any order, to create an edit-decision list from which the system would
construct the final master. This was the first random-access or nonlinear editor. It was a good start,
but not until the 1990s did computer technology advance sufficiently to make nonlinear editing
affordable.
Here and Now
Now, when you look at your editing options, you have a number of choices: stand-alone edit
controllers, computer-based edit controllers, linear and nonlinear. With all these choices, one thing
is certain: now you can play with the big boys. Now, more than any time in the history of video
editing, consumers have at their fingertips equipment whose technology is comparable to that used
by the professionals. The only things to separate the consumer-level video editor from his
Have you heard the buzz about non-linear editing? You know, the computer systems that let you
cut and paste video together the same way you cut and paste sentences or paragraphs in a word
processor? Curious about what these new systems can and can't do? You should be.
Without a doubt, the future of video lies in computer technology and non-linear editing. Unlike the
VCRs and controllers you may use today, computers make the editing process simple and
incredibly flexible. If you plan to edit on into the future, and you want to have fun doing it, you'd
In the beginning of 21st Century, it was a dream come true for those people who were affiliated
with Film and Video Industry as the Digital Technology replaced Analogue and gained a boost.
Although, Sony, in 1986 started Digital Video Recording and invented a machine named “Sony D-
1”. This machine had an ability to copy an “Uncompressed Component Signal” on a ¾” tape at a
speed of 173mb/sec. Today, we are capable of copying massive amount i.e. 5 billion bits per
second due to the addition of Binary Language (0-1) in the field of Information technology.
Between 1991-1993, the companies related to the field of Electronics had a great competition,
Ampex in response to Sony’s D-1 manufactured D-2. After which, Panasonic invented D-3. Also,
Digi-Beta
If you ask my personal opinion, Sony Beta is a better option that D-1, this is so because it is not
only faster and reliable but also the choice of many Professionals. Between 1991 to 1995, a
massive amount of work was done for Chroma Compression and Resolution Compression of a
video signal and finally in 1995, the first compression, which was used at a larger scale, was JPEG
motion introduced by AVID. The quality as a resultant was just like VHS tape. But, when
In 1995, the second biggest change, then came, when Technological 2 was implemented. And it
was the first when DVD optical disc was introduced. The mechanism of this system was MPEG2,
which was developed by Moving Picture Engineering Group. In the same year i.e. 1995, DV
format was also introduced. Which had a compression rate of 25Mb/Sec. Now it was possible to
connect TV cameras live to the computers to transfer the data. Now it was possible to for people to
get a digital copy of their video in a comparatively less price and take it direct to their computer for
editing.
As a result nor was the encoder required neither there was a need of a compression, from here
An Apple of an Eye
Till 1990, AVID was known as the “King of Video” in Hollywood. It was known as the most
expensive and best NLE System. In 1990, another AMIGA System “Video Toaster 4000. NLE
could also be done on it. Now, the most important issue was to store the large amount of data in a
computer. Adobe Premier Pro & Media 100 overcome that issue, as it was a remarkable revolution.
They made AVID, think that price tag is also very much important. Afterwards, in 1998, AVID
sold its editing software to the company of Steve Jobs, Apple Inc. And finally in 1999, Apple
introduced software; named Final Cut Pro for ultra editing purposes.
High Definition Video & Film Scanning
The Addition of High Definition (HD) made Film & TV closer which turned to be a remarkable
revolution, in the field of Video Production. One of the most surprising thing is that, Japan, in
1980 started HD TV transmission where as it was started in 1996 in America. During this period,
Hollywood started to use the Digital Intermediate (DI). With the help DI, film could be converted
into a digital file. For which a system named Telecine was introduced. With the Sony HD WF900,
in 2002, first movie in Hollywood “The Star Wars 2” was made at the Digital Format (MPEG 4).
Till 2005, a continuous work was seen on Digital Format, Fast Camera, Big Storage and 4K
resolutions, which bore fruit and today we are able to edit our video directly on an online system.
From 1930 – 2005, it has been a very short time. Because 75 years are merely countable in human
life. If those 75 years had made something for even the upcoming 75 years then we were able say
that they had done the work not just for 75 years but for 75 decades. These 75 years are those
remarkable dream years for the Film and Video Industry, which make us think for more positivity
Film editing is done by hand. The process is simple. An editor looks at the film and physically cuts
strips of celluloid with a sharp blade. To isolate the price he or she want the pieces he or she wants
editor cuts out that section and puts it aside. The remaining pieces are then glued or taped back
together, or stored as separate pieces. The image for this phase is of an editor holding film in his or
her hand while cutting it with a blade. In the history of editing, this is the Iron Age. With the
arrival of videotape editing, the videotape recorder became the primary device for making edits.
To make an edit, the editor had to find the piece he or she wanted the original source tapes and
copy that section to a new section on a second recorder. The image for this phase of editing is of an
editor systematically playing back tapes on one machine and electronically transferring the images
to another machine for recording. In the history of editing, this is the Middle Age. With the digital
video editing, the computer has become the primary devices. To make an edit, the editor only
needs to rearrange the sequence in which media files are played. The image for this phase of
editing is of an editor seated in front of computer displaying moving objects on the desktop. In the
Video started life as an analogue signal and remained so for over 50 years. However, digital
television via satellite, cable and terrestrial transmission is now rapidly replacing analogue. Digital
signals are less expensive to transmit because more information can be carried within a given
bandwidth using digital multiplex and compression techniques. Digital signals also hold a
significant advantage when it comes to video recording, editing and reproduction: whereas an
analogue recording degrades with each generation of copying, the digital equivalent can nearly
maintain the original quality after numerous copies. On initial analysis, picture quality is also
inspection, however, errors can be detected, especially on rapidly moving pictures e.g. a football
match.
Analogue Video Format
between video cameras, VCR / DVD players and video monitors. When superimposed on a radio
frequency carrier it forms the aerial signal transmitted to homes. It is also the most usual input
connection found on a videoconference picture monitor. This and other signal types are described.
The composite signal is composed of three parts: the black and white information
signals which ensure that the displayed pictures stay in close time synchrony with the
transmission source. A problem with composite signals is that the three elements have to be
coded to enable them to combine, but in the picture monitor these have to be decoded in
order to display an image. These coding / decoding processes introduce unwanted noise
and distortion. Three different coding systems are used worldwide. These systems – PAL,
NTSC and SECAM – are all mutually incompatible. The NTSC (the National Television
Standards Committee) system is used in North and South America and Japan. SECAM
(Sequential Couleur Avec Memoire) is used in France and Eastern Europe, and PAL (Phase
S-Video / YC:
YC signal. S-Video has two separate parts, Luminance (Y) and Chrominance (C), and so
requires two separate connection channels between equipment in the chain. This involves
less signal processing (decoding) in the picture monitor, which means less noise / distortion
Alternatives:
To reduce decoding noise even further the TV information may be transmitted as three
signals, with a luminance channel (Y) and two colour component or colour difference
channels, Red-Y (R-Y) and Blue-Y (B-Y). This minimises processing in the display
monitor but requires three connection paths. An alternative method transmits Red (R),
The popular SCART interface includes three separate R G B channels together with
composite and stereo sound signals, with the connected devices choosing the most
Analogue video signals degrade when material is recorded or distributed. To overcome this, digital
signals are now used throughout broadcasting. Another important advantage of digital signals is
CCIR-601 / 4:2:2: CCIR-601 was one of the first high quality digital standards to be
introduced. It is also known as 4:2:2 or Y Cr Cb. It comprises Luminance (Y) and two
Chrominance components (Cr and Cb) but as it requires a very wide bandwidth for
including 4:2:0. This has the same picture rate and luminance resolution as 4:2:2 but a
reduced colour resolution, which is imperceptible to human eyes, as the human eye is much
It is important as it forms the basis for the MPEG-2 (a video compression standard) form of
coding used extensively for distributing digital television including SKY and Free view.
For less demanding applications SIF (Source Intermediate Format) was introduced. This
has reduced frame rate and chrominance resolutions. An even lower quality format – CIF
(Common Intermediate Format) which is a cross between the US and UK SIF formats – is
(QCIF), 4xCIF and 16CIF (for still images). QCIF has the lowest resolution and frame rate
and is the base line format used within IP and ISDN conferencing for compatibility. A big
advantage of CIF and its derivatives is that they are independent of origination television
standards (PAL, NTSC etc.). This allows communication from the UK to the USA without
standards conversion.
HDMI
DisplayPort
4. HARDWARE AND SOFTWARE REQUIREMENTS
Software requirements
Hardware requirements
Editing systems have two parts – Hardware and software. The hardware is the computer. Even
though an editing appliance might look like a computer, it is one. The computer lets you store and
play pictures and sound in digital files called Media Files. These files are stored on large hard
drives. Fast, powerful hardware is required to ensure quick, efficient, and error free retrieval of the
files. If the hardware is up to the task, the editor sees smooth, nonstop playback of the pictures and
must eventually be played elsewhere. It’s impractical for people to come to where your editing
system resides to watch your show. They’ll want watch it in a more comfortable venue. Hardware
(called an encoder) that converts the digital media files into standard television signals is at the
heart of a digital video editing system. Your editing system has to be capable of displaying video
on a computer and television. This may seem simple and obvious, but the technology to make this
possible is magical and phenomenal. Without it, digital video editing is nothing but a file
Software is what allows editors to manipulate media files to their heart’s content without ever
having known anything about computers. It’s the go between. Most of the people think software as
the user interference even though that’s the only a tiny fraction of what software does for us. The
degree of sophistication determines whether you have a lot of tools or just a few to perform the
tasks necessary to create a finished show. Some software programs are the intuitive and easy to use.
Others are complex with a multiple of features. Every editing software program includes a basic
set of functions and tools that enable you successful edit a finished show a long as you become
Computer manufactures are in the business of selling speed. Every year the speed of the central
processing unit (CPU), which is where all the work gets done, increases dramatically. The reality
is that the computers can never be fast enough, or have enough memory or storage space to satisfy
the enormous demands digital video places on computer. Digital editing is taxing and editing
software uses every bit of your computer ‘s processer and memory in a never-ending search for
more. One second of full motion video is made up of sixty still images. There are 30 frames – 2
fields per frame, 2 separate images – that must be processed and displayed from a file on a hard
drive. Any current computer can display a single still picture. Digital video requires the computer
to display 60 pictures every second in perfect time to maintain smooth motion. That requires
processing power. Not only does the motion have to smooth, but the sound also has to be in a
The Editing system retrieves the thousands of images stored in multiple files and plays them back
with full motion and sound. To manage all of this data, you need fast CPUs that can move the data
stored in large files on your hard drives through the computer and process them quickly. Digital
video editing involves reading files and writing new ones. Speed has an impact on how quickly the
computer is able to do the calculations needed to create transitions and effects and how fast a new
file can be written store the results. We call this creation of new media files rendering.
Random Access Memory (RAM)
With every new editing software release, you gain more tools and feature, although you may also
need a faster computer to run the new version efficiently. Newer, faster computers will always read
and write digital video files faster and efficiently. The corollary to the rule is if your editing system
does everything you need it to do today, it will still do it a year from now. There’s no such thing as
being too thin or too rich. When it comes to Random Access Memory (RAM), there’s no such thing
as having too much. The more memory you have in your computer, the better it will run.
Remember that the computer is processing 60 pictures a second and each picture is composed of
hundreds of thousands of pixels. The pixels change with each new frame. Memory determines how
often your computer can update those pictures. All of the pictures on screen, including the
interference’s buttons, tools, menus, and viewers are kept in memory to display them even though
most of what’s on screen remains static, the editing system interface uses up a lot of memory. The
overhead to run the program, along with all those pictures and sounds the editor is trying to
manipulate, translate into a never-ending need for more memory. The amount of memory in your
editing system also has an impact on how many video and audio tracks can be played in real time.
The memory you have, the more layers you’re likely to be able to use. That’s why we say you can
never have too much and should have as much as you can afford.
Storage
One gigabyte of hard-drive space stores about four and a half minutes of DV footage. To
hold a footage of 1 hour you will need about 13 gigabytes of space. If you are using
1080/24P high definition (HD) video format, you’ll need 334 gigabytes, which is nearly 26
times the space for one hour of storage. The rule is that bigger is the pictures need faster
connections to move through the system. Its easy to see, even with the DV Format that,
projects with a lot of footage will quickly eat up the drive space. Any source of original
material to which you need instant access should be on your editing system. Thankfully,
Storage seems to be bigger, faster, and cheaper every year. The DV Format works well with
the typical drives found in computers of recent vintage. Even storage suitable for 1080/24P
HDTV format, which has a very high data transfers rate requirements and huge files, is
inexpensive. Now one can purchase a terabyte (1000 GB) of 1080/24ps HD storage for under
1. Editing Digital Video (The Complete Creative and Technical Guide) by Robert M.
3. Filmmaker [Link]
5. [Link]
6. [Link]
7. [Link]
8. [Link]
9. [Link]
10. [Link]
Unit 2
Interface
Writer: MuzammilDani
Reviewer: Umer Mehmood
CONTENT
Introduction
Learning outcome
1. Launching application
3. Setting sequence
9. Understanding Rendering
Reference
INTRODUCTION
Dear Students in this unit you will learn how to launch the application managing all the basics
project options and then the settings of all the options will be taught. In this unit the interface of
the editing software will be discussed so that the students understand what is happening in all the
windows and what they are used for as there are different windows in different versions. Most of
them will be covered along with familiarizing with the interface, then there will be a topic to help
out students to customize the interface of the software so that everyone can customize their
interface according to their need and convenience. The main tool box will be explained, every tool
will be explained so that after the topic every student know what the basic tools in the tool bar do
and how to use them. They also have shortcut keys which can be seen by dragging the mouse over
them staying there for couple of seconds. Keyboard is the most important part of editing. There are
a lot of options to customize the keyboard keys so everyone can set it according to their needs.
Some default keys are also available and if someone comes from some other software default keys
for them are also saved by default and they can be select to make the software environment
friendly. The details of how to save the customize keyboard is also explained in this unit.
The explanation of rendering is explained in this unit which is used to process all the timeline
materiel so that it is ready to be played and used. There is also a smart rendering option available
in the software which the students will be briefed. The students will also learn the details of
playback systems used for play back of timeline materials which is rendered and ready to be
played through different playback systems. Its use depends on the hardware being used otherwise
every software have its own playback system which is also briefed in this unit.
Objectives:
First of all, you have to open the application by clicking on the shortcut of Adobe Premiere; it will
When you open it you will be welcomed with the screen on which you will be given an option to
make new project, open existing project and help as shown below:
Here if you are starting for the first time you have to click on new project or if you want to
continue on some old project then you have to click on open project and select the project which is
needed and skip next two steps. When you open new project you will be given option for naming
2. SETTING UP A PROJECT:
Video Rendering and Playback option is there if you have an external video rendering,
capturing card you will have an option to change it otherwise it will stay default.
Video option is there to change the time coding formation it can be changed to different
Audio option is also used to change the display option of audio samples.
Capture option is there to select which camera you are using if you are using any hd camera
then you have to select HDV otherwise select DV but if you are not using any external
Location is for selecting a location of your complete project for editing which will include
all the things used in recommended is to select storage drive other than your Operation
Scratch Disk
There is also an option of scratch disk at the top by clicking on that you will be shown a
window as below.
In this window there are different options to define multiple folder location or even different
drives for capturing, video and audio preview files of the project. All options can have the
option of same location as of the project so that all of the project data is at one place.
Captured video is for giving different locations for the video files which are to be
captured in this project.
Captured audio is also there to give different location for the audio files which are to be
captured.
Video Previews option is there to change the folder for the files which are rendered and
previewed.
Audio previews option is there for the saving the audio files.
3. SETTING SEQUENCE
When the project settings are done press OK it will take you to the sequence settings there are the
setting which are required for making your playback system compatible with your output file.
Here we have alot of presets which are made for user ease. These are the standards used around the
world for example in Pakistan PAL type is used so if we select Standard 48kHz in DV-PAL then
all other selecting will be set accordingly which include aspect ratio ,audio bitrate, frame rate etc.
We have option of settings at the top. By clicking it we will have a window as below.
If user want to change the default setting selected on the previous screen then more option are
available on this screen for power users so the user can make their own preset which can be saved
Editing Mode The video format used for preview files and playback, the time bases available, the
compression methods which appear in the video settings panel, the display formats available.
Choose an Editing Mode option that best matches the specifications of your target format, preview
display, or capture card. The editing mode does not determine the format of your final movie, you
Timebase Specifies the time divisions Premiere Pro uses to calculate the time position of each edit.
In general, choose 24 for editing motion picture film, 25 for editing PAL (European standard) and
SECAM video, and 29.97 for editing NTSC (North American standard) video. The frame rate of
the video you play back or export from sequences is not the same as its timebase. However,
timebase and frame rate are often set to the same value. The options listed for Timebase vary
Frame Size Specifies the dimensions, in pixels, for frames when you play back sequences.
Alternatively, you can adjust the frame size of final output by changing export settings. The
Pixel Aspect Ratio Sets the aspect ratio for individual pixels. Choose Square Pixels for analog
video, scanned images, and computer-generated graphics, or choose the format used by your
source. If you use a pixel aspect ratio different from the pixel aspect ratio of your video, the video
progressive-scan video, select No Fields (Progressive Scan). Many capture cards capture fields
regardless of whether the source footage was shot with progressive scan.
Display Format (Video) Premiere Pro can display any of several formats of timecode. You can
display the project timecode in a film format. Changing the Display Format option does not alter
the frame rate of clips or sequence but it changes only how their timecodes are displayed.
25-fps Timecode Reports time in hours, minutes, seconds, and frames, separating units
Feet + Frames 16mm Reports time in feet and frames, assuming the frame rate of 16mm
Feet + Frames 35mm Reports time in feet and frames, assuming the frame rate of 35mm
Frames Reports time solely in a running count of frames. Does not assign measurements
Sample Rate (Audio) In general, higher rates provide better audio quality when you play back
audio in sequences, but they require more disk space and processing. Re-sampling, or setting a
different rate from the original audio, also requires additional processing time and affects the
quality.
Display Format (Audio) Specifies whether audio time display is measured using audio samples or
milliseconds.
Video Previews settings Video Previews settings determine the file format, compressor, and color
depth Premiere Pro uses for preview files and playback of clips and sequences. Among the various
options, you can reduce the frame size of previews. This reduction permits faster and easier
Preview File Format Select a file format that gives the best quality previews while keeping
rendering time and file size within tolerances acceptable for your system. For certain editing
Codec Specifies the codec used for creating preview files for the sequence. (Windows only) The
Uncompressed UYVY 422 8-bit codec and the V210 10-bit YUV codec match the specifications
for SD-SDI and HDSDI video respectively. Select one of them if you intend to monitor or output
to one of these formats. To access either of these formats, first choose the Desktop Editing Mode.
Width Specifies the frame width of video previews, constrained by the pixel aspect ratio of the
original media.
Height Specifies the frame height of video previews, constrained by the pixel aspect ratio of the
original media.
Reset Clears existing previews and specifies full size for all following previews.
Maximum Bit Depth Maximizes the color bit depth, up to 32 bpc, to include in video played back
in sequences. This setting is often not available if the selected compressor provides only one
maximizes the quality of motion in rendered clips and sequences. Selecting this option often
Tracks
There is a track option at the top. By clicking on it we will have a screen as below:
Video option is to select how many tracks are required for video.
Audio have multiple options to select which output is required from mono to 5.1.
User can even define different names to different tracks and change the types for that particular
track.
You can change some of the settings for an existing sequence. Note that, depending on the Editing
settings.
the raw footage by putting in point and out point and easily dragging it to the time line.
2. Top right is the program monitor it is actually the screen which shows the contents
which are on the timeline and will be rendered, it includes all the tracks on the timeline.
3. Lower left window is the Project interface it shows all the sequences, clips (audio and
4. Along with the Project interface there is a tool bar, it is available in almost every
software, so that the user can select the most used tools easily.
5. Sequence window will show the current sequence. The user is working on the timeline
will be shown in this window. All the clips will be on it and all the editing will be done
on it.
In every window there are options of multiple tabs as it can be seen in window 1
and 3. They are for fast access to different areas of programs, which will be
discussed later.
5. CUSTOMIZING THE WORK SPACE
When the user requires making changes to their work space it is possible for them by going in the
In there if they go to the workspace there are a couple of default settings available, if a person is
familiar to an old Premiere Pro version then editing (CS5.5) can be selected. All the windows will
according to requirement. They can add the windows from the window menu or closing the
window by pressing the cross on the window. The size of the window can also be adjusted by
placing the mouse at the divider line and changing the size of the particular window.
In Premiere Pro CS6, there is a new workspace called, "2-up". 2-up refers to the large Source
Monitor and Program Monitor found at the top of the interface. This arrangement allows you to
In Premiere Pro CS6, the new default editing workspace does not display the Preview Area in the
Project panel, as it had in past versions of Premiere Pro. You can view the Preview Area by
choosing the panel menu > Preview Area in the Project panel.
The 2-up workspace and the Media Browser
In the 2-up interface, the Project panel covers up the Media Browser, so it is not apparent that you
can drag items from the Media Browser into the Project panel. To drag media from the Media
You can also import items from the Media Browser by selecting media and then
You can lower the brightness, when making color corrections or working in dark environments.
Changing the brightness will affects panels, windows, and dialog boxes but will not affect scroll
bars, title bars, and menus. The process to the changing is as below.
1. Choose Edit > Preferences > Appearance (Windows) or Premiere Pro > Preferences >
2. Drag the User Interface Brightness slider to the left or right. Click Default to restore the
You can expand any panel to display it in full-screen mode, and toggle back to normal view. You
can do so with the current panel in focus. To maximize a selected panel you can choose Window >
Maximize Frame. To restore the panel size, choose Window > Restore Frame Size. You can also
press Shift+accent to maximize the panel size of a selected panel. Press the accent key to toggle
the panel size of a panel you are hovering over with the mouse.
You can dock panels together, move them into or out of groups, and undock them so they float
above the application window. As you drag a panel, drop zones-areas onto which you can move
the panel-become highlighted. The drop zone you choose determines where the panel is inserted
Docking zones
Docking zones exist along the edges of a panel, group, or window. Docking a panel places it
adjacent to the existing group, resizing all groups to accommodate the new panel.
Grouping zones exist in the middle of a panel or group, and along the tab area of panels. Dropping
Dragging panel (A) onto grouping zone (B) to group it with existing panels (C)
a) If the panel you want to dock or group is not visible, choose it from the Window menu.
To move an individual panel, drag the gripper area in the upper-left corner of a
To move an entire group, drag the group gripper in the upper-right corner onto the
When you undock a panel in a floating window, you can add panels to the window and modify it
similarly to the application window. You can use floating windows to use a secondary monitor, or
Select the panel you want to undock (if it’s not visible, choose it from the Window menu), and
Choose Undock Panel or Undock Frame from the panel menu. Undock Frame
Hold down Ctrl (Windows®) or Command (Mac OS®), and drag the panel or
group from its current location. When you release the mouse button, the panel or
Drag the panel or group outside the application window. (If the application window
When you position the pointer over dividers between panel groups, resize icons appear. When you
drag these icons, all groups that share the divider are resized. For example, suppose your
workspace contains three panel groups stacked vertically. If you drag the divider between the
bottom two groups, they are resized, but the topmost group doesn’t change.
To quickly maximize a panel beneath the pointer, press the accent key. Press the accent key again
a. To resize either horizontally or vertically, position the pointer between two panel
b. To resize in both directions at once, position the pointer at the intersection between
2. Hold down the mouse button, and drag to resize the panel groups.
When you close a panel group in the application window, the other groups resize to use the newly
available space. When you close a floating window, the panels within it close, too.
3. To see all the panel tabs in a narrow panel group, drag the horizontal scroll bar.
Hover the cursor above the tab area, and turn the mouse scroll wheel. Scrolling
To reveal panels hidden in a narrow panel group, drag the scroll bar above the
panel group.
To increase the available screen space, use multiple monitors. When you work with multiple
monitors, the application window appears on one monitor, and you place floating windows on the
As you customize a workspace, the application tracks your changes, storing the most recent layout.
To store a specific layout more permanently, save a custom workspace. Saved custom workspaces
appear in the Workspace menu, where you can return to and reset them.
Arrange the frames and panels as desired, and then choose Window > Workspace >
New Workspace. Type a name for the workspace, and click OK.
Reset a workspace
Reset the current workspace to return to its original, saved layout of panels.
Delete a workspace
b. Choose the workspace you want to delete, and then click OK.
6. UNDERSTANDING THE TOOL PANEL
A. Selection tool B. Ripple Edit tool C. Rate Stretch tool D. Slip tool E. Pen tool F. Hand
tool G. Track Select tool H. Rolling Edit tool I. Razor tool J. Slide tool K. Zoom tool
Select any tool to activate it to use in the Timeline, by clicking it or pressing its keyboard shortcut.
Let the cursor hover over a tool to see its name and keyboard shortcut.
Selection Tool The standard tool for selecting clips, menu items, and other objects in the user
interface. It’s generally a good practice to select the Selection Tool as soon as you are done using
Track Selection Tool Select this tool to select all the clips to the right of the cursor in a sequence.
To select a clip and all clips to the right in its own track, click the clip. To select a clip and all clips
to its right in all tracks, Shift-click the clip. Pressing Shift changes the Track Selection Tool into
Edit Tool closes gaps caused by the edit and preserves all edits to the left or right of the trimmed
clip. For more information about using the Ripple Edit tool.
Rolling Edit Tool Select this tool to roll the edit point between two clips in a Timeline. The
Rolling Edit Tool trims the In point of one and the Out point of the other, while leaving the
Rate Stretch Tool Select this tool to shorten a clip in a Timeline by speeding up its playback, or to
lengthen it by slowing it down. The Rate Stretch Tool changes speed and duration, but leaves the
Razor Tool Select this tool to make one or more incisions in clips in a Timeline. Click a point in a
clip to split it at that precise location. To split clips in all tracks at that location, Shift-click the spot
Slip Tool Select this tool to simultaneously change the In and Out points of a clip in a Timeline,
while keeping the time span between them constant. For example, if you have trimmed a 10-
second clip to 5 seconds in a Timeline, you can use the Slip Tool to determine which 5 seconds of
Slide Tool Select this tool to move a clip to the left or right in a Timeline while simultaneously
trimming the two clips that surround it. The combined duration of the three clips, and the location
Drag a connector line vertically to adjust it. Ctrl-click (Windows) or Command-click (Mac OS) on
a connector line to set a keyframe. Shift-click noncontiguous keyframes to select them. Drag a
Hand Tool Select this tool to move the viewing area of a Timeline to the right or left. Drag left or
Zoom Tool Select this tool to zoom in or out in a Timeline viewing area. Click in the viewing area
to zoom in by one increment. Alt-click (Windows) or Option-click (Mac OS) to zoom out by one
increment.
Many commands have keyboard shortcut equivalents, so you can complete tasks with minimal use
of the mouse. You can also create or edit keyboard shortcuts. The default shortcut set is called
Find the keyboard shortcuts for a tool, button, or menu command by doing any of the following:
For a tool or button, hold the pointer over the tool or button until its tool tip appears. If
available, the keyboard shortcut appears in the tool tip after the tool description.
For menu commands, look for the keyboard shortcut at the right of the command.
For the most-used keyboard shortcuts not shown in tool tips or on menus, see the table
at the end. For a complete list of default and current shortcuts, choose Edit > Keyboard
Customization.
Use the search field in the Keyboard Customization dialog box to find specific commands quickly.
You can set shortcuts to match shortcuts in other software you use. If other sets are available, you
can choose them from the Set menu in the Keyboard Customization dialog box.
2. In the Keyboard Customization dialog box, choose an option from the menu:
3. In the Command column, view the command for which you want to create or change a
shortcut. If necessary, click the triangle next to the name of a category to reveal the
commands it includes.
a) Type the shortcut you want to use for the item. The Keyboard Customization dialog box
displays an alert if the shortcut you choose is already in use. Do one of the following:
To erase a shortcut and return it to the command that originally had it, click Undo.
To jump to the command that previously had the shortcut, click Go To.
Save As, type a name for your Key Set, and click
c) Save.
To remove a shortcut, select the shortcut you want to remove, and click Clear.
To remove a set of shortcuts, choose the key set from the Set menu and click Delete. When
You can paste the lists of keyboard shortcuts from the Keyboard Customization dialog box into a
Select a set of keyboard shortcuts from the Set menu in the Keyboard Customization dialog
box (Windows).
Mercury Playback Engine is a name for a large number of performance improvements in Adobe
Premiere Pro CS5 and later. Those improvements include the following:
64-bit application
multithreaded application
processing of some things using CUDA (and OpenCL in Premiere Pro CS6)
Everyone who has Premiere Pro CS5 or later has the first two of these. Only the third one
CUDA is a technology (architecture, programming language, etc.) for a certain kind of GPU
processing. CUDA is an Nvidia technology, so only Nvidia cards provide it. OpenCL is a
technology that is similar in purpose to CUDA. OpenCL features are provided by many graphics
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
Unit 3
Introduction
Objectives
4. Navigate in a sequence
5. Capturing
7. Organizing media
8. Reconnecting media
References
INTRODUCTION
Dear Student editing software like Premier Pro can handle a lot of file formats and these files can
be used for editing. In this unit students will learn to import different type of files and folders.
Student will learn about the different panels on a timeline, in this unit there is a detailed
description of how a person can navigate in timeline. In this unit student will learn how to use tools,
which will be used on files. Dear Student in this unit you will learn to create a new sequence
according to your requirement, which will help students during complex editing. Capturing of clips
is also an option to get the requested data from different type of formats like tapes, cameras, live
converges and many more. Capturing media is explained in the unit so the students can capture any
kind of video to their computer for editing. Students will learn about the option to make a low level
video clips which are very useful for editing on those systems which are not that high powered.
During low level video clips the copy of the whole video is made in low resolution so that the
computer can handle it easily and quickly. When all the editing is done it is replaced with the
original high resolution version so the outcome is high resolution video. Dear students the
important thing for the editing is organizing the data so it can be easily accessible whenever
required during editing or when the project is to be edited again for some reason this is really
important thing and that is also taught in this unit in details. Dear students in this unit you will
learn how to delete any unused data from the project folder so the folder size can be reduced to
save the storage space. When some data gets deleted and user have a backup of that data to
reconnect it is must to have a same videos so that timeline is reconnected exactly like it was before
otherwise the editor have to do all editing again and all his work will be wasted. If any file is
appearing offline, any project file goes missing, how to re-link the file, at the end of the unit
Learn to work with low level clips and export in high resolution.
The Import command brings files that are already on your hard disk or other connected storage
device into your project. Importing files makes them available to a project. The editing software
lets you import many types of video, still images and audio. Finally, you can export a Premiere Pro
project from other software of adobe like After Effects and import it into Premiere Pro. You can
import a single file, multiple files, or an entire folder. Frame sizes cannot exceed 16 megapixels.
The Media Browser makes it easy to browse to files, and to find them by their type. Unlike the
Import dialog box, the Media Browser can be left open and docked like any other panel. The
Media Browser gives you quick access to all your media while you edit. Also, you can use the
Media Browser to import clips copied from video storage media such as Memory Cards, MMC,
SxS cards, XDCAM disks, and DVDs. When you import an asset Premiere Pro leaves it in its
current location, and creates a clip in the Project panel that points to it. By default, Premiere Pro
writes XMP files to the directory where the media files are located, but you can turn off this
behavior in Preferences. For best performance, first transfer files from their file-based media to a
local hard disk. Then, import them into editing projects from the hard disk.
To open a folder recently opened, click the triangle in the Recent Directories menu, and
In the list of hard drives and folders in the Media Browser, click the triangles next to
3. To view only files of certain types, click the triangle in the Files of Type menu, and select a
file type. To select an additional type open the menu again and make another selection.
(Windows) or Command-click (Mac OS) the filenames. To select more than one file, Shift-
Select File > Import From Browser or right-click the file in the Media Browser and
select Import. Alternatively, you can drag the file from the Media Browser into the
Project panel, or drag the file from the Media Browser into a Timeline.
The Media Browser imports the file into the Project panel.
Right-click the file in the Media Browser and select Open In Source Monitor.
Alternatively, double-click the file in the Media Browser to open it in the Source
Monitor.
While you can import clips directly from file-based media connected to your computer, it is
best to first transfer clips from these media to a hard disk. Then, import them from the hard disk.
To import a recently imported file, choose File > Import Recent File >[file name].
To import a folder of files, choose File > Import. Locate and select the folder, and then
click Import Folder. The folder, with its contents, is added as a new bin in the Project panel.
2. CREATE NEW SEQUENCE
In many cases, you want to create a sequence that matches the characteristics of the primary clips
that you’ll be editing. You can create a sequence that matches the characteristics of clip by
dragging the clip to the New Item button at the bottom of the Project panel.
You can also create a sequence by using a sequence preset by keyboard shortcut Ctrl+N. The
sequence presets included with Premiere Pro include the correct settings for common types of
assets(clips). For example, if you have footage mostly in DV format, use a DV sequence preset. If
you plan to specify lower quality settings for output, don’t change your sequence settings. Instead,
change your export settings later. When all the parameters of your assets do not match all the
settings of any preset do one of the following. In the Sequence Presets tab of the New Sequence
dialog box, select a preset with most settings matching the parameters of the assets (clip) you want
to edit.
3. On the Sequence Presets tab, select a preset from the Available Presets list.
OR
You can create a new sequence from a selected clip by one of the following methods:
Drag and drop a clip onto the New Item button. As shown above
1. Drag a clip into the sequence. Premiere Pro detects if the attributes of the clip match the
sequence settings.
2. If the attributes do not match, a Clip Mismatch Warning dialog box launches with the
message, “The clips does not match the sequence settings. Change sequence to match the
clip’s settings?” Choose “Change Sequence Settings” if you want to create a new sequence
with attributes that match the clip. This technique is the one to do if you are creating a new
sequence from scratch. If there are existing clips in the sequence, they will be conformed to
the new sequence settings. Choose “Keep Sequence Settings” if you want the clip to be
Time ruler Measures sequence time horizontally. Tick marks and numbers indicating the
sequence time are displayed along the ruler and change according to the level of detail at which
you view the sequence. By default these tick marks and numbers are based on the time code
display style specified in the Display Format field of the New Sequence dialog box, time ruler
numbers can be turned on/off by right clicking on time ruler and selecting Time Ruler Numbers in
A single Timeline panel appears in a frame in the lower central portion of the screen, open any of
its default workspaces, or create a project. You can remove all sequences from a Timeline panel, or
add multiple sequences to it, each appearing as a tab within that Timeline panel. You can also open
multiple Timeline panels, each within its own frame, with each containing any number of
sequences.
You can show or hide items by selecting, or deselecting them in the Timeline panel menu. These
items include: time ruler numbers, and the work area bar.
You can open more than one Timeline panel if you have more than one sequence in a project.
Each will appear in its own tab in the default Timeline panel.
A Timeline panel contains several controls for moving through the frames of a sequence.
A. Current-time display
B. Play head
D. Time ruler
F. Pointer
Current time display shows the time code for the current frame in a Timeline panel. To move to a
different time, click in the time display and enter a new time, or place the pointer over the display
and drag left or right. You can change the display between time code and the simple frame count
by Ctrl-clicking (Windows) or command-clicking (Mac OS) the current time in either a monitor or
a Timeline panel.
Play head Indicates the current frame displayed in the Program Monitor. The current frame
displays in the Program Monitor. A vertical line extends from the playhead to the bottom of the
time ruler. You can change the current time by dragging the playhead.
Zoom scroll bar Located at the bottom of the Timeline panel, this bar corresponds with the visible
area of the time ruler in the Timeline. The Source Monitor and Program Monitor also have zoom
scroll bars. You can drag the handles to change the width of the bar and change the scale of the
time ruler. Expanding the bar to its maximum width reveals the entire duration of the time ruler.
Contracting the bar zooms in for a more detailed view of the ruler. Expanding and contracting the
bar is centered on the playhead. By positioning the mouse over the bar, you can scroll the mouse
wheel to expand and contract the bar. You can also scroll the mouse wheel in the areas outside of
the bars for the same expanding and contracting behavior. By dragging the center of the bar, you
can scroll the visible part of a time ruler without changing its scale. When you drag bar, you are
not moving the playhead, however, you can move the bar and then click in the time ruler to move
Work area bar Specifies the area of the sequence that you want to render previews, or to define a
region you plan to export. The work area bar is located in the lower portion of the time ruler. You
can drag the edges of the work area bar, or use keyboard shortcuts to set the work area in a
sequence. To return the work area bar to the Timeline, enable it from the panel menu by selecting
Work Area Bar. When the work area bar is enabled, commands for Render Effects in Work Area,
and Render Entire Work Area are available in the Sequence menu. You can now use In and Out
points for most things the Work Area does, so you can keep it hidden and use In and Out points for
rendering an area of the Timeline, or for marking an area to export for encoding.
Zoom controls Change the scale of the time ruler to increase or decrease the number of frames
visible within the current viewing area. The zoom controls are located at the bottom left of a
Timeline panel.
Source track indicator Represents a video or audio track of the clip in the Source Monitor. Place
into the head of the Timeline track where you want to insert or overwrite the source clip track.
In the time ruler, drag the playhead or click where you want to position the playhead.
Drag in the current time display. Use any playback control in the Program Monitor.
Press the Left or Right Arrow key to move the playhead in the direction you want. Press
Shift while pressing the arrow keys to move in increments of five frames.
Click the time code value, type a new time, and press Enter (Windows) or Return (Mac OS).
When you have a long sequence of clips, many of them are out of view. If you need to work on a
clip that is out of view, you need to scroll horizontally in your sequence in the Timeline panel. For
each of these commands, the Timeline panel need not be selected; however, your mouse should
hover over the Timeline panel. The sequence will scroll left or right by the number of frames
Use the Page Up key to move left and the Page Down key to move right.
When video or audio clips are stacked up in tracks on the timeline, they can sometimes be hidden
from view. If you need to work on a clip that is out of view, you need to scroll vertically in your
For each of these commands, the Timeline panel need not be selected; however, your mouse
In the right of the Timeline panel drag up or down in the scroll bar.
Place the mouse pointer anywhere in the Timeline panel and turn the mouse wheel while
pressing Ctrl.
The video and audio tracks in a Timeline panel are where you arrange clips, edit them, and add
special effects. You can add or remove tracks as needed, rename them, and determine which to
affect by a procedure.
Add tracks
New video tracks appear above existing video tracks, and new audio tracks appear below existing
audio tracks. Deleting a track removes all clips in the track but does not affect source clips listed in
To specify the placement of added tracks, choose an option from the Placement menu
To specify the type of audio or sub mix track you want to add, choose an option from
the Track Type menu for audio and audio sub mix tracks.
3. Click OK.
Delete tracks
You can delete one or more tracks at a time, whether video or audio.
2. In the Delete Tracks dialog box, check the box for each type of track you want to delete.
3. For each checked item, specify which tracks you want to delete in its menu.
Rename a track
1. Right-click (Windows) or Ctrl-click (Mac OS) the track's name and choose Rename.
2. Type a new name for the track, and press Enter (Windows) or Return (Mac OS).
Locking an entire track is useful for preventing changes to any clips on that track while you work
on other parts of the sequence. In a Timeline panel, a pattern of slashes appears over a locked track.
Although clips in a locked track cannot be modified in any way, they are included when you
preview or export the sequence. If you want to lock both a video track and a track with
corresponding audio, lock each track separately. When you lock a target track, it is no longer the
target; source clips cannot be added to the track until you unlock it and target it again.
Exclude tracks in a sequence
You can exclude video or audio clips in any track from previews and export. Clips in excluded
video tracks appear as black video in the Program Monitor and in output files. Clips in excluded
audio tracks are not output to the Audio Mixer, to the speakers, or to output files. Click to hide the
Eye icon (for video) or the Speaker icon (for audio) at the left edge of the track. (Each icon is a
toggle switch. Click its box again to display the icon and include the track.)
You can expand a track to display track controls. Increase the height of a track to better see icons
and key frames or to display larger views of video track thumbnails and audio track waveforms.
1. To expand or collapse a track, click the triangle to the left of the track name.
2. To resize the track, position the pointer in the track header area between two tracks so that
the height adjustment icon appears, and then drag up or down to resize the track below (for
Collapsed tracks always appear at the same height and cannot be resized.
1. Expand the track by clicking the triangle next to the track name.
2. Click the Set Display Style button at the left corner below the track name, and choose an option
Show Head Only Displays a thumbnail image at the beginning of the clips in the expanded
track.
Show Frames Displays thumbnail images along the entire duration of the clips in the
expanded track. The number of thumbnail frames corresponds to the time units displayed in
images.
Show Head And Tail Displays a thumbnail image at the beginning and end of clips in the
expanded track.
1. Expand the track by clicking the triangle next to the track name.
2. Click the Set Display Style button , and choose an option from the menu:
Show Name Only Displays the name of audio clips without waveforms.
5. CAPTURING
Capturing is different from importing. In this process audio and video is saved to the system hard
disk. This process is done through using the capture panel. The editing software records the audio
and video signal to the hard disk and it can controls the device through the panel.
You can capture audio and video from a DV or HDV device by connecting the device to your
computer with a FireWire cable. The device can also be controlled through the FireWire port.
You can capture DV or HDV footage from XDCAM or P2 devices. You can capture through SDI
ports if your computer has a supported third-party capture card or device installed.
In a sequence made with one of the DV or HDV presets, the capture settings are set for DV
Capture or HDV Capture, respectively. You can, however, change the capture settings to either
You can choose whether to preview DV video in the Capture window during preview and capture.
You can also preview HDV footage in the Capture window, in Windows only. However, you
cannot preview HDV footage in the Capture window during capture. Instead, the word Capturing
Capturing HD video:
You can capture audio and video from an HD device with an SDI port. Your computer must have a
supported SDI capture card, and its drivers and software installed. Similarly, you can capture HD
footage from SDI sources provided a supported SD capture card is installed, along with its
respective driver. Correct installation adds HD presets to the Available Presets pane of the New
Sequence dialog box. It also adds HD formats to the Capture Format menu on the General tab of
the Project Settings dialog box. You typically connect the HD device to your computer by
connecting its SDI ports by coaxial cable with BNC connectors. To provide device control
(Windows only), you also connect the serial port on the device with an RS422 or RS-232 port on
the computer.
To bring footage that is not already in the form of a file or set of files into a project, you can
1. Capture: You capture digital video from a live camera or from tape: you record it from the
source to the hard disk. Many digital camcorders and decks record video to tape. You
capture the video from tape to the hard disk before using it in a project. The software
captures video through a digital port, such as a FireWire or SDI port installed on the
computer. The captured footage is saved to disk as files, and imports the files into projects
as clips.
2. Digitize: You digitize analog video from a live analog camera source or from an analog
tape device. You digitize the analog video, convert it to digital form, so your computer can
store and process it. The capture command digitizes video when a digitizing card or device
is installed in the computer. The interface saves digitized footage to disk as files, and
Use the Capture panel (choose File > Capture) or press F5 to capture digital or analog video and
audio. This panel includes a preview, which displays video being captured, and controls for
recording with or without device control. The Capture panel also contains a Settings pane for
editing your capture settings, and a Logging pane for logging clips for batch capturing. For
convenience, some options available in the Capture panel are also available in the Capture panel
menu. You can control certain source devices, such as camcorders and decks, directly from the
Capture panel. Your computer must have an IEEE1394, RS-232, or RS-422 controller. If your
source device lacks any of these interfaces, you still use the Capture panel. You must cue, start,
1. With a project open, choose File > Capture, and select the Settings tab.
3. In the Capture Settings dialog box, select an option from the Capture Format menu.
4. Click OK.
1. Choose Edit > Preferences > Capture (Windows) or Premiere Pro > Preferences > Capture
(Mac OS).
2. Specify whether you want to cancel capture on dropped frames, report dropped frames..
3. Specify whether to use device control time code. If a device controller is installed,
Premiere Pro can record the time code supplied by the controller instead of recording any
3. Select Record Video, Record Audio, or Record Audio and Video, depending on the option
desired.
If you do not have a device that Premiere Pro controls, you can capture video manually. You
manually operate both the playback device controls and the Capture panel controls in Premiere Pro.
1. Make sure that the deck or camcorder is properly connected to your computer.
3. These settings are preserved for the project, but you can set them again for each new
project.
4. In the Setup area of the Logging pane, choose your media type from the Capture menu.
5. Use the controls on the deck or camcorder to move the videotape to a point several seconds
6. Press the Play button on the deck or camcorder, and then click the red Record button in the
Capture panel.
7. Record a few seconds beyond the end of the footage you need, to provide room for editing.
8. When the Save Captured File dialog box appears, enter logging data and click OK. The
new file is listed in the Project panel and is saved to the disk location specified in the
After a device and the project are set up properly, you can begin capturing clips using device
control. You can capture an entire tape or you can mark In and Out points for each clip, and then
2. These settings are preserved for the project, but you set them again for each new project.
3. In the Capture panel, make sure that the device is online, as indicated above the preview.
4. Insert a tape into the device. Premiere Pro prompts you to name the tape. Be sure not to
give any two tapes the same name. Including a unique number in the name can help you
5. In the Setup area of the Logging pane, choose the media type from the Capture menu.
6. Rewind the tape to its beginning, or to the beginning of the portion you want to capture.
7. You can capture frames that extend beyond the In and Out points of each clip. Enter the
8. Click Tape.
9. To stop capturing at the end of a portion, click the Stop button. Otherwise capturing stops
2. These settings will be set for the project, but you may need to set them again for each new
project.
3. In the Capture panel, make sure that the device is online; it will be indicated above the
preview.
4. Insert a tape into the device. Premiere Pro prompts you to name the tape. Be sure not to
5. In the Setup area of the Logging pane, choose the media type from the Capture menu.
6. Use the controls in the Capture panel to move to the first frame you want to capture, and
click Set In. Then move to the last frame you want to capture, and click Set Out.
7. Click the In/Out button in the Capture area of the Logging pane to capture the clip.
6. CREATE CLIPS FOR OFFLINE EDITING:
For online editing, you edit clips at the level of quality required for the final version of the
video program. This is the default method of working in Premiere Pro. Online editing works well
when the speed and storage capacity of the computer are adequate to the demands of the video
formats used. For example, most modern computers can handle the data rate of DV in full
resolution. They may be challenged, however, by the greater demands for example, HDV or HD
footage. For many videographers, that’s where offline editing comes in. In offline editing, after
capturing high-resolution clips, you make low-resolution copies of them for editing purposes.
After editing, you replace the low-resolution footage associated with the clips with the high-quality
original footage. You can finish, render, and export your final product in high resolution.
Editing the low-resolution clips allows standard computers to edit excessively large assets (clips),
such as HDV or HD footage, without losing performance speed. It also lets editors use laptop
2. In the Project panel, click the New Bin button, and name a bin for your low-resolution clips.
3. Launch Adobe Media Encoder, and add all the clips for your project to the Adobe Media
Encoder Queue.
5. Change the format and other settings to the format and settings for a lower-resolution
format.
6. Click the filename in the Output Name field, and browse to the folder you created for your
low-resolution clips.
7. Click OK.
Adobe Media Encoder encodes clips in the low-resolution format, and, by default, retains the
filename of the original clips in the filenames of the encoded clips. When creating low-resolution
clips for offline editing with Adobe Media Encoder, clips with two audio channels are created even
9. In the Premiere Pro Project panel, open the bin you created for low-resolution clips. Import
You can replace low-resolution copies of assets with the original high-resolution so that you can
1. Select Clip > Replace Footage. Browse to the original high-resolution clip that has the
same filename as the low-resolution clip you selected, and select it. Click Select.
2. Repeat the previous two steps for each low-resolution clip used in the project.
7. ORGANIZING MEDIA:
The Project panel can include bins, which you can use to organize project contents in much the
same way as folders in Windows Explorer or Mac OS Finder. Bins can contain source files,
To add a bin, click the New Bin button at the bottom of the Project panel. You can also use the
To delete one or more bins, select the bins and click the Delete icon at the bottom of the Project
panel. You can also delete bins by selecting one or more bins, and then pressing the Delete key.
Change bin behaviors
While working in a project, you will sometimes want to change the way you view your bins. In
standard layout, you can see the hierarchy of your entire project, which is useful. However,
sometimes you want to open a bin in its own tab, or open in a new panel. That way, you can focus
on the clips in a particular bin, sort clips in storyboard order in icon mode, or search for clips
within a bin by typing in the search field. To move an item into a bin, drag the item to the Bin icon.
You can move bins into other bins to nest them. Dropping an item into a bin does not
automatically open the bin. To display the contents of a bin, in List view, click the triangle beside
To open a bin in its own floating panel, in place, or in a new tab, do the following:
To open a bin in its own floating panel, double-click the bin. This panel can be docked or
the bin.
the bin.
You can change the default behaviors of Project panel bins by editing the Bins preferences.
1. Select Edit > Preferences > General (Windows) or Premiere Pro > Preferences > General
(Mac OS).
2. In the Bins area, select options from the menus for Double-Click, + Ctrl (Windows) or +
3. Click OK.
Label media:
Labels are basically colors that help you identify and associate media. You assign and view labels
in the Project panel. Label colors mark media in the Project panel’s Label column and in a
Timeline panel.
To assign a label to a file, select a clip in the Project panel, choose Edit > Label, and
choose a color.
To select all clips with the same label, select a clip that uses the label and choose Edit >
To edit label names or colors, choose Edit > Preferences > Label Colors (Windows) or
Premiere Pro > Preferences > Label Colors (MacOS). Click a color swatch to edit a color.
To set default labels for a media type, choose Edit > Preferences > Label Defaults
(Windows) or Premiere Pro > Preferences > Label Defaults (Mac OS).
Rename assets
All files in your project are stored on your hard disk as individual files. Only a reference to each
file is added to the Project panel. Whenever you rename a clip, the original file and filename
In the Project panel, choose Clip > Rename, type the new name, and press Enter
In the Project panel, click the Name field, type the new name, and press Enter
Type the new name into the Name field, and press Enter (Windows) or Return (Mac
OS).
You can remove assets you don’t need from the Project panel without removing them from your
hard disk.
You can remove assets you haven’t used in a Timeline panel from the Project panel. Do one of the
following:
Sort the Project panel List view by the Video Usage or Audio Usage columns to identify unused
clips, and then select and delete them. Choose Project > Remove Unused.
8. RECONNECTING MEDIA
You can link offline clips to video files, audio files, and still-image files. However, you cannot link
an offline clip to a still-image sequence different from its original source file. Instead, import new
If you selected more than one offline clip, the Link Media The dialog box appears in turn for each
clip you selected. The title bar of the dialog box gives the filename for each offline clip. Re-link
the correct source file to each offline clip. If all of the offline clips selected point to media in the
same folder, the Link Media To dialog asks for the first file, then links the selected offline clips to
all the files in the same folder as the file selected. If you link to a file from a different project, and
if that project has the same folder structure and folder names as the first project, the Link Media To
dialog box asks for the first file, and then links the selected offline clips to all the files in the other
project.
SELF ASSESSMENT QUESTIONS
1. Explain the process of importing asset from the system hard disk?
6. Can you prevent any time track been changed if possible write the process?
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
Unit 4
Introduction
Objectives
3. Trimming
7. Rendering sequences
9. Memory settings
References
INTRODUCTION
Dear students in this unit you will learn the techniques of adding clip to the sequence and when
adding a clip to a sequence how important i s to assign tracks. The unit introduces students to all
the skills necessary to cut their own program. Students will learn different procedures like
how to drag clips from the Project panel, Source panel, or Media Browser and use insert or
overwrite buttons in the source monitor. The students will be briefed about link/re-link a clip for
editing according to his needs. You will see how to link an offline clip containing audio to a source
The unit will focus on the standard techniques in video editing of three-point and four-point edits.
The students will learn to perform using the control provided by source and program monitors for
three-point and four-point edits. The student will understand process of marking clips and will be
defined about In and Out requirements and utilizations. With marking, student will learn adjusting
after it is edited in to a sequence which is called trimming. Students will learn to trim clips to
adjust by slip, slide, rolling methods of editing. The students will be introduced to the methods of
timeline trimming for quickly trimming clips in the Timeline and will be introduced to use a
combination of trim tools and keyboard shortcuts. The editing methods which are explained in the
unit will help smoothen and clean editing just like a pro.
The students will also learn to explore the software generated special clips, requirements and will
learn how they can be modified. Students will be also learning through a series of keyboard
shortcuts to fasten the pace in during editing. The technique of arranging clips in a timeline is also
explained in-depth in this unit, the students will explore different techniques to move clips in
timeline, extracting frames, lifting and pasting, split or cut a clip in to two clips, or to cut a cross
clips in several tracks at once or to remove gaps between the clip. The concepts of rendering and
requirements of rendering are covered in a broader aspect. The students will learn the background
workings hidden behind the render. The students will be explained procedure to move a work area
bar, and marking In and Out across the rendering area. Further, they will also learn render options
available in the export panel. To make the students editing techniques effective, the requirements
for rendering and making their interface more efficient and reliable through dedication memory is
OBJECTIVES
The unit introduces video editors to all the skills necessary for editing clips.
The students will be able to recognize the grammar used for editing.
The student will learn different methods for adding clips to the timeline which will help
The student will learn the fundamentals of rendering and the chemistry hidden in the
background.
The students will have the knowledge about extended rendering options available while
The students will explorer marking and trimming clips and the procedure to do so.
1. ADDING CLIPS TO SEQUENCES
Youcanaddclipstoasequenceinthefollowingways:
DragtheclipfromtheProjectpanelorSourceMonitortoaTimelinepanelortheProgramMonitor.
[Link]
hekeyboardshortcutsassociatedwith thosebuttons.
AutomaticallyassembleasequencefromtheProjectpanel.
DragtheclipfromtheProjectpanel,Sourcepanel,orMediaBrowserintotheProgrammonitor.
Anoverwriteeditaddsaclipbyreplacinganyframesalreadyinasequencestartingfromtheeditpointand
extendingforthelengthoftheclip.
Overwriteisthedefaultmethodwhendraggingacliptoasequenceorwhenrearrangingclipsinasequenc
e.
Addingaclipbyoverwritingexistingclips
Withaninsertedit,addingacliptothesequenceforcesanyclipslaterintimetoshiftforwardtoaccommod
[Link],
presstheCtrl(Windows)orCommand(MacOS)keytoshiftintoinsertmode.
Addingaclipbyinsertingitbetweenclips
Openasequence
InaProjectpanel,double-clickasequence. ThesequenceopensinaTimelinepanel.
Targetingtracks
[Link],itisimportantt
oassignwhichtrackortracksitisto
[Link],[Link]
tingmethodyouuse:editingfromthe SourceMonitor,dragging,orcopy/pastingtothetimeline.
Inadvanceofmakinganinsertoroverwriteedit,youcanmapthetracksofacliploadedintheSourc
eMonitortooneormoretracksofa
sequencebydraggingthesourcetrackindicatorrepresentingeachofthesourceclip’stracksinto
oneormoreselectedtracksofthe
[Link]
p’[Link],
[Link]
racksaretargeted,edittheclipby pressingtheInsertorOverwritebuttons(orusetheshortcuts).
Highlightedsourcetrackindicatorsofvideoandaudiotracks
Whenyoudragacliptoasequenceasaninsertoroverwriteeditbydragging,youtargetthetrackau
tomaticallybydroppingtheclipintothe
[Link]
uareperforminganinserteditwiththe
clip,pressCtrl(Windows)orCommand(MacOS)[Link],trianglesapp
earshowingtheaffectedtracks.
Targetingatrackwhiledraggingacliptoasequence
Whenyouaddclipstoasequencebypasting,(orkeyboardshortcuts),youmustspecifytargettrac
[Link]
[Link],youcanchoosetotargetavideotracko
[Link]
[Link]
oratargetedtrackappears highlighted.
Highlightedtrackheaderoftargetedvideoandaudiotracks
Ifyouoverwriteaclip,onlytheclipsintargetedtracksareaffected,whetheryoudragthecliporuseaSourc
eMonitor’sOverwritebutton.
Ifyouinsertaclip,theclipgoesintothetargetedtracks,andclipsinanyunlockedtrackswherethesourcecl
iplandsshifttoaccommodatethe
[Link].
Youcandragvideoclipstoanyvideotrack;however,youcandragaudioclipsonlytoacompatibleaudiotr
[Link]’tbeaddedtothe
masteraudiotrackorsubmixtracks,andtheycanbeplacedonlyonaudiotracksofthematchingchannelty
pe:mono,stereo,or5.1.
Clipswithlinkedvideoandaudiocanbedraggedtoeitheravideooranaudiotrack,buttheclip’svideoand
audiocomponentsappearseparately, intheappropriatecorrespondingtracks.
OER:
[Link]/devis_andrew/sync-lock-target-tracks/1
[Link]/designcenter/premierpro/articles/Irvid4072_pr.html
Dragvideoandaudio to asequence
Bydefault,whendroppedintoasequence,thevideoandaudiocomponentsoflinkedclipsappearincorres
pondingtracks(forexample,Video1
andAudio1),[Link],thel
inkedaudioappearsinthenext compatibletrack,oracompatibletrackiscreatedautomatically.
Anaudioclipdraggedtoanincompatibletrackautomaticallyshiftstothenextcompatibletrack,evenifth
etrackisoccupiedbyanother [Link],takecarenottodisturbclipsalreadyinthesequence.
However,youcanalterthisbehaviorbyholdingtheShiftkeywhileyoudrag.
TheProgramMonitorcanhelpyoudeterminewheretopositionaclipyou’[Link]
anoverwriteedit,itdisplaystheframes
inthesequenceadjacenttothenewclip’[Link],itdisplaystheframesadjacent
totheinsertionpoint.
1. OpenaclipintheSourceMonitor,andmarkitsInandOutpoints.
2. Tomakeclipedgesalignwhenyoudragthem,makesurethattheSnapbutton
isactiveinaTimelinepanel.
3. Dooneofthefollowing:
Todragthevideoandaudioportionsofacliptospecifictracks,dragtheclipfromtheSourceMonit
ororProjectpanelintoaTimeline.
Whenthevideoportionoftheclipliesabovethedesiredvideotrack,[Link]
eholdingshift,anddragdownward
[Link]
iredaudiotrack,releasethemouse andreleaseShift.
To
dragthevideoportionofacliptotheVideo1trackandtheaudiotoanyaudiotrack,dragtheclipfro
mtheSourceMonitororProject
[Link]
otrackwhereyouwanttheaudio
portiontoland.ThevideoportionoftheclipwillremainintheVideo1track,andtheaudioportionl
andsinthedesiredaudiotrack.
Toperformanoverwriteedit,dragtheclipfromtheSourceMonitororProjectpaneltoanappropri
atetrackinaTimelinepanelatthe
[Link],andthepointerappearswiththe
Overwriteicon .
Toperformaninsertedit,Ctrl-drag(Windows)orCommand-
drag(MacOS)theclipfromtheSourceMonitororProjectpaneltoan
[Link]
ghlighted,andthepointerappears withtheInserticon
.Arrowsappearattheinsertionpointinalltracks.
Toperformaninserteditandshiftonlytargettracks,Ctrl+Alt-
drag(Windows)orCommand+Option-drag(MacOS)theclipfromthe
SourceMonitororProjectpaneltoanappropriatetrackinaTimelinepanelatthepointyouwantth
[Link] highlighted,andthepointerappearswiththeInserticon
.Arrowsappearattheinsertionpointonlyinthetrackstowhichtheclipis added.
TozoomintooroutofaclipasyoudropitintoaTimelinepanel,dragandpresstheequalsignkey(=)
to increasethezoomfactororpresstheminussignkey(–
)[Link].
TheclipwilllandinaTimelinepanel,andaTimelinepanelwillbecomeactive,makingiteasytoplaybackt
heclipjustaddedtothe sequence.
Youcanaddthevideotrack,theaudiotracks,[Link]
clipfromtheProjectpanelorfrom
themainviewingareaoftheSourceMonitor,[Link]
onlyonetypeoftrack,additfromthe SourceMonitor.
1. Double-clickaclipinaProjectpanelorTimelinepaneltoopenitintheSourceMonitor.
2. IntheSourceMonitor,dooneofthefollowing:
Todragallaudioandvideotracksoftheclip,dragfromanywhereinsidethemainviewingarea.
Todragonlythevideotrackoftheclip,dragfromtheDragVideoOnlyicon .
Todragonlytheaudiotracks,firsttargetintheTimelinepanelthetracksyouwanttoreceivethecli
[Link]
[Link],dragfromtheDragAudioOnlyicon .
[Link]
rtingtherespectivedrag operations.
Insertaclipinto asequence
1. Double-clickaclipinaProjectpanelorsequencetoopenitintheSourceMonitor.
2. Placetheplayheadatthepointinthesequencewhereyouwanttoinserttheclip.
3. IntheTimelinepanel,clicktheheadersofthetrackswhereyouwanttoinsertthesourceclip’scompon
entstotargetthem.
4. Dragthesourcecliptrackindicatorstotheheadersofthetrackswhereyouwanttoinsertthesourceclip
’scomponents.
5. ClicktheSyncLockboxintheheaderofanytrackyouwanttoshiftasaresultoftheinsertion.
6. IntheSourceMonitor,clicktheInsertbutton .
[Link]
therightofitslocationonitsown
trackandtrackswithSyncLockenabledwillshifttotherightbythelengthoftheinsertedclip.
OER:
[Link]/user/lyndapodcast#p/search/11/g_bXEKr9vUA
Overwriteaclipinto asequence
1. Double-clickaclipinaProjectpanelorsequencetoopenitintheSourceMonitor.
2. Placetheplayheadatthepointinthesequencewhereyouwanttooverwritetheclip.
3. Clicktheheadersofthetrackswhereyouwanttooverwritethesourceclipcomponentstotargetthem.
4. Dragthesourcecliptrackindicatorstotheheadersofthetrackswhereyouwanttooverwritethesource
clipcomponents.
5. IntheSourceMonitor,clicktheOverlaybutton .
Theaudioandvideocomponentsoftheclipwillbeoverlaidontothetracksselectedattheplayhead.
[Link],anoverlayappearsinmonitortoprovideavisualdepictionofOverwriteversusI
[Link]
[Link]
itbydraggingacliptotheProgram panel,dothefollowing:
Drag-and-droptooverwriteedit(default).
Drag-and-droptoInsertedit(holddownCommand/Ctrlkeymodifier).
Theclip,orclipsthatcanbedraggedtotheProgrampanelcaneitherbefromtheProjectpanel,ortheMedia
[Link],video only,oraudioonlyclips.
WhenaclipisdraggedfromtheProjectpanelortheMediaBrowserintotheProgrammonitor'svideodispl
ayarea,theOverwriteoverlayappears
[Link]'sthumbnailimag
e,todrop(mouserelease)tocreatean
overwriteedit,andthatholdingdowntheCommand/Ctrlkeycreatesaninserteditinstead.
[Link]
condoesnottrulydepictthenumberof clipsbeingdragged.
Whenthemodifierkeyishelddown,[Link]
backandforthbetweenthe Overwrite/Insertmodesinthemiddleofthedrag-and-
[Link].
Relinkanoffline clip
Youcanlinkanofflinecliptoasourcefile,eventoasourcefiledifferentfromtheonefromwhichtheoffline
[Link]
[Link],forexample,toeditanonlineclipinaseq
uence,makeitssourceoffline,and
[Link]
edid. Youcanlinkofflineclipstovideofiles,audiofiles,andstill-
[Link],youcannotlinkanofflinecliptoastill-imagesequencedifferent
[Link],importnewstill-
imagesequences,andplacethemintotimelinesmanually.
Youcanlinkanofflineclipcontainingaudiotoasourcefilecontainingnoaudio.
Tolinktheaudioofanewsourcefile,thesourcefilemusthavethesametypeofaudiotrackastheofflineclip
.Forexample,iftheoffline
cliphasastereoaudiotrack,youcannotlinkittoasourcefilewithamonauralaudiotrack.
1. IntheProjectpanel,selectoneormoreofflineclips.
2. ChooseProject>LinkMedia.
3. Selectthesourcefile,andclickSelect.
4. Ifyouselectedasourcefilecontainingnoaudiotolinktoanofflineclipcontainingaudio,theMedia
Mismatchdialogboxappears.
Dooneofthefollowing:
TodeletetheaudiotrackfromallinstancesoftheofflineclipfromtheprojectclickOK.
Tocancellinkingtothesourcefile,andretaintheaudiotrackinallinstancesoftheofflineclip,clic
kCancel.
IntheProjectpanel,youcanchooseClip>[Link]
offline,[Link],youcanusetheRelinkcommandtolin
ktothedesiredtracks,whileleaving othersoffline.
TheSourceandProgramMonitorsprovidecontrolstoperformthree-pointandfour-pointedits—
standardtechniquesintraditionalvideoediting.
Inathree-
pointedit,youmarkeithertwoInpointsandoneOutpoint,[Link]’tha
vetoactivelysetthefourth point;it’[Link],inatypicalthree-
pointedityouwouldspecifythestartingandendingframesofthesourceclip
(thesourceInandOutpoints),andwhenyouwantthecliptobegininthesequence(thesequenceInpoint).
Wheretheclipendsinthesequence—theunspecifiedsequenceOutpoint—
[Link],anycombinationofthreepoints
[Link],sometimesthepointwhereaclipendsinasequenceismorecriticaltha
[Link],the
threepointsincludesourceInandOutpoints,[Link],ifyouneedthecl
iptobeginandendatparticular pointsinthesequence—say,perfectlyoveralineofvoice-
overnarration—youcouldsettwopointsinthesequence,andonlyonepointinthe source.
Inafour-pointedit,[Link]-
pointeditisusefulwhenthestartingandending
[Link]
Makeathree-pointedit
1. InaProjectpanel,double-clickacliptoopenitintheSourceMonitor.
2. ClicktheheadersofthetracksinaTimelinepanelintowhichyouwanttoaddthecliptotargetthem.
3. IntheTimeline,dragthesourcetrackindicatorstotheheadersofthetracksintowhichyouwanttheclip
componentstofall.
4. IntheSourceandProgramMonitors,markanycombinationofthreeInandOutpoints.
5. IntheSourceMonitor,dooneofthefollowing:
Toperformaninsertedit,clicktheInsertbutton .
Toperformanoverwriteedit,clicktheOverwritebutton .
Makeafour-pointedit
1. InaProjectpanel,double-clickacliptoopenitintheSourceMonitor.
2. ClicktheheadersofthetracksinaTimelinepanelintowhichyouwanttoaddthecliptotargetthe
m.
3. IntheTimeline,dragthesourcetrackindicatorstotheheadersofthetracksintowhichyouwantt
heclipcomponentstofall.
4. UsingtheSourceMonitor,markanInpointandanOutpointforthesourceclip.
5. IntheProgramMonitor,markanInpointandanOutpointinthesequence.
6. IntheSourceMonitor,dooneofthefollowing:
Toperformaninsertedit,clicktheInsertbutton
Toperformaninserteditandshiftclipsintargettracksonly,Alt-click(Windows)orOption-
click(MacOS)theInsertbutton .Toperformanoverwriteedit,clicktheOverwritebutton.
7. Ifthemarkedsourceandprogramdurationsdiffer,selectanoptionwhenprompted:
ChangeClipSpeed(FittoFill)
Maintainsthesourceclip’sInandOutpoints,butchangestheclip’sspeedsothatitsdurationmatc
hesthe durationdeterminedbythesequenceInandOutpoints.
TrimClip’sHead(LeftSide)
Automaticallychangesthesourceclip’sInpointsothatitsdurationmatchesthedurationdetermi
nedbythe sequenceInandOutpoints.
TrimClip’sTail(RightSide)
Automaticallychangesthesourceclip’sOutpointsothatitsdurationmatchesthedurationdeter
minedbythe sequenceInandOutpoints.
IgnoreSequenceInPoint
DisregardsthesequenceInpointyouset,andperformsathree-pointedit.
IgnoreSequenceOutPoint
DisregardsthesequenceOutpointyouset,andperformsathree-pointedit.
YoucanreplaceoneclipinaTimelinepanelwithanotherfromtheSourceMonitororabin,retaini
nganyeffectsthatwereappliedtotheoriginal clipinaTimeline.
Usingoneofthefollowingkeyboardmodifiers,dragaclipfromtheProjectpanelorSourceMonitorontoa
clipinaTimelinepanel:
TousetheInpointofthenewclip,Alt-drag(Windows)orOption-
drag(MacOS).YoumayusetheInpointofthenewclip,forexample,if
youhavealreadytrimmedittostartatthedesiredpointoftheaction.
ToapplytheInpointoftheoriginalcliptothenewclip,Shift-Alt-drag(Windows)orShift-
Option-drag(MacOS).YoumayapplytheInpoint oftheoriginalcliptothenewclip.
InaTimeline,clippositionandeffectsarepreserved,andanyeffectsthatwereappliedtotheoriginalclipa
reappliedtothereplacementclip.
[Link]
tsareautomaticallyremovedwhenyouperformaliftorextracteditfromtheProgramMonitor.
SetsequenceInandOutpoints
1. NavigatetotheInpointinaTimelinepanelandclicktheSetInPointbutton
intheProgramMonitor.
2. NavigatetotheOutpointinaTimelinepanelandclicktheSetOutPointbutton .
SetsequenceInandOutpointsaroundaselection
1. InaTimelinepanel,selectoneormoreclips,oragap,inthesequence.
2. ChooseMarker>SetSequenceMarker>[Link]
Outpointsthatmatchtheselection’sIn andOutpoints.
RemovesequenceInandOutpoints
1. MakesurethatthesequenceisopenintheProgramMonitor.
2. ChooseMarker>ClearSequenceMarker,andthenchooseanoptiontocleartheInpoint,theOutpo
int,orboth.
4. TRIMMING CLIPS
Settingaclip’[Link]
inasequencebymarkingthatframe
astheclip’[Link]
picalworkflow,youmarkInandOut pointsforaclipintheSourceMonitor.
Adjustingaclip'[Link],y
outrimclipstoadjusthowtheyplay
[Link],asyouviewtheedit,youwanttocuttotheincomingclipalittlesoonertha
nyouoriginallyplannedwhile [Link],trimtheclipusingtrimmingtools.
[Link]'s"edge"isaclip’sInorOutpoint,[Link]
alspecializedtoolsandtechniques
[Link],red
ucingthenumberofstepsinvolvedand maintainingtheintegrityofthesequence.
Youcanperformtrimmingtaskstoselectededitpointsofaclip,orselectededitpointsfrommultipleclips.
Therearenew
iconsforthetools,andwhenselectingeditswithtrimtools,theeditpointishighlightedwithacolorrelated
tothetrimyouperform.
TheSourceMonitorpanelholdsversatiletools,[Link]
techniquestoset,move,orremoveIn
andOutpoints,cuetheplayheadtoanyofthesepoints,orpreviewtheframesattheirlocations.
OpenaclipintheSourceMonitor
ToopenaclipintheSourceMonitor,dooneofthefollowing:
Double-clicktheclipintheProjectpanel.
Double-clicktheclipinaTimelinepanel.
OpenandviewrecentclipsfromtheSourceMonitor
[Link],youcanviewonlyoneclipatati
[Link] availablefromamenuatthetopoftheSourceMonitor.
1. IntheSourceMonitortab,clickthedownward-pointingtriangletoopenthetabmenu.
2. Selectthenameoftheclipyouwanttoview.
SetInpointsandOutpointsintheSourceMonitor
TosetanInPointorOutpointintheSourceMonitor,doanyofthefollowing:
TomarkanInpoint,[Link]
,orpresstheIkey.
TomarkanOutpoint,[Link]
n ,orpresstheOkey.
AfteryoumarkInandOutpoints,youcanalwayschangeyourmindbeforeyouedittheclipintothesequen
[Link]
[Link]
tbuttonstosetnewInorOut points.
MoveInpointandOutpointtogether
Dooneofthefollowing:
Foravideooraudioclip,intheSourceMonitortimeruler,dragtheIn/OutGrip(texturedareaatthe
centeroftheshadedspanbetween
theInandOutpoints).Makesurethatyoudragthetexturedarea;otherwise,yousimplycuethepla
yhead.
DraggingtheIn/OutGripforavideocliportrack
Foranaudioclip,youcanalsodragtheIn/OutGrip,orthegreyareabetweentheInpointandOutpo
intabovethewaveformtotheleft orright.
DraggingtheaudioIn/OutGripforanaudiocliportrack
TheInandOutpointsmovetogether,keepingthedurationbetweenthemconstant.
AdjustingeditpointsintheSourceMonitor
Sometimes,[Link]
eTimelineintotheSourceMonitor,
youcandragtheIn/[Link]
iqueisusefulforusingadifferent
[Link],[Link]
yworksonlywithclipsthatyou’veopenedintheSourceMonitorfromasequence.
1. SettheInandOutpointsintheSourceMonitor.
2. EdittheclipintotheTimeline.
3. DoubleclickthecliptoloaditintotheSourceMonitor.
4. DragtheIn/OutGrip(texturedareaatthecenteroftheshadedspanbetweentheInandOutpoints),a
syoudidinthesection,MoveInpoint andOutpointtogether.
Timelinetrimming
Forquicklytrimmingclips,[Link]
ortcutstoselectandadjusteditpoints.
Timelinetrimminghasbeenenhancedwiththeabilitytoselecteditpointsandadjustthemusingthemous
e,keyboard shortcuts,orthenumerickeypad.
OER:
[Link]/en/[Link]
[Link]/en/lessons/triming-on-the-timeline
Selectingeditpoints
Beforeyoucanusetimelinetrimmingtechniques,itisimportanttoselecteditpointsforclipsintheTimeli
[Link] selecteditpointswiththemouse,orbyusingkeyboardshortcuts.
Selectingeditpointswiththemouse
ClickingwiththemousetoselectaneditpointintheTimelineusesthelocationofthemousecursor,theacti
vetrimtool,andthemodifierkeys.
Dragging,asopposedtoclickingandreleasingthemousetoselectaneditpoint,bothselectsaneditpointa
ndperformsthetrim.
Selectiontool:
ClickingtheeditpointwiththeSelectiontoolchoosesaTrimInorTrimOuteditpointselection,de
pendingonwhichsideof [Link]-click(Windows)orCommand-
click(MacOS)ontheeditpointwiththeSelectiontool,thecursordisplaysa
[Link].
RippleEdittool:
ClickingtheeditpointwiththeRippleEdittoolchoosesaRippleInorRippleOuteditpointselecti
on,dependingonthe [Link]-
click(Windows)orCommand-click(MacOS)ontheeditpointwiththeRippleEdittool,the
cursorshowstheRippleEditorRollingEdittoolandchoosesTrimOut,Rolling,orTrimIndepen
dingonwhichsideoftheeditpointyou click.
RollingEdittool:
[Link]-
click(Windows)or Command-
click(MacOS)modifierisheldwiththeRollingEdittool,thecursorshowstheRippleEditorRolli
ngEdittoolandchoosesRipple
Out,Rolling,orRippleIn,dependingonwhichsideoftheeditpointyouclick.
Editcursorsforthevariousedittypes
[Link]
[Link]
YoucanperformarippleorrollingediteitherdirectlyonthetracksintheTimeline.
Aboutrippleandrollingedits
Whenyouwanttoadjustthecut,oreditpoint,betweentwoclips,usevariationsofsimpletrimmingknown
[Link],makeadjustmentsinasingleactionthatwould
[Link]
,theaffectedframesappearintheProgramMonitorsidebyside.
Furthermore,theeditpointisselectedwhenyouclickitwithaRippleEditorRollingEdittool.
ProgramMonitorandTimelineduringarollingedit
Rollingedit
ArollingedittrimsanadjacentOutpointandInpointsimultaneouslyandbythesamenumberofframes.T
hisactioneffectivelymovestheedit
pointbetweenclips,preservingotherclips’positionsintimeandmaintainingthetotaldurationoftheseq
[Link](Windows)orOption
(MacOS)whenyoubegintoperformarollingeditoverridesvideoandaudiolinking,allowingyoutocrea
teasplitedit(L-cutorJ-cut).
Inthisrollingedit,theeditpointismovedearlierintime—
shorteningthepreviousclip,lengtheningthenextclip,andmaintainingtheprogram duration.
Rippleedit
[Link]
rippleeditingshiftsallclipsafterthe
cutbackintime;conversely,[Link]’
remakingarippleedit,emptyspaceon
[Link](Windows)orOpti
on(MacOS)whenyoubeginto performarippleeditignoresthelinkbetweenvideoandaudio.
MakearollingeditusingtheRollingEdittool
1. SelecttheRollingEdittool .
2. InaTimelinepanel,[Link]
ramesaddedtotheclipare [Link]-drag(Windows)orOption-
drag(MacOS)toaffectonlythevideooraudioportionofalinkedclip.
Timelinepanelduring(above)andafter(below)arolledit
MakearippleeditusingtheRippleEdittool
1. SelecttheRippleEdittool .
2. InaTimelinepanel,positionthepointerovertheInorOutpointoftheclipyouwanttochangeuntilthe
appears,[Link],butt
heirdurationsremain [Link]-drag(Windows)orOption-
drag(MacOS)toaffectonlythevideooraudioportionofalinkedclip.
Timelinepanelduring(above)andafter(below)arippleedit
Makeslipandslideedits
Justasrippleandrollingeditsallowyoutoadjustacutbetweentwoclips,slipandslideeditsareusefulwhe
nyouwanttoadjusttwocutsina
[Link],theProgramMonitordisplaysthefourframesi
nvolvedintheeditsidebyside,except wheneditingaudioonly.
ProgramMonitorandTimelineduringaslideedit
ThoughSlipandSlidetoolsaretypicallyemployedonthecenterofthreeadjacentclips,eachtoolfunction
snormallyeveniftheclipisadjacentto aclipononesideandblankspaceontheother.
Makeaslipedit
Aslipeditshiftsaclip’sInandOutpointsforwardorbackwardbythesamenumberofframesinasingleacti
[Link],
youcanchangeaclip’sstartingandendingframeswithoutchangingitsdurationoraffectingadjacentclip
s.
Inthisslipedit,aclipisdraggedleft,movingitssourceInandOutpointslaterintime.
1. SelecttheSliptool .
2. Positionthepointerontheclipyouwanttoadjust,anddraglefttomovetheInandOutpointslaterinthe
clip,ordragrighttomovetheIn andOutpointsearlierintheclip.
Slipaclipwithkeyboardshortcuts
[Link],selectac
lip(ormultipleclips),andthendothe following:
Toslipclipselectionleftfiveframes:
PressCtrl+Alt+Shift+Left(Windows).
PressOption+Shift+Command+Left(MacOS).
Toslipclipselectionleftoneframe:
PressAlt+Shift+Left(Windows).
PressOption+Command+Left(MacOS).
Toslipclipselectionrightfiveframes:
PressCtrl+Alt+Shift+Right(Windows).
PressOption+Shift+Command+Right(MacOS).
Toslipclipselectionrightoneframe:
PressAlt+Shift+Right(Windows).
PressOption+Command+Right(MacOS).
Makeaslideedit
[Link]
pleftorrightwiththeSlidetool,theOut
pointoftheprecedingclipandtheInpointofthefollowingcliparetrimmedbythenumberofframesyoum
[Link]’sInandOut points(andhence,itsduration)remainunchanged.
Inthisslideedit,aclipisdraggedleftsothatitstartsearlierinthesequence,shorteningtheprecedingcli
pandlengtheningthefollowingclip.
1. SelecttheSlidetool .
2.
Positionthepointerontheclipyouwanttoadjust,anddraglefttomovetheOutpointoftheprecedingclipa
ndtheInpointofthefollowing
clipearlierintime,ordragrighttomovetheOutpointoftheprecedingclipandtheInpointofthefollowingc
liplaterintime.
Whenyoureleasethemouse,itupdatestheInandOutpointsfortheadjacentclips,displayingtheresultint
heProgramMonitor
[Link]
sequence.
Slideaclipwithkeyboardshortcuts
[Link],select
aclip(ormultipleclips),andthendo thefollowing:
Toslideclipselectionleftfiveframes:
PressAlt+Shift+,(Windows).
PressOption+Shift+,(MacOS).
Toslideclipselectionleftoneframe:
PressAlt+,(Windows).
PressOption+,(MacOS).
Toslideclipselectionrightfiveframes:
PressAlt+Shift+.(Windows).
PressOption+Shift+.(MacOS).
Toslideclipselectionrightoneframe:
PressAlt+.(Windows)
PressOption+.(MacOS).
5. CREATING SPECIAL CLIPS
Ifyouplantocreatefilmoutputfromasequence,[Link]
helpsaprojectionistverifythataudio
[Link]
leadertoaddtothebeginningofa project.Theleaderis11secondslong.
1. IntheProjectpanel,clicktheNewItembutton
atthebottomoftheProjectpanelandchooseUniversalCountingLeader.
2. IntheNewUniversalCountingLeaderdialogbox,setWidth,Height,Timebase,PixelAspectRat
io,andSampleRatetomatchthesesame
[Link].
3. IntheUniversalCountingLeaderSetupdialogbox,specifythefollowingoptionsasneeded:
WipeColor Specifiesacolorforthecircularone-secondwipearea.
BackgroundColor Specifiesacolorfortheareabehindthewipecolor.
LineColor Specifiesacolorforthehorizontalandverticallines.
TargetColor Specifiesacolorforthedoublecirclesaroundthenumeral.
NumeralColor Specifiesacolorforthecountdownnumeral.
CueBlipOnOut Displaysacuecircleinthelastframeoftheleader.
CueBlipOn2 Playsabeepatthetwo-secondmark.
CueBlipAtAllSecondStarts Playsabeepatthebeginningofeverysecondduringtheleader.
4. ClickOK.
Createcolorbarsanda 1-kHztone
Youcancreateaone-secondclipcontainingcolorbarsanda1-
kHztone,asareferenceforcalibratingvideoandaudioequipment.
1. IntheProjectpanel,clicktheNewItembutton
atthebottomoftheProjectpanelandchooseBarsAndTone.
2. IntheNewSyntheticdialogbox,setWidth,Height,Timebase,PixelAspectRatio,andSampleRatet
omatchthesesamesettingsforthe [Link].
Someaudioworkflowsmustbecalibratedataspecifictonelevel.Thedefaultlevelofthe1-kHztoneis-
[Link]
cancustomizethetoneleveltomatchyouraudioworkflowbychoosingClip>AudioOptions>AudioGai
[Link]
barsandtoneclipintheProjectpanel,[Link]
inaTimelinepanel,youchangethe levelforthatclipinstanceonly.
HDcolorbarswhichcomplywithARIBSTD-
B28standardforcalibratingvideooutput.Thesyntheticalsoincludea1- kHztone.
ForHDbarsandtone,dothefollowing:
1. ChooseFile>New>HDBarsandTone.
2. [Link],orclickOKtoaccept
thesettings.
Createblackvideo
[Link]
cessary,youcanalsocreateclipsof
[Link]
lipofadifferentcolor,useacolor matte.
1. IntheProjectpanel,clicktheNewItembutton
atthebottomoftheProjectpanelandchooseBlackVideo.
2. Ifnecessary,intheNewBlackVideodialogbox,setWidth,Height,Timebase,andPixelAspectRati
otomatchthesesettingsforthe
[Link],thedurationofthenewclipissettofives
[Link].
YoucanchangethedefaultdurationofblackvideoclipsandotherstillimageclipsintheGeneralpaneofth
ePreferencesdialogbox.
Createacolormatte
1. IntheProjectpanel,clicktheNewItembutton
atthebottomoftheProjectpanelandchooseColorMatte.
2. IntheNewSyntheticdialogbox,setWidth,Height,Timebase,andPixelAspectRatiotomatchtheses
ettingsforthesequenceinwhichyou [Link].
3. IntheColorPicker,selectacolorforthecolormatte,andclickOK.
Createatransparentvideoclip
TransparentVideoisasyntheticclipjustlikeBlackVideo,BarsandTone,[Link]
ndywhenyouwanttoapplyaneffect
thatgeneratesitsownimageandpreservestransparency,suchastheTimecodeeffectortheLightningeff
[Link] “ClearMatte.”
OER: [Link]/tutorials/89
YoucannotapplyjustanyeffecttoTransparentVideo—onlythosethatmanipulatethealphachannel.
1. IntheProjectpanel,clicktheNewItembutton
atthebottomoftheProjectpanelandchooseTransparentVideo.
2. IntheNewSyntheticdialogbox,setWidth,Height,Timebase,andPixelAspectRatiotomatchtheses
ettingsforthesequenceinwhichyou [Link].
3. FromtheProjectpanel,dragthetransparentvideocliptothehighesttrackinasequence,stretchitasfar
asyouwant,andapplyaneffect toit.
Moveclips
[Link]
erofclipsoncetheyarethere, replacethem,removethem,orinsertadditionalclips.
MoveclipsinaTimelinepanel
[Link]
[Link]
translucentrectanglethatrepresentstheclip’[Link],selectarang
eofclips,ormoveagroupofclips.A
[Link]
gthecliptowardthebeginningofthe sequence,andapositivenumberiftowardtheend.
OverwriteisthedefaultmodeandisindicatedbytheOverwriteicon
[Link](Windows)orCommand(MacOS)asyoudropaclipperformsaninse
[Link]
appearswhenyoudragclipswhilepressingCtrl(Windows)orCommand(MacOS).
Bydefault,youcanchangethetracklocationofeitherportionofaclip,audioorvideo,bydraggingthatport
[Link]
[Link],however,eitherbypressingShiftwhileyoudrag,orbydragg
ingverticallyacrossthebarthat
[Link],it
willsnaptoitsoriginaltimelocation inthenewtrack,ifSnapisturnedon.
Dooneofthefollowing:
Tomovetheaudioportionofacliptoadifferenttrack,dragtheaudioportionoftheclipverticallyt
othedestinationaudiotrack.
Tomovethevideoportionofacliptoadifferenttrack,dragthevideoportionoftheclipverticallyt
othedestinationvideotrack.
TomovethevideoportionofacliptoVideo1andmovetheaudioportiontoadifferentaudiotrack,
dragthevideoportiondownwardpast
thebarseparatingvideoandaudiotracks.ThevideoportionwillremaininVideo1whiletheaudi
oportionwilllandintheaudiotrackwhere youdropit.
TomovetheaudioportionofacliptoAudio1andmovethevideoportiontoadifferentvideotrack,
dragtheaudioportionupwardpastthe
barseparatingvideoandaudiotracks.TheaudioportionwillremaininAudio1whilethevideopo
rtionwilllandinthevideotrackwhereyou dropit.
Toplacethevideoandaudioportionsofaclipintotracksyouspecify,dragthevideoportiontothe
[Link]
[Link]
downwardpastthebarseparatingvideoand
[Link]
stinationaudiotrack.
Tooverwriteotherclips,dragoneormoreclipsanddropthemonthetrackwheretheotherclipsar
elocated.
Tomoveonlyonetrackofalinkedclip,pressAlt(Windows)orOption(MacOS)anddragthepart
oftheclip,audioorvideo,youwantto
[Link](Windows)orOption(MacOS)keyafteryouinitiatetheedi
[Link].
Toinsert,dragoneormoreclips,andpressCtrl(Windows)orCommand(MacOS)asyourelease
themousebuttonanddroptheclipor
[Link]
[Link] whichyoumovetheinsertedclips.
Moveclipsusingthekeypad
Youcanchangethepositionofaclipinasequencebytypingthenumberofframesthatyouwanttomove.
1. Selecttheclipinthesequence.
2. UsingyournumerickeypadwithNumLockon,type+(plus)andthenumberofframesthatyouwantto
movethecliptotheright,ortype-
(minus)[Link],pressEnter(Windows)or
Return(MacOS).
Ifanygapsexistbetweenclips,[Link],theselectedclipoverwritesadjacentclipsb
ytheremainingnumberof frames.
Moveclipstoadifferenttrack
[Link]
ipyoudragwillmoveintoanew track.
Whendraggingaudio,youcandropitintothenextcompatibletrack,orifonedoesn’texist(forexample,if
youaredraggingstereoaudio andonlyamonotrackexists),anewoneiscreated.
RearrangeclipsinaTimelinepanel
[Link]
geeditextractsaclipandinsertsitinto
[Link],onlyclipsinthedestinationtrackareshifted;clipsinothertracksarenotaffecte
[Link]
changetheorderofclipsinasequence,[Link]
Dragaclip;thenpressCtrl+Alt(Windows)orCommand+Option(MacOS)asyoudropittoanew
location.
AsyoupressCtrl+Alt(Windows)orCommand+Option(MacOS),theRearrangeicon
[Link] shiftsclipsinthedestinationtracksonly.
Split or cut oneor moreclipswith the Razortool
YoucanusetheRazortooltocutaclipintotwoclips,[Link]
aclipcreatesanewandseparate
instanceoftheoriginalclip,[Link],bu
twithdifferentInandOutpoints.
Doanyofthefollowing:
Tosplitasinglecliporlinkedclip,selecttheRazortool
,andclickthepointinthesequencewhereyouwanttosplittheclip.
Tosplitonlytheaudioorvideoportionoflinkedclips,Alt-click(Windows)orOption-
click(MacOS)withtheRazortool.
Tosplitclipsontargetedtracks,[Link]
layheadwhereyouwanttosplittheclip
orclips,andchooseSequence>[Link],pressCtrl+K(Windows),orCom
mand+K(MacOS).
Tosplitclipsonallexceptlockedtracks,lockanytrackcontainingaclipthatyoudon’twanttosplit
.ChooseSequence>[Link]+Shift+K(Windows),orCommand+Shift+K
(MacOS).YoucanalsoShift-click
withtheRazortooltosplitalltracksatthesamepointinaTimelinepanel.
Removeclipsfrom asequence
Toremoveentireclips,selectoneormoreclipsinthesequenceandpressDelete.
Lift andpasteframes
Youcanremoveorliftframesfromaspecifiedareaofoneormoretracksinasequence,leavingagapinth
[Link]
[Link],thatpar
twillbeliftedfromthesequence
[Link].
1. UsethecontrolsintheProgramMonitortospecifysequenceInandOutpoints.
2. IntheTimeline,clicktheheadersofthetracksfromwhichyouwanttoliftframestotargetthem.
3. IntheProgramMonitor,clicktheLiftbutton .
4. Theframesthatareliftedareplacedonthesystemclipboard.
5. Clicktheheaderofthetrackintowhichyouwanttopastetheliftedframestotargetit.
6. Movetheplayheadtothelocationwhereyouwanttopastetheliftedframes.
7. SelectEdit>Paste.
Extractandpasteframes
Youcanextractframesfromaspecifiedareaofoneormoretracksinasequence,leavingnogapintheirpl
[Link]
[Link]
,PremiereProwillextractonlythat
partoftheclipfromthesequence,[Link],youcanpastetheext
ractedframesanywhereinasequence.
1. UsethecontrolsintheProgramMonitortospecifysequenceInandOutpoints.
2. IntheTimeline,clicktheheadersofthetracksfromwhichyouwanttoextractframestotargetthem.
3. [Link]
psintrackswhereSyncLockis disabledwillnotshift.
4. IntheProgramMonitor,clicktheExtractbutton .
5. Clicktheheaderofthetrackintowhichyouwanttopastetheextractedframestotargetit.
6. Movetheplayheadtothelocationwhereyouwanttopastetheextractedframes.
7. SelectEdit>Paste.
Deleteclipsandclosegapssimultaneously
Whenyoudeleteaclip,[Link]
e.
1. Inthesequence,[Link],Shift-
clicktheclipsordragamarqueeoverthem.
2. SelectEdit>RippleDelete.
Deletegapsbetweenclips
WhenyoudeletespacebetweenclipsinaTimeline,allclipsinallunlockedtracksshiftaccordingtothed
[Link]
fromshiftingduringarippledelete(oranyinsertorextractedit),[Link],turnoffSy
ncLockonthosetracksthatyoudon'twant toshift.
InaTimeline,dooneofthefollowing:
Right-click(Windows)orCtrl-
click(MacOS)thegapbetweentwoclips,andchooseRippleDelete.
Selectthegapbetweentwoclips,andchooseEdit>RippleDelete.
Selectthegapbetweentwoclips,andpressDelete.
Iftherippledeletecommandfails,youmayneedtolocktracksthatcontainconflictingclipsalongtheedi
tpoint.
Deleteallclipson onetrack
1. SelecttheTrackSelecttool .
2. Dooneofthefollowing:
Todeleteboththeaudioandvideooflinkedclips,clickthefirstclipinthetrack.
Todeleteonlyonetrack’sclipsandnotthelinkedcounterparts,Alt-
click(Windows)orOption-click(MacOS)thetrack’sclips.
3. PressDelete.
Youcanalsodeleteatrackalongwitheverythingitcontains.
7. RENDERING SEQUENCES
Real-time,fullframe-rateplaybackisnotalways
possibleforcomplexsectionswithoutpreviewfiles:unrenderedsections.
Toplaybackcomplexsectionsinrealtimeandatfullframerate,youmayhavetofirstrenderpreviewfile
[Link] softwaremarks
[Link]
fasequenceindicatesanunrenderedsectionthatprobablymustberenderedinordertoplaybackinrealt
[Link]
[Link]
y,
[Link]
nrenderbarindicatesasectionthat alreadyhasrenderedpreviewfilesassociatedwithit.
[Link]
esintheWindowsorMacfilebrowser
ratherthantheProjectpanel,you’llbepromptedtofindorskipthepreviewfilesthenexttimeyouopenth
eproject.
Workareafor rendering
Doanyofthefollowing:
[Link]
eabarfromitstexturedcenter;otherwise youcuetheplayheadinstead.
Grabbingtheworkareabar(above)anddraggingitoverthesectiontopreview(below)
Dragtheworkareamarkers(ateitherendoftheworkareabar)tospecifythebeginningandendo
ftheworkarea.
Draggingtheworkareamarkerstoexpandtheworkarea
Positiontheplayhead,andpressAlt+[(Windows)orOption+[(MacOS)tosetthebeginningof
theworkarea.
Positiontheplayhead,andpressAlt+](Windows)orOption+](MacOS)tosettheendofthewo
rkarea.
Double-
clicktheworkareabartoresizeittoeitherthewidthofthetimeruler,orthelengthoftheentireseq
uence,[Link]
definethewholesequenceastheworkarea,thewholesequencemustbevisibleintheTimelinep
anel.
When
settingtheworkareabartodefineanareaforrendering,correspondingoptionsappearintheSequence
menu:
RenderEffectsinWorkArea,[Link]
[Link]
willnotappearintheSequencemenuiftheworkareabarisnotenabled.
YoucanmarkInandOutpointstodefineanareaforrendering:
MarkInandOutpointsfortheareaofthesequencethatyouplantorender.
WhenmarkingInandOutpointstodefineanareaforrendering,correspondingoptionsappearintheSe
quencemenu:RenderEffectsInto
Out,[Link]
willnotappearintheSequence menuiftheworkareabarisenabled.
[Link]
[Link]
erbysettingIn andOutpoints.
RenderapreviewfileforasectionofasequencesettingInandOutpoints:
1. SetInandOutpointstomarktheareayouwanttopreview.
2. ChooseSequence,andselectoneofthefollowing:
RenderEffectsIntoOutRendersthesectionsofthevideotrackslyingwithintheInandOutpoi
ntscontainingaredrenderbar. Alternatively,pressEnter.
RenderIntoOutRendersthesectionsofthevideotrackslyingwithintheInandOutpointscont
ainingeitheraredrenderbarorayellow renderbar.
RenderAudioRendersapreviewfileforthesectionsoftheaudiotrackslyingwithintheworka
rea.
Therenderingtimedependsonyoursystemresourcesandthecomplexityofthesegment.
Theseoptionsarenotavailableiftheworkareaisenabled.
Renderaudio whenrenderingvideo
Bydefault,the
audiotracksdoesnotrenderwhenyouselecteitherSequence>RenderEffectsInWorkArea,orSequen
ce>Render
[Link],playbackmaysufferwhenthedatathroughputofyourdiskdrivecannots
ustaintheflowwhenmixingmultiple
[Link]
automaticallyrendersaudiopreviews wheneveritrendersvideopreviews.
1. SelectEdit>Preferences>General(Windows)orPremierePro>Preferences>General(MacOS).
2. SelectordeselectRenderAudioWhenRenderingVideo.
3. ClickOK.
Adobe Premiere Pro's export dialog features several rendering options that are not widely
understood. All of them are switched off by default because they either degrade quality or
increase rendering times, however they can all be useful in particular situations.
Render at Maximum Depth
This renders content at 32-bit color depth. Very few output formats actually support 32-bit
color but processing at this depth can produce better quality for compositing and effects
operations before being scaled back to the output format's bit depth. It can reduce or eliminate
artifacts and banding in your video but that benefit comes at the cost of an increase in
Your source media has a higher bit depth than the format you are outputting to.
Your sequence contains heavy compositing or lots of layered effects (particularly 32-
Your sequence contains very high contrast or very low contrast images.
OER: [Link]
Maximum Render Quality
This is a high-quality resize operation that should be used when outputting to a different frame
size from your sequence. It can reduce aliasing (jagged edges) when resizing images but is of
no use when outputting to the same frame size. This operation significantly increases render
Frame Blending
This option smooth out juddery motion when exporting to a different frame rate than your
sequence. While it may improve motion quality compared to not having it switched on, it's not
considered a high quality option. You will probably get better results from exporting with the
sequence frame rate and then converting in Adobe Media Encoder, Apple Compressor.
9. MEMORY SETTINGS
In the Preferences dialog for Premiere Pro there is a section called Memory that allows you to
specify how Premiere Pro and other Adobe applications will use your RAM.
Premiere will allow itself a certain percentage of memory by default and you can decrease this
by increasing the RAM reserved for other applications and the operating system. This is a
memory pool so the RAM is assigned between them. Premiere and After Effects are assigned
the highest priority within the pool so closing these applications can improve performance in
Adobe applications are designed to share data in real-time through dynamic linking so it is
common for users to run multiple apps at once. It is therefore recommended to set these
settings as high as possible. The default is around 70-75% of total RAM. Note that it's
possible for third-party plugins and importers to exceed the memory limit.
If you install additional memory in your system and it is not reflected in the Memory dialog,
~/Library/Preferences/Adobe/dynamiclinkmanager/6.0/[Link]
C:\Users\username\AppData\Roaming\Adobe\dynamiclinkmanager\6.0.
In the Memory pane you can also optimize rendering for performance or memory. In
performance mode Premiere runs several tasks in parallel and uses all of your processor cores
(up to 16). In memory mode it runs fewer tasks simultaneously so these settings will lower
4. How to split or cut one or more clips with the razor tool, explain?
7. Briefly explain the use of Selection tool, ripple Edit tool, rolling Edit tool?
References
[Link]
[Link]
[Link]
[Link]
in-Premiere-Pro
[Link]
[Link]
[Link]
[Link]
[Link]
Unit : 5
Introduction
Learning Outcomes
1. Overview of Audio
3. Audio Meters
References
INTRODUCTION
Dear students creating engaging audio is essential in video production because it produces an
emotional context through music and sound design and moves the story forward through
dialogue and natural audio. The sound you use has a big impact on your videos. Adobe Premier
Pro provides you with the tools to narrate clips while previewing them in real time; create, add,
and modify sound tracks; and control the volume levels within clips. This unit helps you explore
the basics of working with audio. Clips in higher-numbered video track covers what is below
them but clips in audio tracks all play together in the timeline. If you have 10 layered audio
tracks loaded up with a variety of audio clips and do nothing to them in terms of adjusting
volume levels and stereo panning, they will all play as one grand symphony. Students it is much
easier to use the Audio Mixer to adjust volume levels and other characteristics for multiple audio
tracks. You can edit audio, add effects to it, and mix as many tracks of audio in a sequence as
Dear student the tracks can contain mono or 5.1 surround channels. In addition, there are
standard tracks and adaptive tracks. The standard audio track can cope with both mono and
stereo in the same track. That is, if you set your audio track to standard, you can use footage with
different types of audio tracks on the same audio track. You can choose different kinds of tracks
for different kinds of media. For example, you could choose for mono clips to be edited only
onto mono tracks. You can choose for multichannel mono audio be directed to an adaptive track
by default.
Dear students whether it’s an audio-only file or the audio channel of a video clip, learn how to
enable sub-frame audio scrubbing and trimming. Dear student in this unit you will learn to
In this lesson, students will take their skills a step further and learn how to
Understand the difference between audio clip and audio track editing.
Know how to monitor audio level by using the Audio Meters panel.
Inediting
software,youcaneditaudio,addeffectstoit,andmixasmanytracksofaudioinasequenceasyourcompute
Toworkwithaudio,[Link]
deoclipsthatcontainaudio.
Aftertheaudioclipsareinaproject,[Link]
nalsoviewthewaveformsof
[Link]
meandpan/balancesettingsofaudio
[Link]
[Link]
[Link],considerorganizi
ngthemintosub-mixesandnested sequences.
[Link],and5.1s
urroundaudio tracks,therearenowstandardtracks,andadaptivetracks.
Asequencecancontainanycombinationofthefollowingaudiotracks:
Standard
[Link]
[Link] containbothmonoandstereoclips,butnotadaptiveor5.1clips.
Mono(monophonic)
[Link],thestereotrackisconvertedtoamonot
rack.
Adaptive The adaptive track can contain both mono and stereo tracks.
Withadaptivetracks,youcanmapsourceaudiotooutputaudiochannels in
[Link]
atrecordmultipleaudiotracks.
Adaptivetrackscanalsobeusedwhenworkingwithmergedclips,ormulticamsequences.
5.1 Containsthefollowing:
i. Threefrontaudiochannels(left,center,andright)
ii. Tworearorsurroundaudiochannels(leftandright)
iii. Alow-frequencyeffects(LFE)audiochannelroutedtoasubwooferspeaker.
Clipscancontainoneaudiochannel(mono),twoaudiochannels—
leftandright(stereo),orfiveaudiosurroundchannelswithalow-frequency
effectsaudiochannel(5.1surround).[Link],a
lltheaudioismixedtothetrackformat (mono,stereo,or5.1surround)ofthemastertrack.
View audio data
Youcanviewand
[Link]
tthetrackdisplayissettoShow TrackKeyframesorShowTrackVolume.
Inaddition,audiotracksinaTimelinepanelcontainwaveforms,whicharevisualrepresentationsofaclip’
[Link] waveformshowstheamplitude(loudnessorquietness)oftheaudio—
thelargerthewaveform,[Link]
audiotrackishelpfulforlocatingspecificaudioinaclip.
Toviewawaveform,expandtheaudiotrackbyclickingthetrianglenexttotheaudiotrackname.
Clicktriangletoexpandaudiotracktoviewaudiowaveform,trackname,andrubberband.
Viewaudioclips
Youcanviewanaudioclip’sVolume,Mute,orPantimegraphsandits
[Link]
SourceMonitor,[Link]
[Link] settingisusefulforeditingaudioatsmallerincrementsthanframes.
Doanyofthefollowing:
ToviewtheaudiowaveformofaclipinaTimelinepanel,clickthetriangletotheleftoftheaudiotrac
knameandclicktheSetDisplay
Styleicon undertheToggleTrackOutputicon .ThenchooseShowWaveform.
ToviewanaudioclipintheSourceMonitorwhentheclipisinaTimelinepanel,double-
clicktheclip.
ToviewanaudioclipintheSourceMonitorwhentheclipisintheProjectpanel,double-
clicktheclip,ordragthecliptotheSource
[Link],youcanviewitsaudiointheSourceMonitorbyclicking
theSettingsbuttonandselecting AudioWaveform.
Makingquickaudio adjustments
featuredaudiomixer,[Link],when
creatingaroughcutfromvideoandaudiocapturedtogetherfromDVfootage,outputtostereotracks,follo
wtheseguidelines:
i. StartwiththeMastermetersandvolumefaderintheAudioMixer.
ii. Iftheaudioistoofarbelow0dBortoohigh(theredclippingindicator
appears),adjustthelevelofclipsortracksasneeded.
ToggleTrackOutputiconinaTimelinepanel.
iv. To temporarilysilenceallothertracks,usetheSolobuttonintheAudioMixer.
Whenmakingaudioadjustmentsofanykind,determinewhetherthechangeisappliedto
i. UsetheShow/HideTrackscommandintheAudioMixermenutodisplayonlythe
informationyouwanttoseeandsavescreenspace.
ii. Ifyou
aren’tusingEffectsandSends,youcanhidethembyclickingthetriangleattheleftedgeoftheAudi
oMixer.
IntheAudioMixer,[Link]
udioMixertrackcorrespondstoatrack
[Link]
ucanrenameatrackbydouble-
[Link]’stracks.
AudioMixer
[Link]/balancecontrol
[Link]/SoloTrack/EnableTrackForRecordingbuttons
[Link] E. Track [Link]
[Link]
Bydefault,theAudioMixerdisplaysallaudiotracksandthemasterfader,andtheVUmetersmonitoroutp
[Link] representsthetracksintheactivesequenceonly,notallproject-
[Link],
setupamastersequenceandnestothersequenceswithinit.
Audiomixerplaybackcontrols
[Link]/StopToggle
[Link]
[Link]
parateAudioMeterspanelanddockit
[Link]
oMixerortheMasterFadersectionis notvisible.
AudioMixer
[Link]/[Link] [Link]
[Link]
ModifytheAudioMixer
1. ChooseanyofthefollowingfromtheAudioMixermenu:
Todisplayorhidespecifictracks,chooseShow/HideTracks,usetheoptionstomarkthetracksyou
wanttoseeandclickOK.
TodisplayhardwareinputlevelsontheVUmeters,chooseMeterInput(s)[Link]
chosen,youcanstillmonitoraudioinPremiereProforalltracksthataren’tbeingrecorded.
Todisplaytimeinaudiounitsinsteadofvideoframes,[Link]
ecifywhethertoviewsamplesor
millisecondsbychangingtheAudioDisplayFormatoptionintheGeneraltaboftheProjectSettingsdialog
[Link]
UnitsoptionaffectsthetimedisplaysintheAudioMixer,Sourcepanel,Programpanel,andTimelinepane
l.
TodisplaytheEffectsAndSendspanel,clicktheShow/HideEffectsAndSendstrianglealongthel
eftsideoftheAudioMixer.
Toaddaneffectorsend,clicktheEffectSelectionorSendAssignmentSelectiontriangleintheEff
[Link] aneffectorsendfromthemenu.
2. Right-
clickthepanelandusethemenutosetthevisualmeteringmode,peakdisplay,valleyindicatordisplay,and
decibelrange.
MonitorspecifictracksintheAudioMixer
ClicktheSoloTrackbuttonforthecorrespondingtracks.
OnlythetrackswiththeSoloTrackbuttonenabledaremonitoredduringplayback.
YoucanalsosilenceatrackusingtheMuteTrackbutton.
3. AUDIO METERS
AudioMeterpanel
[Link](gradientsinthemeterpanel) [Link]
[Link]
1. SelectWindow>AudioMeters.
2. Right-clickthepanelandusetheoptionstodothefollowing:
[Link],thepeakindicatorisupdatedcon
stantlywithathree-second
[Link],thepeakindicatordisplaystheloudestpeakuntiltheindicatorisresetor
playbackisrestarted.
Viewvalleyindicatorsatlowamplitudepoints.
ViewLEDMeters(meterappearswith colorsegments)
Setadecibelrangefromtheavailableoptions
Note: TheaudiometersprovideinformationaboutboththeSourceandProgrammonitors.
SetmonitoringoptionsfortheAudioMeterspanel
Right-clicktheAudioMeterspanel,andchooseadesiredoptionfromthemenu.
SoloinPlace
[Link],soloingtheright-
surroundin5.1,youhear onlythischanneloutoftheright-
[Link]
ayed intheTimelinepanel.
MonitorMonoChannels
Allowsyoutolistentoonespecificchanneloutofbothyourstereomonitoringspeakers,regardlessofitsas
signment.
MonitorStereoPairs
[Link],foran8-
channelmulti-
channelmastersequence,youcanmonitorjustchannels3and4outoftheleftandrightspeakers.
Audio channelicons
TheseiconsappearontheAudioChannelstaboftheModifyClipdialogbox,andintheAudioOutputMapp
ingdialogbox. Thefollowingiconsindicatechannelmappingforstereomixes:
Leftstereochannel
Rightstereochannel
Thefollowingiconsindicatechannelmappingfor5.1surroundmixes:
Leftfrontchannel
Rightfrontchannel
Leftsurroundchannel
Rightsurroundchannel
Centerfrontchannel
Lowfrequencyeffectschannel
[Link]
[Link]
mappings,gain,speed,duration,andinterpretfootageadjustmentsintheoriginalmasterclipsareappliedt
othenew,extractedaudioclips.
1. IntheProjectpanel,selectoneormoreclipscontainingaudio.
2. ChooseClip>AudioOptions>ExtractAudio.
PremiereProgeneratesnewaudiofilescontainingtheextractedaudio,withtheword“Extracted”addedto
theendofthefilenames.
Youcanselectanaudioclipinasequenceandgenerateanewaudioclipthatreplacestheoneyouselected.T
henewaudioclipcontainsany
[Link],then
ewclipcontainsonlythetrimmed audioinsteadoftheentireaudiooftheoriginalmasterclip.
1. Selectanaudioclipinasequence.
2. ChooseClip>AudioOptions>RenderAndReplace.
[Link](eitheraudiocliporvideocli
pcontainingaudio)inthe Projectpanelisuntouched.
Breakallstereotracksintomonotracks
PremiereProcanautomaticallybreakoutindividualstereoandsurroundchannelstodiscretemonauralcli
psaseachclipiscapturedorimported.
1. ChooseEdit>Preferences>Audio(Windows)
2. IntheSourceChannelMappingarea,chooseMonofromtheDefaultTrackFormatmenu.
3. ClickOK.
[Link],
youcanapplyamonocliptoapair ofleftandrightstereochannels.
1. IntheProjectpanel,selectamonoclip.
2. ChooseClip>Modify>AudioChannels.
3. IntheModifyClipdialogbox,selectMonoAsStereo,andthenclickOK.
Ifyouhaveastereoclipwithsoundrecordedinonlyonechannel,orifyouhaveastereoclipthathassoundin
onechannelthatyouwantto
replacewiththesoundfromtheotherchannel,youcanusesourceclipchannelmapping,theFillLeftaudiof
ilter,ortheFillRightaudiofilter.
[Link]
linkaudioclipsinasequence,youlink
[Link].
[Link]
effects,includingVolumeandPanning
effects,[Link]
ngtheothers,out-of-syncindicators appear.
Indicatorsappearwhenlinkedclipsarenolongersynchronized.
[Link]-
cliplink,[Link]
[Link],theSourceMo
nitortimelinedisplaysmarkersonly [Link]-
cliplinkfromtheProjectpanel,youcanusetheOverlayorInsertbuttonstoaddthelinkedclipstoseparatetr
acksinaTimelinepanel.
Choosingtrackofmulti-cliplinkinSourceMonitor
TheEffectControlspaneldisplaysallthevideoandaudiotracksinamulti-
[Link]
applyeffectsfromtheEffectspaneltoaspecificgroupintheEffectControlspanel.
Effectsappliedtoaudiotracksinmulti-cliplinkdisplayedinEffectControlspanel
Linkaudio clips
[Link]
ylinked,suchasanaudioclip linkedtoavideoclip,theymustbeunlinkedbeforeyoucancreateamulti-
cliplink.
1.
Ifnecessary,selecteachlinkedvideoandaudioclip,andchooseClip>Unlink.InAdobePremiereProCS5
.5andlater,youmayselect multipleclips,andchooseClip>Unlink.
2. Dooneofthefollowing:
[Link]-
clicktoselectavideoclip.
Shift-clicktoselectmorethanoneaudiocliponseparatetracksinaTimelinepanel.
Allaudioclipsmusthavethesametrackformat(mono,stereo,or5.1surround).
3. ChooseClip>Link.
6. EDITING AUDIO IN A TIMELINE PANEL
InandOutpointsaresetattime-basedivisions—thatis,[Link]-
basededitsareusuallyadequateforaudioas
well,[Link],youmaywanttoplaceanInpointbetweentw
owordsinasentence,butthetiny
divisionbetweenwordsdoesn’[Link],digitalaudioisn’tdivide
dintoframes,butintoaudiosamples,which
[Link]’sorsequence’stimerulertoaudiosamples,y
oucansetmorepreciseaudioInand Outpoints.
SourceMonitorsettodisplayaudiounitsformorepreciseeditingofanaudioclip
SwitchatimerulertoaudiounitsintheSourceorProgramMonitor
IntheSourceorProgramMonitorpanelmenu,chooseShowAudioTimeUnits.
Navigateaudioinsampleview
1. SwitchthetimerulerintheSourceMonitororTimelinepaneltoaudiounits.
2. Tonavigate,dooneofthefollowing:
Dragthecurrent-timeindicator inthetimerulertonavigatesmoothlythroughtheclip.
ClicktheStepForwardorStepBackbuttonstomovethecurrent-timeindicator oneaudiosampleatatime.
3.
Tozoominorout,drageitherendoftheviewingareabarinthetimeruleroftheSourceMonitororTimelinep
anel.
TrimaudioinsampleviewinaTimelinepanel
1.
InaTimelinepanelmenu,[Link]
mMonitorswitchtoasample- basedscale.
2. Ifnecessary,expandtheaudiotrackcontainingtheclipyouwanttoedit,clicktheSetDisplayStylebutton
,andchooseShowWaveform.
3.
ViewtheaudioInpointorOutpointoftheclipyouwanttoeditindetailbydraggingthezoomslidertotherig
ht.
4. Trimtheclipbydoingoneofthefollowing:
ToadjusttheInpoint,positionthepointerovertheleftedgeoftheclip’saudiosothatthetrimheadtool
appears,anddragleftorright.
ToadjusttheOutpoint,positionthepointerovertherightedgeoftheclip’saudiosothatthetrimtailicon
appears,anddragleftor right.
5. UsethewaveformdisplayorplaytheaudiotomakesurethatyouadjustedtheInandOutpointsproperly.
IntheProjectpanel,clipsthatcontainbothvideoandaudioappearasasingleitem,representedby
.Whenyouaddthecliptothesequence,
however,thevideoandaudioappearastwoobjects,eachinitsappropriatetrack.
ThevideoandaudioportionsofthecliparelinkedsothatwhenyoudragthevideoportioninaTimelinepane
l,thelinkedaudiomoveswithit,and
[Link],theaudio/[Link],eachpartofthelin
kedclipislabeledwiththesameclip
name,[Link][V]andtheaudioismarked[A].
Ordinarily,[Link]
videoindividually,youcanunlinkthem.
Whenyoudo,youcanusethevideoandaudioasthoughtheywerenotlinked;eventheclipnamesnolongera
ppearunderlinedorbearthe[V] and[A][Link],[Link]-
linktheclips,theyindicatewhethertheyhavebeenmovedoutofsync,and
[Link].
[Link]
ronizevideoandaudiothatwere recordedseparately.
Linkorunlinkvideoandaudio
1. DothefollowinginaTimeline:
Tolinkvideoandaudio,Shift-
clickavideoandaudioclip,oraseriesofaudioclipstoselectthem,andthenchooseClip>Link.
Tounlinkvideoandaudio,selectalinkedclipandchooseClip>Unlink.
Tounlinkvideoandaudiofrommultipleclips,selecttheclipsandchooseClip>Unlink.
2.
(Optional)Touseasetoflinkedclipsmultipletimes,createanestedsequencefromthesetofsynchronized
clips,andplacethenested sequenceinothersequencesasdesired.
Edittracksoflinkedclipsindividually
InaTimeline,Alt-click/Option-
clickeitherpartofalinkedclip,[Link],youca
n reselect(click)[Link]/Option-
draggingaudioorvideoworkswellforadjustingasplitedit.
Automaticallysynchronizeclipsthatweremovedoutofsync
1. Right-click/Control-clickthenumberthatappearsattheInpointinaTimelinepaneloftheout-of-
syncvideooraudioclip.(Thenumber
indicatestheamountoftimetheclipisoutofsyncwithitsaccompanyingvideooraudioclip.)
2. Chooseoneofthefollowingoptions:
MoveIntoSync
[Link]
utregardto adjacentclipsandoverwritesanyclipstoregainsync.
SlipIntoSync Performsaslipedittorestoresyncwithoutmovingtheclip’spositionintime.
Createsplitedits
Ordinarily,[Link]’salinkedclip(aclipcontaining
videoandaudiotracks),InandOut
[Link],theaudioandvideoofthestandardclipappearatthes
[Link] want
tosetthevideoandaudioInorOutpointsindependently,however,inordertocreatesplitedits(alsoknowna
sL-cutsandJ-cuts).Whenplacedin
asequence,acliptrimmedforaspliteditwillhaveitsaudioappearbeforeitsvideo,oritsvideobeforeitsaud
io.
[Link]-cut
Createasplitedit
1.
Ifnecessary,clickthetriangletotheleftofeachtracknameinaTimelinepaneltoexpandtheaudiotracksyo
uwanttoadjust.
2. Selectoneoftheclipsinvolvedinthesplitedit,andchooseClip>[Link].
3. SelecttheRollingEdittool fromtheToolspanel.
4. Startingattheaudioeditpointbetweenthetwoclips,dragleftorright.
Ifnothinghappens,makesurethatbeforeyoustartdragging,youpositionthepointeroverthevisibleaudio
editpoint,notoveran appliedaudiotransition.
AcommoneditingtechniqueistoAlt/Option-
dragaclip’[Link]’salotfasterthangoingtoamenuto unlinkaclip.
YoucanmonitoraudiolevelsforclipsinaTimelinepanel.
1.
IftheAudioMasterMeterspanelisnotopen,selectWindow>AudioMasterMeters.InPremiereProCS6,
chooseWindow>AudioMeters.
2. SelecttheProgramMonitororaTimelinepanel.
3. Do one of the following: Press Space, In the Program Monitor, click the Play Stop Toggle
(Space) button .
TheAudioMeterspaneldisplaystheaudiolevelfortheTimeline.
Monitor volumelevelwhilecapturing
YoucanmonitoraudiolevelswhilecapturingDVorHDVfootage.
1. IftheAudioMeterspanelisnotopen,selectWindow>AudioMasterMeters.
InPremiereProCS6,chooseWindow>AudioMeters.
2. CapturevideofromaDVorHDVsource.
TheAudioMeterspaneldisplaystheaudiolevelforthecapturedfootage.
Adjusting gainandvolume
[Link]
[Link]
cansetgainorvolumelevelstomakelevelsmoreconsistentamongtracksorclips,ortochangethevolumeo
[Link],
however,thatifthelevelofanaudioclipwassettoolowwhenitwasdigitized,increasingthegainorvolume
[Link]
results,followthestandardpracticeofrecordingordigitizingsourceaudioattheoptimumlevel;thispracti
ceallowsyoutoconcentrateon adjustingtracklevels.
[Link]
mmandisindependentoftheoutput
levelsettingsintheAudioMixerandTimelinepanels,butitsvalueiscombinedwiththetracklevelforthefi
nalmix.
[Link]
lspanel,youusethesamemethods
[Link]’softensimplertoadjusttheVolumeeffectina
Timelinepanel.
[Link]
imarilythroughtheAudioMixer,youcan alsodosousingaudiotrackkey
[Link]
framesrepresentmixerautomationsettings,theyaffectoutputonly
ifautomationissettoRead,Touch,orLatch.
YoucanadjustthegainforanentiresequencewiththeNormalizeMasterTrackcommand.
Normalizeoneor moreclips
1. Dooneofthefollowing:
YoucanadjustthegainofamasterclipsothatallinstancesoftheclipaddedtoaTimelinepanelhave
[Link] masterclipintheProjectpanel.
Toadjustthegainofjustoneinstanceofamasterclipalreadyinasequence,selecttheclipinaTimeli
nepanel.
Toadjustthegainofmorethanonemastercliporclipinstance,selecttheclipsinaProjectpanelorse
[Link],Shift- [Link],Shift-
clicktoselectcontiguousclips,orCtrl-click(Windows)orCommand-click(Mac
OS)toselectnon-contiguousclips.
2. ChooseClip>AudioOptions>AudioGain.
TheAudioGaindialogboxopensandPremiereProautomaticallycalculatesthepeakamplitudeofthesele
ctedclips,reportingthe
[Link],[Link]
nusethisvalueasaguideforthe amounttoadjustgain.
3. Selectoneofthefollowing,setitsvalue,andthenclickOK.
SetGainTo
[Link]
atedtothe
currentgain,[Link],whenthesec
ondoption,AdjustGainBy,is usedtoadjustthegainby-
1dB,[Link]
openedforselectedclipsthathavealreadyhadtheirgainadjusted,thecurrentgainvalueisdisplayedinthis
field.
AdjustGainBy
[Link]+or-
[Link]
fieldautomaticallyupdatestheSetGainTodBvaluetoreflecttheactualgainvalueappliedtotheclip.
NormalizeMaxPeakTo
[Link],ausermaywanttoallo
w forheadroomandsetthisto-
[Link]-
specified [Link],aclipwithapeakamplitudeof-
6dBwillhaveitsgainadjustedby+[Link] amultiple-
clipselection,theclipwiththemaximumpeakwillbeadjustedtotheuser-
specifiedvalue,whiletheotherclipswillbeadjustedby
thesameamount,[Link],assumecliponehasapeakof-
6dB,andcliptwohasapeakof-
[Link],itwillbeadjustedby+3dBtoboostittotheuser-
specifiedgainof0.0dB,whileclipone alsowillbeadjustedby+3dB,boostingitto-
3dB,andpreservingthegainoffsetbetweenthetwoclipsintheselection.
NormalizeAllPeaksTo
[Link],ausermaywanttoallo
w forheadroomandsetthisto-
[Link]-specifiedvalue.
Forexample,asingleclipwithapeakamplitudeof-
6dBwillhaveitsgainadjustedby+[Link] amultiple-
clipselection,eachclipintheselectionwouldhaveitsgainadjustedbyamountsnecessarytoboostthemall
to0.0dB.
Normalizethe Mastertrack
[Link]
efaderforthewholemastertrack
[Link]
keyframesonthemastertrackupward
ordownward,inproportiontotheadjustmentmadeinoverallvolume.
1. Selectthesequenceyouwanttonormalize.
2. SelectSequence>NormalizeMasterTrack.
3. IntheNormalizeTrackdialogbox,typeanamplitudevalueinthedBfield.
4. ClickOK.
Youcanadjustthevolumelevelofawholecliportrack,orhavethevolumechangeovertimeusingtherubbe
rbandinanaudiotrackofaTimelinepanel.
1. Expandtheaudiotrackviewbyclickingthetrianglenexttotheaudiotrackname.
2. Intheaudiotrackheader,clicktheShowKeyframesbutton
,andchooseoneofthefollowingfromthemenu:
ShowClipKeyframesLetsyouanimateaudioeffectsforaclip,includingVolumeLevel.
ShowClipVolumeLetsyouchangeonlyaclip’sVolumeLevel.
ShowTrackKeyframesLetsyouanimatemanyaudiotrackeffects,includingVolume,Mute,andBalan
ce.
ShowTrackVolumeLetsyouchangeonlyatrack’svolumelevel.
3. IfoneoftheKeyframessettingsisselected,dooneofthefollowing:
IfShowClipKeyframesisselected,chooseVolume>Levelfromthedrop-
downmenuattheheadoftheclipintheaudiotrack.
IfShowTrackKeyframesisselected,chooseTrack>Volumefromthedrop-
downmenuattheheadoftheclipintheaudiotrack. Volumeadjustmentisenabledbydefault.
4.
UseeithertheSelectiontoolorthePentooltomovetheVolumelevelrubberbandup(increasevolume)ord
own(decreasevolume).
IfyouwanttheVolumeeffecttochangeovertime,placethecurrent-timeindicator
atthelocationforeachchange,clickthe Add/RemoveKeyframebutton
intheaudiotrackheader,anddragthekeyframeup(louder)ordown(quieter).
Applyavolumelevelto severalclips
1. IntheTimeline,adjustthevolumeofasinglecliptothedesiredlevel.
2. ChooseEdit>Copy.
3. Dragamarqueeovertheotherclipsyouwanttochange.
4. ChooseEdit>PasteAttributes.
Thisprocedurepastesalleffectsandattributesofthefirstclipselected,notjustitsvolumesettings.
Bydefault,[Link],youcanalsocreatesubmix
[Link]
[Link]
audiotrackasaninputfora
[Link]
[Link]
[Link],youcansendtheoutputfr
omamonauralaudiotracktoa
stereosubmixtrack,andthensendtheoutputfromthestereosubmixtracktoa5.1-channelMasterTrack.
Ifthenumberofchannelsdiffersbetweenaninputtrackanditsoutputtrack,youdeterminehowmucheach
ofthechannelsintheinputtrack
[Link],youcansend80percentofthesignalfromamona
uralaudiotracktotheleftchannel
ofastereosubmixtrack,[Link]
eooutputtrackwithLeft/RightPan
dialsintheAudioMixer.Youbalancetheaudiotoa5.1outputtrackwith5.1PannercontrolsintheAudioMi
xer.
IntheAudioMixer,aLeft/RightPandialappearsinatrackonlywhenyouselectastereotrackastheoutputf
orthetrack.A5.1Pannercontrol appearsinatrackonlywhenyouselecta5.1-
[Link]
trackandthenumberofchannelsintheoutputtrack(oftenthemastertrack)determineswhetherthepanand
balanceoptionsareavailableforan audiotrack.
Panningisthemovingofaudiofromoneoutputchanneltoanother,[Link],ifacardrivesfro
mtherightsideofavideoframeto
theleft,youcanpanthechannelcontainingthecaraudiosothatitbeginsontherightsideofthescreenandend
sontheleft.
IntheAudioMixer,[Link]
outputtrackisdisplayedintheTrack OutputAssignmentmenuatthebottomofeachtrack.
Thefollowingrulesdeterminewhetheratrack’saudiocanbepannedorbalancedinits outputtrack:
Whenyououtputamonotracktoastereoor5.1surroundtrack,youcanpanit.
Whenyououtputastereotracktoastereoor5.1surroundtrack,youcanbalanceit.
Whentheoutputtrackcontainsfewerchannelsthanintheotheraudiotracks,PremiereProdown-
mixestheaudiotothenumberofchannels intheoutputtrack.
Whenanaudiotrackandtheoutputtrackaremonoorwhenbothtracksare5.1surround,panningandbalanc
ingaren’[Link] channelsofbothtrackscorresponddirectly.
Whilethemasteraudiotrackisthedefaultoutputtrack,[Link]-
mixtrackscanbebothanoutput
destinationofotheraudiotracksandanaudiosourcetothemastertrack(orothersub-
mixtracks).Therefore,thenumberofchannelsina sub-
mixtrackaffectsthepanorbalancecontrolsavailableintracksthatoutputtoit,andthenumberofchannelsi
nthesub-mixoutputtrack affectwhetherpanningorbalancingisavailableforthatsub-mixtrack.
[Link]
[Link]
[Link]
swhenamonoorstereotrack [Link]-
[Link]
panorbalanceaudioamongthefivespeakers,whicharerepresentedbypocketsaroundtheedgeofthetray.
Thetrayalsoincludescontrolsfor
adjustinga5.1surroundaudiotrack’[Link]
pearsifatrackoutputstoasubmixor
mastertrackthatcontainsthesamenumberofchannelsorfewer;therefore,apanorbalancecontrolisnever
availablefora5.1surroundtrack.A
mastertrackdoesn’tcontainapanorbalancecontrolbecauseit’[Link],p
anningorbalancinganentire
sequenceispossiblewhenyouusethesequenceasatrackinanothersequence.
YoucanvarythepansettingovertimeintheAudioMixer,orinaTimelinepanelbyapplyingkeyframestoat
rack’sPanoptions.
Panningandbalancingcontrols
Panor balanceastereotrack
IntheAudioMixer,dooneofthefollowing:
Dragthepancontrolknoborthevaluebelowtheknob.
Clickthevaluebelowthepancontrolknob,typeanewvalue,andpressEnter(Windows)orReturn(Mac
OS).
Panor balancea16-channeltrack
Whenyouselectasequencecontaininga16-
channelmasteraudiotrack,DirectOutputAssignmentbuttonsappearabovetheslidersforeach
[Link]
hemastertrack.
Selectingchannel12fortheoutputfromtheleft-frontchannelofa5.1audiotrack
[Link]
[Link] [Link]
buttonsfora5.1surroundtrack
1. IftheAudioMixerisnotopen,selectWindow>AudioMixer,andselectthedesired16-
channelsequence.
DirectOutputAssignmentbuttonsshowtowhichMastertrackchannelPremiereProautomaticallyassig
nedthechannelsoftheinitialtracks.
Asyoucreateadditionaltracks,PremiereProautomaticallyassignstheirchannelstochannel1,1-2,or1-
6inthe16-channelMastertrack, dependingonthenumberofchannelswithinthenewtrack.
2.
IntheAudioMixer,foreachchannelinatrack,clicktheDirectOutputAssignmentbutton,andselectoneof
the16channelsintheMaster trackasthedestinationforthatchannel.
Panor balanceatrackin aTimelinepanel
1. InaTimelinepanel,ifnecessary,expandatrack’sviewbyclickingthetrianglenexttothetrackname.
2. ClicktheShowKeyframesbutton ,andchooseShowTrackKeyframesfromthemenu.
3.
ClickTrack:VolumeatthetopleftofthetrackandthenchoosePanner>BalanceorPanner>Panfromthem
enu.(For5.1surroundaudio, choosethedimensionyouwanttoeditfromthePannermenu.)
4. (Optional)Ifyouwanttoadjustthepanorbalanceeffectovertime,movethecurrent-
timeindicatorandclicktheAdd/RemoveKeyframeicon .
5. UsetheSelectiontoolorthePentooltoadjustthelevel.
6. (Optional)Ifyou’readjustingthepanorbalanceeffectovertime,repeatsteps4and5asnecessary.
SELF ASSESSMENT QUESTIONS
6. Explain panning and balancing? Define the procedure to pan and balance audio of a
clip?
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
Unit 6
Introduction
Objectives
4. Effects Presets
8. Keying Effect
9. Transition effect
References
INTRODUCTION
Dear students editing software includes a variety of audio and video effects that you can apply to
clips in your project. An effect can add a special visual or audio characteristic or provide an
unusual feature attribute. For example, an effect can alter the exposure or color of footage,
Students you can also use effects to rotate and animate a clip or adjust its size and position within
the frame. In this unit students will learn to create and apply presets for all effects. Standard
effects are listed in the Effects panel and are organized into two main bins, Video Effects and
Audio Effects. Dear students within each bin Premiere Pro lists effects by type in nested bins. For
example, the Blur and Sharpen bin contains effects that defocus an image, such as Gaussian Blur
and Directional Blur. The Effect Controls panel lists all the effects that are applied to the
currently selected clip. Students fixed effects are included with every clip: the Motion, Opacity,
and Time Remapping effects are listed in the Video Effects section and the Volume effect is
listed in the Audio Effects section. The Volume effect is included only for audio clips or video
clips with linked audio. In the Effects panel, the Presets bin contains presets for popular effects.
Students can save time by using a preset made for a specific purpose, rather than configuring an
effect yourself.
In this unit students will learn to stabilize motion with the Warp Stabilizer effect. It removes jitter
caused by camera movement, making it possible to transform shaky, handheld footage into
steady, smooth shots. Dear students in video, the color correction encompass adjusting both the
hue and luminance in an image. Students by adjusting the color and luminance in video clips you
can create a mood, eliminate a color cast in a clip, correct video that’s too dark or too light, or set
the levels to meet broadcast requirements or to match color from scene to scene. A transition
moves a scene from one shot to the next. Generally, you use a simple cut to move from shot to
shot, but in some cases you might want to transition between shots by phasing out one and
phasing in another. Premiere Pro provides many transitions that you can apply to your sequence.
A transition can be a subtle crossfade or a stylized effect, such as a page turn or spinning
pinwheel. While you usually place a transition on a cut line between shots, you can also apply a
Objectives:
Fixed effects
Every clip you add to a Timeline panel have Fixed effects pre-applied, or built in. Fixed effects
control the inherent properties of a clip and appear in the Effect Controls panel whenever the clip
is selected. You can adjust all of the Fixed effects in the Effect Controls panel. However, the
Program Monitor, Timeline panel, and Audio Mixer also provide controls that are often easier to
use.
Motion Includes properties that allow you to animate, rotate, and scale your clips, adjust their
anti-flicker property, or composite them with other clips. Opacity lets you reduce the opacity of a
Time Remapping
It lets you play with the speeds of the clip like slow down, speed up, or reverse playback, or
freeze a frame, for any part. Provides fine control for the acceleration or deceleration of these
changes. Volume Controls the volume for any clip that contains audio. Because fixed effects are
already built in to each clip, you need only adjust their properties to activate them.
Standard effects
Standard effects are additional effects that you must first apply to a clip to create a desired result.
You can apply any number or combination of Standard effects to any clip in a sequence. Use
Standard effects to add special characteristics or to edit your video, such as adjusting tone or
trimming pixels. Premiere Pro includes many video and audio effects, which are located in the
Effects panel. Standard effects must be applied to a clip and then adjusted in the Effect Controls
panel. Certain video effects allow direct manipulation using handles in the Program Monitor. All
Standard effect properties can be animated over time using key framing and changing the shape
of the graphs in the Effect Controls panel. The smoothness or speed of the effect animation can
be fine-tuned by adjusting the shape of Bezier curves in the Effect Controls panel.
All video effects-both Fixed and Standard effects are clip-based. They alter individual clips. You
can apply a clip-based effect to more than one clip at a time by creating a nested sequence. Audio
effects can be applied to either clips or to tracks. To apply track-based effects, use the Audio
Mixer. If you add keyframes to the effect, you can then adjust the effect either in the Audio
Find the required effect in the respective bins as there are three main bins available.
Find audio effects in bins named for the type of audio clips they support: mono, stereo, or 5.1.
You can also locate an effect by typing the effect name in the Contains box.
To open the Effects panel, choose Window > Effects, or click the Effects tab.
In the Effects panel, click the New Custom Bin button, or choose New Custom Bin from the
Effects panel menu. A new Custom bin appears in the Effects panel. You can rename it.
Drag effects to the Custom bin. A copy of the effect is listed in the Custom bin. You can create
To rename the custom bin, click the existing name to select the folder, click it again to select
1. In the Effects panel, select a Custom bin and do one of the following:
c. Press Delete.
d. Press Backspace.
2. Click OK.
You can apply one or more Standard effects to a clip by dragging effect icons from the Effects
panel to a clip in a Timeline panel. Alternatively, select the clip and drag the effect icon to the
Effect Controls panel. Select the clip and double click an effect in the Effects panel to apply it.
You can apply the same effect multiple times, using different settings each time. You can apply
Standard effects to more than one clip at a time by first selecting all the clips you want to affect.
You can also temporarily disable any effect, which suppresses the effect without removing it, or
you can remove the effect completely. To view and adjust effects for a selected clip, use the
Effect Controls panel. Alternatively, you can view and adjust effects for a clip in a Timeline
panel by expanding its track and selecting the proper viewing options. By default, when you
apply an effect to a clip, the effect is active for the duration of the clip. However, you can make
an effect start and stop at specific times or make the effect more or less intense by using
keyframes.
a. To apply one or more effects to a single clip, select and drag the effects to the clip in the
Timeline.
b. To apply one or more effects to more than one clip, first select the clips. Control-click
(Windows) or Command-click (Mac OS) each of the desired clips in the Timeline. Then,
drag one effect or a selected group of effects to any of the selected clips.
To apply an audio effect, drag the effect to an audio clip or the audio portion of a video clip. You
cannot apply audio effects to a clip when Show Track Volume or Show Track keyframes is enabled for
In the Effect Controls panel, click the triangle to show options for any effect, and then
You can easily copy and paste effects from one clip to one or more other clips. For example, you can
apply identical color correction to a series of clips shot in similar lighting conditions. You can copy
effects from a clip in one track of a sequence and paste them onto clips in another track. You do not
values from a clip in any sequence. You can paste these values to another clip in any sequence using
the Paste Attributes command. With Paste Attributes, effects intrinsic to the source clip—Motion,
Opacity, Time Remapping, and Volume—replace those effects in the destination clips. All other effects
(including keyframes) are added to the list of effects already applied to the destination clips.
1. In a Timeline panel, select the clip that contains the effect or effects you want to copy.
2. To select one or more effects to copy, in the Effect Controls panel, select the effect you want to
copy. Shift-click to select multiple effects. To select all effects, skip this step.
4. In a Timeline panel, select the clip to which you want to paste the effect and choose one of the
following:
1. Select the clip in a Timeline panel. To make sure that only one clip is selected, click an empty
space in the Timeline, then click the clip. Click a spot in the time ruler above the selected clip to
2. In the Effect Controls panel, select the effect or effects you want to remove. To select more than
Choose Remove Selected Effect from the Effect Controls panel menu.
Disable or enable effects in a clip
Select one or more effects in the Effect Controls panel, and do one of the following:
Deselect or select the Effect Enabled command in the Effect Controls panel menu.
You can apply crossfades for audio transitions between clips. An audio fade is analogous to a video
transition. For a crossfade, you add an audio transition between two adjacent audio clips on the same
track. To fade in or fade out, you add a crossfade transition to either end of a single clip.
Premiere Pro includes three types of crossfade: Constant Gain, Constant Power, and Exponential Fade.
1. Right-click (Windows) or Control-click (Mac OS) either Constant Gain or Constant Power in
4. Choose Edit > Preferences > General (Windows) or Premiere Pro > Preferences > General (Mac
OS).
5. In the Preferences dialog box, enter a value for the Audio Transition Default Duration.
7. Make sure that the two audio clips are adjacent, and that both clips are trimmed.
To add the default audio transition, move the current-time indicator to the edit point
between the clips, and choose Sequence > Apply Audio Transition.
To add an audio transition other than the default, expand the Audio Transitions bin in the
Effects panel and drag the audio transition to a Timeline panel, on the edit point between
1. Make sure that the audio track is expanded in a Timeline panel. If necessary, click the triangle
to the left of the track name to expand the audio tracks that you want to crossfade.
To fade in a clip’s audio, drag an audio transition from the Effects panel to a Timeline
panel so that it snaps to the In point of the audio clip. You can also select the applied
transition in a Timeline panel. Then, in the Effect Controls panel choose Start At Cut
To fade out a clip’s audio, drag an audio transition from the Effects panel to a Timeline
panel so that it snaps to the Out point of the audio clip. You can also select the applied
transition in a Timeline. Then, in the Effect Controls panel, choose End At Cut from the
Alignment menu.
3. Use any of the three types of audio crossfade transitions to fade in or fade out.
Adjust or customize an audio transition
To edit an audio transition, double-click the transition in a Timeline panel and adjust the
To customize the rate of an audio fade or crossfade, adjust the clip’s audio volume keyframe
4. EFFECT PRESETS
1. In a Timeline, select the clip that uses one or more effects with the settings that you want to
save as a preset.
2. In the Effect Controls panel, select one or more effects which you want to save. Ctrl-click
3. Click the panel menu icon to the upper right of the Effect Controls panel to open the panel
menu.
5. In the Save Preset dialog box, specify a name for your preset. If desired, enter a description.
7. Scale scales the source keyframes proportionally to the length of the target clip. This action
8. Anchor To In Point Retains the original distance from the clip In point to the first effect
keyframe. If the first keyframe is 1 sec. from the In point of the source clip, this option
adds the keyframe at 1 sec. from the In point of the target clip. This option also adds all
9. Anchor To Out Point Retains the original distance from the clip Out point to the last effect
keyframe. If the last keyframe is 1 sec. from the Out point of the source clip, this option
adds the keyframe at 1 sec. from the Out point of the target clip. This option also adds all
Performing this action saves the selected effects, including their keyframes, to the new preset.
You can apply an effect preset containing settings for one or more effects to any clip in a sequence.
In the Effects panel, expand the Presets bin, and do one of the following:
Select the clip in a Timeline panel, and then drag the effect preset into the Effect Controls panel.
If you dragged the preset onto the clip in a Timeline panel the drop destination is determined as
follows:
If the Timeline has no clips selected, then the preset is applied to the clip targeted by the drop.
If the Timeline has clips selected, but the clip targeted by the drop is not part of that selection,
then the selected clips are deselected. The targeted clip and any linked track items become
selected. The preset is applied to the targeted clip and linked track items.
If the Timeline has clips selected, and the clip targeted by the drop is part of that selection, then
the preset is applied to all selected clips. The preset does not affect linked clips that are not
selected.
5. STABILIZE MOTION EFFECT
2. In the Effects panel, choose Distort > Warp Stabilizer, and then apply the effect by double-
clicking, or by dragging the effect to the clip in the Timeline or the Effect Controls panel.
After the effect is added, analysis of the clip begins immediately in the background. As analysis
begins, the first of two banners displays in the Project panel indicating that analysis is occurring.
When analysis is complete, the second banner displays a message that stabilization is occurring.
Analyze
There is no need to press this button when you first apply Warp Stabilizer, it is pressed for you
automatically. The Analyze button remains dimmed until some change takes place. For example, if you
adjust a layer’s In or Out points, or there is an upstream change to the layer source. Click the button to
Cancel
Cancels an analysis in progress. During analysis, status information appears next to the Cancel button.
Result
When selected, Smoothness is enabled to control how smooth the camera movement
becomes.
No Motion: Attempts to remove all camera motion from the shot. When selected, the Crop
Less Smooth More function is disabled in the Advanced section. This setting is used for
footage where at least a portion of the main subject remains within the frame for the entire
Smoothness
Chooses how much the camera’s original motion is stabilized. Lower values are closer to the camera’s
original motion while higher values are smoother. Values above 100 require more cropping of the
Method
Specifies the most complex operation the Warp Stabilizer performs on the footage to stabilize it:
Position: Stabilization is based on position data only and is the most basic way footage can
be stabilized.
Position, Scale And Rotation: Stabilization is based upon position, scale, and rotation data.
If there are not enough areas to track, Warp Stabilizer chooses the previous type (Position).
Perspective: Uses a type of stabilization in which the entire frame is effectively corner-
pinned. If there are not enough areas to track, Warp Stabilizer chooses the previous type
Subspace Warp (default): Attempts to warp various parts of the frame differently to
stabilize the entire frame. If there are not enough areas to track, Warp Stabilizer choose the
previous type (Perspective). The method in use on any given frame can change across the
Borders
Borders settings adjust how borders (the moving edges) are treated for footage that is stabilized.
2. While Warp Stabilizer is analyzing your footage, you can adjust settings or work on a different
3. Choose Stabilization > Result > No Motion if you want to completely remove all camera
0motion. Choose Stabilization > Result > Smooth Motion if you want to include some of the
4. If the result is good, you’re done with stabilization. If not, do one or more of the following:
If the footage is too warped, or distorted, switch the Method to Position, Scale, Rotation.
If there are occasional rippled distortions, and footage was shot with a rolling shutter
5. If the result is too cropped, reduce either Smoothness or Crop Less Smooth More. Crop Less
6. If you want to get a feel for how much work the stabilizer is actually doing, set the Framing to
Stabilize Only.
6. COLOR CORRECTION AND ADJUSTMENT
The following procedure is a general overview of applying the Color Correction effects.
1. Set up your workspace for color correction. If possible, make sure a calibrated PAL monitor is
2. Apply one of the Color Correction effects to the clip in a Timeline panel.
Move the current-time indicator to a frame that provides the best example of colors that
need to be adjusted.
To view only the luminance values in a clip, choose Luma from the Output menu. This
option only affects the preview in the Program Monitor, it doesn’t remove the color from
the video.
To display a before and after view of the clip in one monitor, select the Show Split View
option. You can specify whether the split view is horizontal or vertical by choosing from
the Layout menu. You can also adjust the relative proportion of the before and after views.
(Optional) Use the Tonal Range Definition control to define the shadow, midtone, and
The Auto Color, Auto Contrast, and Auto Levels effects make quick global adjustments to a clip. Auto
Color adjusts contrast and color by neutralizing the mid tones and clipping the white and black pixels.
Auto Contrast adjusts the overall contrast and mixture of colors, without introducing or removing color
casts. Auto Levels automatically corrects the highlights and shadows. Because Auto Levels adjusts
Temporal Smoothing The range of adjacent frames, in seconds, analyzed to determine the amount of
correction needed for each frame, relative to its surrounding frames. If Temporal Smoothing is 0, each
frame is analyzed independently, without regard for surrounding frames. Temporal Smoothing can
Scene Detect If this option is selected, frames beyond a scene change are ignored when the effect
Snap Neutral Midtones (Auto Color only) Identifies an average nearly neutral color in the frame and
Black Clip, White Clip How much of the shadows and highlights are clipped to the new extreme
shadow and highlight colors in the image. Be careful of setting the clipping values too large, as doing
so reduces detail in the shadows or highlights. A value between 0.0% and 1% is recommended. By
default, shadow and highlight pixels are clipped by 0.1% - that is, the first 0.1% of either extreme is
ignored when the darkest and lightest pixels in the image are identified; those pixels are then mapped to
output black and output white. This clipping ensures that input black and input white values are based
Blend with Original Determines the effect’s transparency. The result of the effect is blended with the
original image, with the effect result composited on top. The higher you set this value, the less the
The three-way color corrector has been designed to improve accessibility to the most commonly
Output menu The Output menu has two options, Video and Luma. The Composite option has been
relabeled to Video.
Master color wheel The Master option replaces the Master color wheel. When this option is
selected, all the three color wheels behave as the Master color wheel. A change in one wheel is
wheels have color pickers associated with them. To set properties as numerical values, scroll down
for the options. You can expand all the three options to set or view their properties.
Input Level, Output Level, and Secondary Color Correction The Input Level and Output Level,
and the Secondary Color Correction options have been moved above for better accessibility.
Secondary Color Correction The option has been moved above for better accessibility.
The Mask option, previously present in the Output menu, is now available as Show Mask
The Invert menu replaces the Invert Limit Color option in Secondary Color Corrector. The
available options in the menu are None, Invert Limit Color, and Invert Mask.
All changes made to controls under secondary color correction also apply to other effects
that use secondary color correction. These effects include Luma Curve, Luma Corrector, and
RGB Curve.
7. CREATING COMMONLY USED RESULTS
Fade in video
1. To fade a video clip in, or fade up from black, select a clip in a Timeline panel.
Keyframe the opacity of the clip to start at zero and increase to 100%.
You can use the Position and Scale controls of the Motion effect to create a picture-in-picture (PIP).
The technique of zooming and panning can be used on still images whichcan bring life to still images.
1. Make sure that the Info panel is visible. If it is not, choose Window > Info.
2. In either the Project panel or Timeline panel, select the clips for which you want to know the
total duration. The Info panel displays the number of items selected and the total duration of
those items. This information is useful if you want to paste clips into a specific area and need to
know the exact duration of the target area or of the source clips.
1. Choose Edit > Preferences > General (Windows) or Premiere Pro > Preferences > General (Mac
OS).
2. For Still Image Default Duration, specify the number of frames you want as a default duration
Change clip speed and duration with the Rate Stretch tool
Select the Rate Stretch tool , and drag either edge of a clip in a Timeline panel.
You can change the speed of the video portion of a whole clip. You can use Time Remapping to create
slow motion and fast motion effects in which the rate of speed varies.
1. In the track header of the video track containing the desired clip, click the Show Keyframes
2. Click the Clip Effect menu triangle, and choose Time Remapping > Speed.
A horizontal rubber band that controls the speed of the clip appears across the center of the clip.
Drag the rubber band upward or downward to increase or decrease the speed of the clip. A tool
tip appears showing the change in speed as a percentage of the original speed.
The playback speed of the video portion of the clip changes and its duration expands or contracts
depending on whether its speed is increased or decreased. The audio portion of the clip remains
8. KEYING EFFECTS
Use the Alpha Adjust effect in place of the Opacity effect when you need to change the default render
order of Fixed effects. Change the opacity percentage to create levels of transparency.
The following Alpha Adjust effect settings let you interpret the alpha channel in the clip:
Invert Alpha Reverses the transparency and opaque areas of the clip.
Blue Screen Key effect (Windows only)The Blue Screen Key effect creates transparency from
true chroma blue. Use this key to key out well-lit blue screens when creating composites.
The following Blue Screen Key effect settings are adjusted in the Effect Controls panel:
Threshold Sets the levels of blue that determines transparent areas in a clip. Dragging the slider to the
left increases the amount of transparency. Use the Mask Only option to view black (transparent) areas
Cutoff Sets the opacity of nontransparent areas specified by the Threshold setting. Dragging the Cutoff
slider to the right increases the opacity. Use the Mask Only option to view white (opaque) areas as you
transparent and opaque regions. Choose None to produce sharp edges, with no anti-aliasing. This
option is useful when you want to preserve sharp lines, such as those in titles. Choose Low or High to
Mask Only Displays only the clip’s alpha channel. Black represents transparent areas, white represents
Blue Screen Key effect is applied (right) to superimpose subject over underlying track.
The Chroma Key effect keys out all image pixels that are similar to a specified key color. When you
key out a color value in a clip, that color or range of colors becomes transparent for the entire clip.
Control the range of transparent colors by adjusting the tolerance level. You can also feather the edges
of the transparent area to create a smooth transition between the transparent and opaque areas.
Chroma Key effect
A. Original image B. Blue color keyed out C. Image on second track D. Final composite image
The following Chroma Key effect settings are adjusted in the Effect Controls panel:
Similarity Broadens or reduces the range of the target color that will be made transparent. Higher
Blend Blends the clip you are keying out with the underlying clip. Higher values blend more of the clip.
Threshold Controls the amount of shadows in the range of color you keyed out. Higher values retain
more shadows.
Cutoff Darkens or lightens shadows. Drag to the right to darken shadows, but do not drag beyond the
Smoothing Specifies the amount of anti-aliasing that Premiere Pro applies to the boundary between
transparent and opaque regions. Anti-aliasing blends pixels to produce softer, smoother edges. Choose
None to produce sharp edges, with no anti-aliasing. This option is useful when you want to preserve
sharp lines, such as those in titles. Choose Low or High to produce different amounts of smoothing.
Mask Only Displays only the clip’s alpha channel. Black represents transparent areas, white represents
The Color Key effect keys out all image pixels that are similar to a specified key color. This effect
Figure: Nonstandard blue screen (left) and background (center) are combined with Color Key effect (right).
When you key out a color value in a clip, that color or range of colors becomes transparent for the
entire clip. Control the range of transparent colors by adjusting the tolerance level. You can also feather
the edges of the transparent area to create a smooth transition between the transparent and opaque areas.
The Difference Matte effect creates transparency by comparing a source clip with a difference clip, and
then keying out pixels in the source image that match both the position and color in the difference
image. Typically, it’s used to key out a static background behind a moving object, which is then placed
on a different background. Often the difference clip is simply a frame of background footage (before
the moving object has entered the scene). For this reason, the Difference Matte effect is best used for
scenes that have been shot with a stationary camera and an unmoving background.
A. Original image B. Background image C. Image on second track D. Final composite image
The Difference Matte creates transparency by comparing a specified still image with a specified clip
and then eliminating areas in the clip that match those in the image. This key can be used to create
special effects. Depending on the clip, it’s possible to use Difference Matte to key out a static
You can create the matte by saving a frame from a clip that shows the static background before the
moving object enters the scene. For best results, neither the camera nor anything in the background
should move.
The following Difference Matte settings are adjusted in the Effect Controls panel:
View Specifies whether the Program Monitor shows the Final Output, Source Only, or Matte
Only.
Matching Tolerance Specifies the degree to which the matte must match the foreground in
order to be keyed.
Matching Softness Specifies the degree of softness at the edges of the matte.
Blur Before Difference Specifies the degree of blur added to the matte.
Work Flow
1. Find a frame of your foreground clip that consists only of the static background. You will use
this frame as a matte. Save this frame as an image file. It will appear in the Project panel.
2. Drag the matte frame from the Project panel to a video track in a Timeline panel.
3. Drag the clip you want to use as the background to a track in a Timeline panel above the matte
frame.
4. Place the video clip you wish to use in the foreground on a track in a Timeline panel above the
background clip.
5. In the Effects panel, expand the Video Effects bin and then the Keying bin.
6. Drag the Difference Matte effect onto the foreground video clip.
7. In the Effect Controls panel, click the triangle next to Difference Matte to expose its controls.
8. From the Difference Layer drop-down menu, select the track that contains the matte frame.
A new keyframe appears in the Effect Controls timeline when you change the settings. You can also
adjust the interpolation between keyframes by editing the keyframe graph. Repeat this step as
needed.
Dust & Scratches effect
The Dust & Scratches effect reduces noise and defects by changing dissimilar pixels within a specified
radius to be more like their neighboring pixels. To achieve a balance between sharpness of the image
and hiding defects, try various combinations of radius and threshold settings.
Radius is how far the effect searches for differences among pixels. High values make the image blurry.
Threshold How different pixels can be from their neighbors without being changed by the effect. Use
Median effectThe Median effect replaces each pixel with a pixel that has the median color value of
neighboring pixels with the specified Radius. At low Radius values, this effect is useful for reducing
some types of noise. At higher Radius values, this effect gives an image a painterly appearance.
Noise effectThe Noise effect randomly changes pixel values throughout the image.
Amount of Noise The amount of noise to add. Noise Type use Color Noise to add random values to the
red, green, and blue channels individually. Otherwise, the same random value is added to all channels
for each pixel. Clipping Clips color channel values. Deselecting this option causes more apparent noise.
9. TRANSITION EFFECTS
Transition effects can be used in place of transitions for added controls. For the appearance of a
transition effect, overlap clips on different video tracks, adding the effect to the overlapping clip.
Keyframe the Animation Completion parameter to ramp the effect as a transition effect.
The Block Dissolve effect makes a clip disappear in random blocks. The width and height of the blocks,
Original image (left), and with effect applied (center and right)
The Gradient Wipe effect causes pixels in the clip to become transparent based on the luminance values
of corresponding pixels in another video track, called the gradient layer. Dark pixels in the gradient
layer cause the corresponding pixels to become transparent at a lower Transition Completion value. For
example, a simple grayscale gradient layer that goes from black on the left to white on the right causes
the underlying clip to be revealed from left to right as Transition Completion increases.
Original image (left), and with effect applied (center and right)
The gradient layer can be a still image or a moving image. The gradient layer must be in the same
Transition Softness The degree to which the transition is gradual for each pixel. If this value is 0%,
pixels in the clip to which the effect is applied are either completely opaque or completely transparent.
If this value is greater than 0%, pixels are semitransparent at the intermediate stages of the transition.
Gradient Placement How the gradient layer’s pixels are mapped to the pixels of the clip to which the
effect is applied:
Center Gradient Uses a single instance of the gradient layer in the center of the clip.
Stretch Gradient To Fit Resizes the gradient layer horizontally and vertically to fit the
Invert Gradient Inverts the gradient layer’s influence; lighter pixels in the gradient layer
You can use a grayscale image as a gradient wipe. In a gradient wipe, image B fills the black area of the
grayscale image and then shows through each level of gray as the transition progresses until the white
1. In the Effects panel, expand the Video Transitions bin and the Wipe bin inside it.
2. Drag the Gradient Wipe transition from the Wipe bin to an edit point between clips in a
Timeline panel.
3. Click Select Image, and then double-click the file you want to use as the gradient wipe. The
4. Adjust the softness of the transition’s edges by dragging the Softness slider. As you drag the
slider to the right, image A increasingly shows through image B. Click OK.
To preview the transition, drag the current-time indicator through the transition in a Timeline panel.
Linear Wipe effect
The Linear Wipe effect performs a simple linear wipe of a clip in a specified direction.
Wipe Angle The direction that the wipe travels. For example, at 90° the wipe travels from left to right.
Original image (left), and with effect applied (center and right)
The Radial Wipe effect reveals an underlying clip using a wipe that circles around a specified point.
Start Angle The angle at which the transition starts. With a start angle of 0°, the transition starts at the
top.
Wipe Specifies whether the transition moves clockwise or counterclockwise, or alternates between the
two.
Original image (left), and with effect applied (center and right)
You can use the Effect Controls panel to change settings for a transition you placed in a sequence.
Settings vary from transition to transition. In the Effect Controls panel, the adjoining clips and
A. Play The Transition button B. Transition preview C. Edge selector D. Clip previews E. Start and
End sliders F. Clip A (first clip) G. Transition H. Clip B (second clip) I. Current-time indicator
To open the transition in the Effects control panel, click the transition in a Timeline panel.
To show or hide the time ruler in the Effect Controls panel, click the Show/Hide Timeline
View button . If necessary, widen the panel to make this button visible and active.
To play back the transition in the Effect Controls panel, click the Play the Transition button.
This doesn’t affect the Program Monitor. To view frames from the actual clip or clips in the
button. Then drag the current-time indicator in the Effect Controls panel’s time ruler to the
desired frame.
You can change the alignment of a transition placed between two clips in either a Timeline panel or the
Effect Controls panel. A transition need not be centered or strictly aligned to the cut. You can drag the
1. In a Timeline panel, zoom in so that you can clearly see the transition.
1. Double-click the transition in a Timeline panel to open the Effect Controls panel.
2. If the Effect Controls time ruler is not visible, click the Show/Hide Timeline View button in
the Effect Controls panel. If necessary, widen the panel to make this button visible and active.
3. In the Effect Controls time ruler, position the pointer over the center of the transition until the
Slide Transition icon appears; then drag the transition as desired. For finer control,
To center the transition on the cut line, in the Effect Controls panel, double-click the
To place all of the transition in the clip preceding the edit point, drag the transition to the
left to align its end to the edit point. Alternatively, in the Effect Controls panel, double-
To place all of the transition in the clip following the edit point, drag the transition to the
right to align its beginning to the edit point. Alternatively, in the Effect Controls panel,
To place unequal portions of the transition in each clip, drag the transition slightly left or
You can adjust the location of the cut in the Effect Controls panel. Moving the cut line changes the In
and Out points of the clips, but does not affect the length of the movie. As you move the cut, the
1. Double-click the transition in a Timeline panel to open the Effect Controls panel.
2. If the Effect Controls time ruler is not visible, click the Show/Hide Timeline View button in
the Effect Controls panel. If necessary, widen the panel to make this button visible and active.
3. In the Effect Controls time ruler, position the pointer over the transition, placing it on the thin
vertical line that marks the cut. The pointer changes from the Slide Transition icon to the
You can edit a transition’s duration in either a Timeline panel or the Effect Controls panel. The default
duration for transitions is initially set to 1 [Link] a transition’s duration requires that one
In a Timeline panel, position the pointer over the end of the transition until the Trim-In icon or the
1. Double-click the transition in a Timeline panel to open the Effect Controls panel.
In the Effect Controls time ruler, position the pointer over the transition until the Trim-In
icon drag.
Drag the Duration value, or select it and type a new value. How the transition changes
Center At Cut or Custom Start The transition’s start and end points move equally in opposite
directions.
If you change the default, the new setting has no affect on transitions already placed.
2. Change the value for the Video Transition Default Duration or Audio Transition Default
Some transitions, such as Iris Round, are positioned around a center. When a transition has a center that
can be repositioned, you can drag a small circle in the A preview area in the Effects Control panel.
1. Click the transition in a Timeline panel to open the Effect Controls panel.
2. In the A preview area in the Effect Controls panel, drag the small circle to reposition the
transition center.
Edge selectors Change the orientation or direction of the transition. Click an Edge selector arrow on
the transition’s thumbnail. For example, the Barn Doors transition can be oriented vertically or
horizontally. A transition doesn’t have Edge selectors if it has one orientation or if orientation isn’t
applicable.
Start and End sliders Set the percentage of the transition that is complete at the start and end of the
transition. Hold down the Shift key to move the start and end sliders together.
Show Actual Sources Displays the starting and ending frames of the clips.
Border Width Adjusts the width of the optional border on the transition. The default Border is None.
eyedropper to choose the color. Reverse Plays the transition backward. For example, the Clock Wipe
Custom Changes settings specific to the transition. Most transitions don’t have custom settings.
In most cases, you don’t want a transition to occur during the essential action in a scene. For this reason,
transitions work best with handles-the extra frames beyond the In and Out points set for the clip.
The handle between a clip’s Media Start time and In point is sometimes called head material, and the
handle between a clip’s Out point and Media End time is sometimes called tail material.
A clip with handles
In some cases, the source media may not contain enough frames for clip handles. If you apply a
transition, and the handle duration is too short to cover the transition duration, an alert appears to warn
you that frames will be repeated to cover the duration. If you decide to proceed, the transition appears
Transitions are typically double-sided—they combine the last video or audio material from the clip
before the cut with the first material from the clip right after the cut. You can, however, apply a
transition to an individual clip so that it affects only the beginning or end of the clip. A transition
applied to a single clip is called single-sided. The clip can be immediately adjacent to another clip or
sitting by itself on a track. You can apply double-sided transitions only when the clip before the cut has
a handle at its tail, and the clip after the cut has a handle at its head.
Using single-sided transitions, you have more control over how clips transition. For example, you can
create the effect of one clip departing using the Cube Spin transition, and the next clip fading in using
Dither Dissolve.
Single-sided transitions fade to and from a transparent state, not to and from black. Whatever is below
the transition in a Timeline panel appears in the transparent portion of the transition. If the clip is on
Video 1 or has no clips beneath it, the transparent portions display black. If the clip is on a track above
another clip, the lower clip is shown through the transition, making it look like a double-sided transition.
Single-sided transition with clip beneath it (left) compared
to single-sided transition with nothing beneath it (right)
In a Timeline panel or the Effect Controls panel, a double-sided transition has a dark diagonal line
through it, while a single-sided transition is split diagonally with one half dark and one half light.
Types of transitions
A. Double-sided transition using duplicate frames B. Double-sided transition
C. Single-sided transition
Applying transitions
To place a transition between two clips, the clips must be on the same track, with no space between
them. As you drag the transition to a Timeline panel, you can adjust the alignment interactively.
Whether or not the clips have trimmed frames determines how you can align the transition as you place
it between the clips. The pointer changes to indicate the alignment options as you move it over the cut:
If both clips contain trimmed frames at the cut, you can center the transition over the cut or
you can align it on either side of the cut so that it either starts or ends at the cut.
If neither clip contains trimmed frames, the transition automatically centers over the cut
and repeats frames from the first clip, or from the second clip, or from both clips, as
needed to fill the transition duration. Diagonal bars appear on transitions that use repeated
frames.
If only the first clip contains trimmed frames, the transition automatically snaps to the In
point of the next clip. The transition uses the first clip’s trimmed frames for the transition
If only the second clip contains trimmed frames, then the transition snaps to the Out point
of the first clip. The transition uses the second clip’s trimmed frames for the transition and
The default duration of a transition, for either audio or video, is set to 1 second. If a
transition contains trimmed frames, but not enough to fill the transition duration. You can
adjust the duration and alignment of a transition after you place it.
1. In the Effects panel, find the transition you want to apply. You’ll need to expand the Video
Transitions bin, and then expand the bin containing the transition you want to use.
2. To place a transition between two clips, drag the transition to the cut line between two clips,
and release the mouse when you see the Center At Cut icon .
3. If a dialog box appears containing transition settings, specify options and click OK.
To preview the transition, play the sequence or drag the current-time indicator through the transition.
1. In the Effects panel, find the transition you want to apply. You’ll need to expand the Video
Transitions bin, and then expand the bin containing the transition you want to use.
2. To place a transition on a single cut, Ctrl-drag (Windows) or Command-drag (Mac OS) the
transition into a Timeline panel. Release the mouse when you see either the End At Cut or Start
At Cut icon.
End At Cut icon Aligns the end of the transition to the end of the first clip.
Start At Cut icon Aligns the beginning of the transition to the beginning of the second clip.
To preview the transition, play the sequence or drag the current-time indicator through the transition.
You can specify a video transition and an audio transition as default transitions and quickly apply them
between clips in a sequence. A red outline marks default transition icons in the Effects panel. Cross
Dissolve and Constant Power Crossfade are preset as the video and audio default [Link] you use
another transition more frequently, you can set it as the default. When you change the default transition
setting, you change the default for all projects. Changing the default transition doesn’t affect transitions
1. Choose Window > Effects and expand the Video Transitions or Audio Transitions bin.
3. Click the Menu button for the Effects panel, or right-click the transition.
Choose Edit > Preferences > General (Windows), or Premiere Pro > Preferences >
Click the Effects panel menu button. Choose Default Transition Duration.
2. Change the value for the Video Transition Default Duration or Audio Transition Default
You can apply the default transition to adjoining pairs of clips on one or more tracks
1. Click one or more track headers to target the tracks where you want to add the transition.
2. Position the current-time indicator at the edit point where the pair or pairs of clips meet. To
navigate to an edit point, you can click the Go To Next Edit Point and Go To Previous Edit
3. Choose Sequence > Apply Video Transition or Sequence > Apply Audio Transition, depending
(Windows) or Command+D (Mac OS). You can add the default audio transition between two clips
You can apply the default video and audio transitions to any selection of two or more clips. The default
transitions are applied to every edit point where two selected clips touch. The placement does not
depend upon the position of the current-time indicator or on whether the clips lie on targeted tracks.
The default transitions are not applied where a selected clip touches a non-selected clip or no clip at all.
1. In the Timeline, select two or more clips. Shift-click clips, or draw a marquee over them, to
select them.
You can copy any transition in a sequence, and paste it to any other cut line on a track of the same type:
3. Move the current-time indicator to the cut line where you want to paste the transition.
When you paste a double-sided transition to a double-sided location, the transition remains
double-sided.
When you paste a double-sided transition to a single-sided location, the transition becomes
single-sided.
When you paste a single-sided transition to a double-sided location, the transition becomes
double-sided.
11. Briefly explain the process of applying transition between two clips?
13. What is a default transition and how can you specify the default transition?
14. Explain the process of copy and pasting a transition?
References
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
stabilizer-in-premiere-pro-cs6/
[Link]
[Link]
[Link]
[Link]
[Link]
Unit 7
CONTENT
Introduction
Learning Outcomes
References
INTRODUCTION
Dear student while you will rely upon audio and video sources as the primary ingredients for building a
sequence, you will often need to incorporate text into your project. Text is really effective when you
need to convey information quickly to your audience. For example, you can identify a speaker in your
video by super-imposing his name and title during the interview (often called a lower third). You may
also use text to identify sections of a longer video or to acknowledge the cast and crew (with credits).
Dear students your video can look incomplete without a Title. In this unit students will learn to create
title using built-in Titler in Premier Pro. The Titler is a versatile tool enabling you to create, not just
Dear students the Titler is a collection of related panels. You can close the panels within the Titler
without closing the Titler. You can dock the panels to each other or to other parts of the interface.
When the panels are not docked to the main workspace, they appear over the other panels, or float.
The proper use of allows you to succinctly deliver information . It is clearer than the use of a narrator
and allows for information to be presented in middle of dialogue segments. Additionally, text can be
used as a re-enforcement of key information to the end-viewer. Dear students you can load more than
one title into the Titler. You can choose the title you want to view by choosing its name in the Title tab
menu. You can reopen a title when you want to change it or to duplicate it and base a new version on it.
Students once you enter in the Titler you can position, format, and customize text along a path, in a box,
and in the unit detailed explanation of how to work with text in the Titler.
The Titler is an engaging and powerful tool. Its customizability make it possible to create compeling
Objectives:
Students will get a complete exposure to the complete range of options available.
The students will be familiarized by the different panels and the tools in the titler.
Learn Titler, selecting color properties and font characteristics and saving them as styles to
Learn about the tools in the Titler to create various shapes, such as rectangles, ellipses, and lines.
Know to create objects and transforming objects using anchor points and curves.
The students will learn creating rolling and crawling titles and their use.
Understand how to applying changes to stack order, aligning and distributing text and objects.
How to create titles in Titler that roll or crawl across the screen, and set timing options to
customize the rolling and crawling titles.
Learn to utilize title styles panel to quickly format text with presets.
1. CREATE NEW TITLE
Create a title from scratch, or use a copy of an existing title as a starting point.
Create a title
Choose Title > New Title and then choose a title type.
In the Project panel, press the New Item button and choose Title.
3. Use the text and shape tools to create a file or to customize a template.
Titles are added to the Project panel automatically and are saved as part of the project file.
OER: [Link]/26210965
1. In the Titler, open or select the title on which you want to base a new title.
2. In the Title Quick Properties panel, click New Title Based On Current Title .
3. In the New Title dialog box, enter a name for the new title and click OK.
You can import a title file as you would any other source file.
You can export titles as independent files that use the .prtl filename extension.
1. In the Project panel, select the title you want to save as an independent file.
3. Specify a name and location for the title and click Save.
The title-safe and action-safe margins in the drawing area of the Titler designate the safe zones. These
margins are enabled by [Link] zones are useful when you edit for broadcast and videotape. Most
TVs over-scan the picture. Over-scanning places the outer edges of the picture outside the viewing area.
The amount of over-scanning is not consistent across TVs. To ensure that everything fits within the
area that most TVs display, keep text within the title-safe margins. Keep all other important elements
The title templates included with Premiere Pro provide numerous themes and preset layouts that make
it quick and easy to design a title. Some templates include graphics pertinent to certain subjects, such as
new-baby or vacation themes. Others include placeholder text that you can replace to create credits for
your movie. Some templates have transparent backgrounds, represented by dark gray and light gray
squares. You can see your video beneath the title. Other templates are opaque.
You can easily change any element in the template by selecting the element and either deleting it or
overwriting it. You can also add elements to the template. After you modify the template, you can save
it as a title file for use in current and future projects. Alternately, you can save any title you create as a
template.
You can view a frame of footage in the drawing area as you create the title. Viewing the frame helps
you place elements in your title. The video frame is for your reference only; it is not saved as part of the
title.
Use the timecode controls in the Titler to specify the frame you want to display. The Titler displays the
frame under the current-time indicator in the active sequence. Setting the frame in the Titler also moves
the current-time indicator in the Program Monitor and Timeline panel. Moving the current-time
indicator in the Program Monitor or Timeline panel changes the frame displayed in the Titler.
the drawing area. To display the frame by specifying its timecode, click the time value next to Show
When adding text to a title, you can use any font on your system, including Type 1 (PostScript), Open
You can copy and paste formatted text objects between Titler and other applications such as After
Effects, Photoshop, Encore, and Illustrator. Depending on the tool you choose in the Titler, you can
create point text or paragraph text. When you create point text, you specify an insertion point where
you want to begin typing. Typing continues on a single line unless you enable the word wrap feature.
Word wrap continues the text on a new line when it reaches the edge of the title-safe area. When you
create paragraph text, you specify a text box in which the text fits. The text in a text box wraps
Dragging the corner handle of a point-text object scales the text, Dragging the corner of a text box
reflows the text it contains. If a text box is too small to contain the characters you type, you can resize it
to reveal the hidden text. Text boxes that contain hidden characters have a plus sign (+) on the right
You can also create path text. Instead of following a straight baseline, path text follows a curve you
create. Text can be oriented horizontally or vertically along its baseline or path.
Type text without boundaries
2. In the drawing area, click where you want to begin, and then type the text.
3. When you finish typing, choose the Selection tool and click outside the text box area.
You can set the titler to wrap text within the title safe area automatically.
3. Type the text. The text wraps when it reaches the boundaries of the text box.
4. When you finish typing, choose the Selection tool and click outside the text box.
Resizing the text box resizes only the visible area of the box. The text remains the same size.
1. In the Titler, click the Path Type tool or the Vertical Path Type tool . Using the path type
4. Continue clicking until you create the path shape you want.
5. Type the text. When you type, the text begins along the top or right edge of the path. If
6. When you finish, choose the Selection tool and click outside the text box.
Using the Selection tool, double-click the text at the point you want to edit or begin a selection. The
tool changes to the Type tool, and a cursor indicates the insertion point.
To move the insertion point, click between characters or use the Left Arrow and Right Arrow
keys.
To select a single character or group of contiguous characters, drag from the insertion point
You can format selected text using controls in the Titler main panel, the Title Properties panel, or menu
commands. To format an entire text or graphic object, click the object and then modify its properties.
Some object properties—such as fill color and shadow—are common to all objects you create in the
Titler. Other properties are unique to text objects. Controls for font, font style, and type alignment are
in the Titler panel above the drawing area. Other options are available in the Title Properties panel and
your installed fonts using a set of default characters, which you can customize.
When you choose a font in the Font Browser, it immediately applies to your title. The Font Browser
Specify a font
Choose Title > Font and choose a font from the menu.
In the Title Properties panel, click the Font Family triangle to open the drop-down menu, and select a
font.
When you select any object in a title, its properties are listed in the Title Properties panel. Adjusting
values in the panel alters the selected object. Text objects possess unique properties, such as leading
and kerning.
1. Select the text object or range of text you want to modify.
2. In the Title Properties panel, click the arrow next to Properties, and set values.
Font Specifies the font applied to the selected text object. To view a font in its typeface, use the
Font Browser.
Aspect Specifies the horizontal scale of the selected font. This value is some percentage of the
font’s natural aspect ratio. Values less than100% narrow the text. Values above 100% widen the
text.
Leading Specifies the amount of space between lines of type. For roman type, leading is
measured from the baseline of one line of type tothe baseline of the next line. For vertical text,
leading is measured from the center of one line of type to the center of the next line. In the Titler,
Kerning Specifies the amount of space you add or subtract between specific character pairs.
The value indicates the percentage ofcharacter width between the character pairs. Place the
Tracking Specifies the amount of space between a range of letters. The value indicates the
percentage of character width between thespecified range of characters. The direction of the text
Baseline Shift Specifies the distance of the characters from the baseline. Raise or lower the
selected type to create superscripts orsubscripts. Changing the Baseline Shift value affects all
characters.
Small Caps Size Specifies the size of the small caps as some percentage of regular height.
Adjusting this value changes the size of allcharacters in the text object except for the leading
character. A Small Caps value of 100% sets the text to all capitals.
Underline When selected, specifies that the selected text is underlined. This option is not
Tools in the Titler make it possible to quickly resize and align paragraph text.
Select a paragraph text object, and at the top of the Titler panel:
3. To justify text to the right side of its text box, click Right .
Drag any handle of the paragraph text’s bounding box to resize the box.
You can apply tabs in a text box in much the same way as you would in a word-processing program.
Tabs are especially useful in creating professional-looking rolling credits. You can set multiple tabs
within a text box and press the Tab key to move the cursor to the next available tab stop. You can
specify a different justification option at each tab [Link] work exclusively to align the characters
within text objects. To align entire text or graphic objects, use the Align command.
You can use the drawing tools in the Titler to create various shapes, such as rectangles, ellipses, and
lines. The Titler includes standard pen tools that resemble pen tools used in Illustrator and Photoshop.
Alt-drag (Windows) or Option-drag (Mac OS) to draw from the center of the shape.
Shift+Alt-drag (Windows) or Shift+Option-drag (Mac OS) to constrain the aspect ratio and
Drag diagonally across the corner points to flip the shape diagonally as you draw.
Drag across, up, or down to flip the shape horizontally or vertically as you draw.
1. In the Title Properties panel, click the triangle next to Properties to expand its list, and then
Draw straight lines by clicking Pen Tool in the drawing area. Pen Tool creates object anchor points
2. Position the tip of the pen point where you want the straight segment to begin, and click to
define the first object anchor point. The object anchor point remains selected (solid) until you
4. Continue clicking Pen Tool to create additional straight segments. The last object anchor point
To close a path, click the initial object anchor point. A circle appears underneath the pen pointer when
To leave the path open, Ctrl-click (Windows) or Command-click (Mac OS) anywhere away from all
The Titler includes tools for modifying existing paths. You can add or delete object anchor points on a
path. You can also move object anchor points, and manipulate their direction lines to change the curve
of adjacent line segments. You can specify not only the path’s thickness but also the shape of each of
its ending points. You can also specify its caps, and its corners, or joins.
To add an object anchor point without creating or manually adjusting a curve, click where you want to
add an object anchor point. To add an object anchor point and simultaneously move the new point, drag
a spot on a path.
3. Position the cursor over the point. When the cursor becomes an arrow with a square next to it,
You can change the type of object anchor point you have created for a segment.
2. Select Convert Anchor Point Tool and position the cursor over the object anchor point that
To convert a corner point to a smooth point, drag a direction point out of the corner point. To
convert a smooth point to a corner point without direction lines, click the smooth point.
To convert a corner point without direction lines to a corner point with independent direction
lines, first drag a direction point out of a corner point. Dragging a direction point makes it a
smooth point with direction lines. Release the mouse button, and then drag either direction point.
To convert a smooth point to a corner point with independent direction lines, drag either
direction point.
Select a line or an open or closed Bezier shape, and in the Title Properties panel, specify any of the
following options:
Graphic type Adjusts open and closed Bezier shapes to standard shapes. Graphic type can also change
a closed Bezier shape to an open oneand vice versa. Graphic type must be set to “Filled Bezier” to add
fill to a closed shape. For more about adding fill to a closed shape, see Set a fill for text and objects.
Cap Type Specifies the type of cap placed at the end of the paths. The Butt option caps paths with
square ends. The Round option caps pathswith semicircular ends. The Square option caps paths with
square ends that extend half the line width beyond the end of the line. This option makes the weight of
Join Type Specifies how the ends of adjoining path segments are joined. The Miter option joins path
segments using pointed corners. The Roundoption joins path segments using rounded corners. The
Miter Limit Specifies the point at which the join type switches from mitered (pointed) to bevel
(square). The default miter limit is 4. At the default,the join type switches from miter to bevel when the
length of the point is four times the stroke weight. A miter limit of 1 results in a bevel join.
Use the Titler to place images in a title, such as adding a logo graphic. You can either add the image as
a graphic element or place it in a text box to become part of the text. The Titler accepts both bitmap
images and vector-based artwork (such as art created with Adobe Illustrator). However, Premiere Pro
rasterizes vector-based art, converting it to a bitmap version in the Titler. By default, an inserted image
1. Drag the logo to where you want it. If necessary, you can adjust the size, opacity, rotation, and
1. Using a type tool, click where you want to insert the logo.
Select the logo and choose either Title > Logo > Restore Logo Size or Title > Logo > Restore Logo
Aspect Ratio.
An object is any shape or text box you create in the Titler. When you create objects that overlap
each other, you can control their stacking order in the Titler.
2. Choose Title > Arrange and then choose one of the following:
Bring To Front Brings the selected object to the top of the stacking order.
Bring Forward Switches the selected object with the object directly in front of it.
Send To Back Moves the selected object to the bottom of the stacking order.
Send Backward Switches the selected object with the object directly behind it.
The Title Actions panel includes buttons to arrange objects in the drawing area. You can align,
2. In the Title Actions panel, click the button for the type of centering you want.
You can center objects using the Title > Position command and selecting the option you want.
Additionally, you can choose Title >Position > Lower Third to position the selected object along
the bottom edge of the title-safe margin. To center an object both horizontally and vertically within
An alignment option aligns selected objects to the object that most closely represents the new
alignment. For example, for right alignment, all selected objects align to the selected object that is
2. In the Title Actions panel, click the button for the type of alignment you want.
In the drawing area, drag any of the selected objects to a new position.
Choose Title > Transform > Position and type new X and Y Position values; then click OK.
In the Transform section of the Title Properties panel, enter values for X Position and Y
Position.
Use the arrow keys to nudge the object in 1-pixel increments, or press Shift+arrow key to
Choose Title > Position and choose an option to center the selected object or align its
To scale the width, drag any object’s left or right handles in the drawing area.
To scale the height, drag the object’s top or bottom handles in the drawing area.
To constrain the object proportions, Shift-drag the corner and side handles.
To scale and constrain the aspect ratio, Shift-drag any object’s corner handles.
To scale from the center, Alt-drag (Windows) or Option-drag (Mac OS) any object’s corner
handles.
To set scale values in terms of percentages, choose Title > Transform > Scale,
specify the values you want, and click OK. To set scale values in terms of
pixels, specify values for Width and Height in the Title Properties panel.
Dragging the handles of a text object created with the Horizontal Type or Vertical Type tool
changes its font size. If the scaling is notuniform, the text’s aspect value also changes.
An object’s fill property defines the area within the contours of the object. Fill specifies the space
inside a graphic object, or within the outline of each character of a text object. You can fill an
2. In the Title Properties panel, click the triangle next to the Fill category and select the box
object.
Color Determines the color of the fill. Click the color swatch to open a color picker, or click the
eyedropper to sample a color from anywhereon the screen. Color options vary according to the Fill
Type specified.
Opacity Specifies the fill’s opacity, from 0% (transparent) to 100% (opaque). Set the opacity of an
object’s fill color to set the opacity ofindividual objects in a title. To set the opacity of the title as a
whole, add it to a track in the Timeline above another clip. Adjust opacity as you would for any
other clip.
Fill type options
4-Color Gradient Creates a gradient fill composed of four colors, with a color
The Color Stop Color option and the Color Stop Opacity option specify the color and
Click the Color Stop Color palette to open the Color Picker. Then, select a
color.
Click the Color Stop Color eyedropper, and click any color on the screen.
Bevel Adds a beveled edge to the background. Balance option specifies the
Ghost Specifies that the shadow is rendered, but not the fill.
Add a sheen
Add a sheen to any object’s fill or stroke. A sheen resembles a streak of colored light
across the surface of an object. You can adjust a sheen’s color, size, angle, opacity,
and position.
You can map a texture to any object’s fill or stroke. To add a texture, specify a vector
In the Title Properties panel, click the triangle next to Fill or Strokes, then
You can add an outline, or stroke, to your objects. You can add both inner strokes and
outer strokes. Inner strokes are outlines along the inner edge of your objects, and
outer strokes are outlines along the outer edge. You can add up to 12 strokes to each
object. After you add the stroke, you can adjust its color, fill type, opacity, sheen, and
texture. By default, strokes are listed and rendered in the order you create them;
2. In the Properties section of the Title Properties panel, expand the Strokes
category.
Type Specifies the type of stroke you apply. Depth creates a stroke that makes the
Fill Type Specifies the type of fill for the stroke. All the fill types, including Sheen
To delete strokes from text, click the Type Tool , and then drag to select the
text.
3. In the Title Properties panel, click the triangle next to Strokes to expand the
category.
6. Click Delete.
Add drop shadows to any object you create in the Titler. The various shadow options
give you full control over color, opacity, angle, distance, size, and spread.
1. Select an object.
2. In the Title Properties panel, select Shadow.
3. Click the arrow next to the Shadow option to set any of the values including:
Distance Specifies the number of pixels that the shadow is offset from the
Spread Specifies how far the alpha channel boundaries of the object are extended
before blurring. Spread is useful on small, thin features such as cursive descenders
Though static titles, graphics, and logos suffice for some projects, many others
require titles that move across the screen. Titles that move vertically over the
footage are called rolls. Titles that move horizontally are called [Link] length
of the title clip in a Timeline panel determines the speed of the roll or crawl. The
more you increase the title clip length, theslower the movement.
2. Create the text and graphic objects for the rolling or crawling title. Use the Titler
panel scroll bar to view off screen areas of the title. When the title is added to the
4. Specify the appropriate Direction and Timing options, and then click OK.
End Off Screen Specifies that the roll continues until the objects are out of view.
Pre-roll Specifies the number of frames that play before the roll begins.
Ease-In Specifies the number of frames through which the title rolls at a slowly
Ease-Out Specifies the number of frames through which the title scrolls at a slowly
Post-roll Specifies the number of frames that play after the roll completes.
Crawl Left, Crawl Right Specifies the direction in which the crawl moves.
1. In the Titler Panel, select the text box you want to convert, and click the
2. For Title Type, specify the type of title you want, and if necessary, specify Timing
options.
3. Click OK.
You can save a combination of color properties and font characteristics as a style, for
later use. You can save any number of styles. Thumbnails of all saved styles appear in
create or load. The display defaults to show large swatches of sample text with the
loaded style applied. However, you can choose to view your styles in small swatches
Small Thumbnails Displays only small swatches of sample text objects with the
Large Thumbnails Displays only large swatches of sample text objects with the
Create a style
1. Select an object that has the properties you want to save as a style.
3. Type a name for the style and click OK. Depending upon the display option you
select, either a swatch displaying the new style or the new style name appears in the
2. In the Title Styles panel, click the style swatch that you want to apply.
To delete a style, select it, and then choose Delete Style from the Title Styles
panel menu.
To duplicate a style, select it, and choose Duplicate Style from the Title
Styles panel menu. A duplicate of the selected style appears in the Title
Styles panel.
To rename a style, select it, and choose Rename Style from the Title
After you create a style, you can save it in a collection, or style library, with other
styles. By default, the styles you create appear in the current style library, but you can
create new libraries in which to save styles. For example, you can delete the current
library display, create new styles as you work, and then save those styles in their own
library.
To restore the default style libraries, choose Reset Style Library from the
Styles menu.
To save a style library, choose Save Style Library from the Styles menu.
All styles visible in the Styles section are saved. Specify a name and
Styles panel menu. Then browse to the style library, select it, and click
To replace a style library, choose Replace Style Library from the Title
Styles panel menu. Browse to the style library that you want to use as a
replacement, select it, and click Open (Windows), or Choose (Mac OS).
SELF ASSESSMENT QUESTIONS
2. Explain how to create a text style preset and manage style library?
3. Explain how the anchor point and curves are used to transform an
object?
5. Define safe margins and procedure to show the video behind the title?
an object?
References
[Link]
[Link]
[Link]
crawling-credits/
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
software/[Link]
[Link]/en/[Link]
[Link]/en/[Link]
[Link]
premier-pro-titler/
[Link]
[Link]
crawling-credits/
Unit 8
Exporting
Introduction
Objectives
1. Types of exporting
5. Smart Rendering
References
INTRODUCTION
Exporting is the getting of end result from any software this is very important for the editor
as there are a lot of different formats which are used for playback and by other
software’s .Every format have their own benefits along with drawbacks some give out very
good video quality along with a very big file sizes and if we select any format which gives
out very small file size it can lack in the quality so basically it all depends on the need of the
editor which format is required .There are a lot of formats in the market and they all have
different type of encoding going on in them some are good for playback for broadcast ,some
In this unit the student will be learning different exporting technics and about different
formats which are available in editing software’s we will cover the most commonly used
formats and then there will be exporting to different types of tapes which are really useful to
get the backup of the resulting file on which all the editing is done as it is the most secure
form of data storage so it is important to use them for long term data storage. Data can also
be transferred from one editing machine to other with the help of data drives or Disk like
DVD, Blu-ray burning to dvd or Blu-ray is done with the help of add on software known as
encore which is also explained in this unit so an editor can write a dvd of his final output.
Sometimes the project file needs to be transferred to other systems with better hardware or to
a totally different software these type of things are also made possible by exporting a
complete project file so that it can be used on a different machine or a different software.
Smart rendering will also be discussed as it is a really good add-on and make things a lot
faster.
Objectives:
You will learn how to export a file which can be used later for editing
Exporting the project files for editing the project on other systems will be covered
You can export video from a sequence in the form best suited for further editing or for a viewing
audience. Premiere Pro supports export in formats for various uses and target devices.
You can export editable movie or audio files. Then, you can preview your work with
effects and transitions fully rendered. Also, you can continue editing the files in applications
other than Premiere Pro. Similarly, you can export a still-image sequence. Also, you can export a
still image from a single frame of video for use in a title or graphic. After editing P2 MXF assets,
you can export the sequence back to P2 MXF format. You can continue editing the resulting
Premiere Pro supports both direct export and Adobe Media Encoder export. Direct export
generates new files directly from Premiere Pro. Adobe Media Encoder export sends files to
Adobe Media Encoder for rendering. From Adobe Media Encoder, you can choose whether to
b. Exporting to tape
You can export a sequence or clip to videotape in a supported camcorder or VTR. You
can use this type of export for archiving a master tape, or for delivering rough edits for screening
from VTRs.
You can send video from any sequence into Adobe Encore for output to DVD, Blu-ray
Disc (Windows only), or a SWF file. Changes made in the timelines of either Premiere Pro or
Encore are reflected in the other, by way of Adobe Dynamic Link. You can send content from
Premiere Pro to Adobe Encore for creating an AutoPlay disc without menus. You can quickly
create menu-based discs using the professional templates in Adobe Encore. Finally, you can use
the deep authoring tools of Adobe Encore, Adobe Photoshop, and other applications, to author
professional-quality discs. You can also export in formats appropriate for CD-ROM distribution.
You can export project files, not just clips, to standard EDL files. You can import EDL
files into various third-party editing systems for finishing. You can trim Premiere Pro projects
down to their essentials and ready them, with or without their source media, for archiving.
Finally, using the Adobe Media Encoder, you can export video in formats suitable for
to video-sharing web sites to mobile phones to portable media players to standard- and high-
definition TV sets.
Premiere Pro and other applications employ Adobe Media Encoder, a standalone
Export Settings dialog box and click Export, Premiere Pro sends the export request to the Adobe
Media Encoder.
From the Export Settings dialog box, click Queue to send Premiere Pro sequences into the
standalone Adobe Media Encoder queue. From the queue, you can encode sequences into one or
When the standalone Adobe Media Encoder is rendering and exporting in the background, you
Media Encoder encodes the most recently saved version of each sequence in the queue.
2. WORKFLOW FOR EXPORTING VIDEO AND AUDIO FILES
Choose File > Export > Media. Premiere Pro opens the Export Media dialog box.
Choose File > Export. Then select one of the options other than Media from the menu.
3. (Optional) In the Export Settings dialog box, specify the Source Range of the sequence or clip
you want to export. Drag the handles on the work area bar. Then click the Set In Point button and
5. Select the file format you want for your exported file.
6. Select a preset best suited for your target means of playback, distribution, and audience. 7. To
automatically export a file from a Premiere Pro sequence with settings that exactly match the
settings for that sequence, select Match Sequence Settings in the Export Settings dialog box.
8. To customize the export options, click a tab (e.g., Video, Audio) and specify the appropriate
options.
a. Click Queue. Adobe Media Encoder opens with the encoding job added to its queue.
b. Click Export. Adobe Media Encoder renders and exports the item immediately.
By default, Adobe Media Encoder saves the exported file in the folder where the source file is
located. Adobe Media Encoder appends the extension for the format specified to the end of the
When you have finished editing a Panasonic P2 sequence you can export the sequence to a hard
disk or back to a P2 card. You can also export individual clips to the P2 format. The maximum
file size for a clip stored in the P2 format is 4 GB. When Premiere Pro exports clips or sequences
The workflow from P2 card to edit and back to P2 card is simple. Import the P2 clips into a
project containing a 5.1-channel sequence. Map the source channels to their specified tracks.
When you export clips or sequences to P2 media, Premiere Pro translates clip and XMP metadata
into P2-standard fields. P2 viewers, cameras, servers, and decks can read these.
2. (Optional) If exporting from the Timeline, set a timeline marker, numbered “0” on the
frame you want used as the P2 icon for the exported. If you do not set this marker, the P2
5. (Optional) Click the hot text in the Output Name field, and type a new filename.
This name is used as the value for the User Clip Name element in the exported clip’s metadata
XML file. The User Clip Name value appears in the Name column of the Project panel when the
clip is imported back into Premiere Pro. If you do not specify a name, the filename appears in the
Name column. The name of the file is automatically generated in conformance with the
7. If a P2 compliant file structure is present at the destination, Premiere Pro adds the exported
clips to the existing folders. If the P2 compliant file structure is not present, Premiere Pro creates
8. Define the section of the clip or sequence you want to export. In the Export Settings dialog
box, drag the triangular current-time indicator to the desired in point, and click the Set In Point
button. Drag the triangular current-time indicator to the desired out point, and click the Set Out
Point button.
Click Queue. Adobe Media Encoder opens with the encoding job added to its queue.
You can export all the active audio tracks from an entire sequence in Premiere Pro to an Open
Media Format (OMF) file. Digi Design Pro Tools imports OMF files, when the Digi Translator
feature is licensed. With Digi Translator in Pro Tools, you can sweeten soundtracks from
Premiere Pro.
3. In the OMF Export Settings dialog box, type a title for the OMF file into the OMF Title field.
4. From the Sample Rate and Bits Per Sample menus, choose the settings needed for your sequence.
a. Encapsulate With this setting, Premiere Pro exports an OMF file containing the project
metadata and all the audio for the selected sequence. Encapsulated OMF files typically are large.
b. Separate Audio With this setting, Premiere Pro exports individual mono AIF files into an omfi
Media Files folder. The folder name contains the OMF filename. Using AIF files assures
a. Copy Complete Audio Files With this setting, Premiere Pro exports audio for the entirety of
each clip used in the sequence, no matter how many times the clip is used nor how many parts of
b. Trim Audio Files With this setting, Premiere Pro exports only the portions of each clip that are
used in the sequence: the clip instances. You can choose to export each clip instance with extra
7. In the Handle Frames field, specify the length of the handles, in video frames. This amount of
time is added to the start and end of the exported files when you choose Consolidate Media. The
default setting is one second, in frames, at the sequence frame rate. If the length of the handles
you specify exceeds the length of the clip instance, Premiere Pro exports the whole clip instance.
8. Launch Pro Tools, and import the OMF file. For more information on importing files into Pro
On export to OMF, Premiere Pro exports files with the following attributes and metadata:
Sample accurate exports Premiere Pro places all transitions and keyframe points on audio
48k and 96k sample rates Premiere Pro converts sound clips to the same consistent sample rate,
as required by Pro Tools. You can select the sample rate at the time of export.
16-bit and 24-bit depth You can choose the bit-depth at the time of export.
Encapsulate and Separate Audio options With the Encapsulate option, you can export a single,
large, OMF file containing both audio and OMF metadata. With the Separate Audio option, you
can export a smaller OMF file and a set of related, individual, external audio files. The Separate
Audio option is useful for larger projects, as an OMF file cannot exceed two gigabytes.
Track names OMF and Pro Tools work with mono tracks only. Premiere Pro exports each
channel from a stereo, 5.1-channel or 16-channel track into its own mono track with its source
track ID appended to its track name. Premiere Pro exports Left and Right stereo channels with
Clip names After you import an OMF file into Pro Tools, the clip names from the Premiere Pro
Clip volume and clip keyframe volume By default, Premiere Pro exports clip volume levels
and clip keyframe volume levels to the Clip Gain effect in the OMF file. You can set Digi
Audio Transitions Premiere Pro exports audio transitions between two adjoining clips, both
Audio Mixer pan settings One pan setting is exported per clip without keyframes. Premiere Pro
extracts the pan setting from the track and applies it to the clip export data.
Stereo tracks By default, Premiere Pro hard pans the Left channel to the left and the Right
Stereo Balance Premiere Pro applies clip balance to the Clip Gain effect for the clip. Premiere
Pro does not apply Audio Mixer balance, as that is track-based, not clip-based.
Channel Gain effects for 5.1-channel and 16-channel tracks Premiere Pro applies the first
channel-gain value per clip channel. Premiere Pro does not apply clip channel-gain keyframes.
Fill Left, Fill Right, and Swap Channel effects Premiere Pro applies the first value for Fill Left,
Fill Right, and Swap Channel effects to each clip. Premiere Pro does not apply Fill Left, Fill
Output setting turned on. If a track is turned off it does not appear in the exported OMF file.
Premiere Pro does not apply the Audio Mixer Mute Track, or Solo Track button settings.
Nested sequences Premiere Pro exports audio for each nested sequence the same way it does for
Merged Clips Premiere Pro CS exports audio the same way it does for master clips and sub-
clips.
For automatic gain control, select Convert Clip Based Gain To Automation.
Leave Sample Rate Conversion deselected, unless you need sample rate conversion.
Change the default setting to Manually Find And Relink, and press OK.
The Export Frame buttons in the Source Monitor and Program Monitor enable you to quickly
export frames of video without using the Adobe Media Encoder. This is sometimes called a
frame grab.
3. The Export Frame dialog box opens with the name field in text edit mode. The entire name is
selected for editing. By default, the frame name contains the name of the source clip or sequence,
and an auto-incremented number. For example, Premiere Pro names frames exported from a clip
named [Link], "[Link].Still001," "[Link].Still002," "[Link].Still003," and so on.
Even if you rename the frame, Premiere Pro uses the next number the next time you export a
frame from that same clip. By default, Premiere Pro selects the format last used for a frame
export.
Type a new name for the frame. Select a format from the Format: menu. Browse to a destination
Press Enter to accept the default frame name, format, and location.
Premiere Pro exports a frame. By default, Premiere Pro sets the color bit depth of the exported
You can export sequences or portions of sequences in files formatted for authoring and burning
to DVD and Blu-ray Disc. Alternately, you can export to Encore for authoring a DVD or Blu-ray
To export your sequence for later use or to work in Encore on another computer you can use File
> Export > Media and choose the appropriate settings for export. See Workflow for exporting
When exporting a file from the Export Settings dialog box for use in DVD or Blu-ray Disc
creation, select the format appropriate for the target medium. For single-layer or dual-layer DVD,
select MPEG2-DVD. For single-layer or dual-layer Blu-ray Disc, select either MPEG2 Blu-ray
or H.264 Blu-ray.
Select the preset for a given format in accordance with the available space on the target medium
Before you begin, make sure that Encore is installed on the same computer as Premiere Pro.
2. (Optional) Add Encore chapter markers, if desired. See Add Encore chapter markers.
3. (Optional) If you are producing a sequence for standard-definition output that includes high-
definition clips, select Maximum Render Quality before using Dynamic Link to send the
sequence to Encore for DVD authoring. This does not apply to HD sequences that use Dynamic
5. On the Basic tab in the New Project dialog box, type a name for the disc into the Name field.
6. (Optional) Click Browse and browse to a location for the Encore project, to change it from the
default location.
7. In the Project Settings pane, select the name of the authoring mode desired. The sets of options
available in the Settings area and on the advanced tab depend on whether Blu-ray or DVD is the
authoring mode.
9. Click OK.
Premiere Pro starts Encore. The Encore Project panel contains the dynamically linked Premiere
When exporting, smart rendering can be used for certain formats to create better quality output
by avoiding recompression when possible. In previous versions of Premiere Pro, smart rendering
In Premiere Pro CS6 (6.0.1, and later), smart rendering capability has been added for Long GOP
MPEG2 OP1a exports, where the original material is a matching long GOP MPEG2 OP1a or
XDCAM EX file. Smart rendering in Premiere Pro CS6 (6.0.1) is enhanced to accelerate MXF
render times for long GOP MPEG2 essences, while avoiding recompression. For DV or DVCPro
formats, smart rendering automatically engages. For XDCAM formats, check the checkbox for
smart rendering in the XDCAM exporter plug-in. If you have these types of clips in your
timeline in a sequence with matching settings, are exporting out to MXF OP1a with a matching
preset, and the checkbox is checked in the XDCAM exporter plug-in, it engages. Premiere Pro
To disengage smart rendering, uncheck the checkbox in the XDCAM exporter plug-in. Using
these formats, smart rendering creates an accelerated workflow, and less generational loss.
Render times are anywhere from 4 to 12 times faster than real-time. The lower the bitrate, the
faster it renders (less data per frame to copy, so it can do more at the same transfer speed).
You can export a sequence for use on Apple iPods, 3GPP cell phones, Sony PSPs, or other
mobile devices. In Export Settings, select an H.264 format preset made for the target device.
You can use Device Central to preview how a movie will appear on a wide variety of mobile
devices.
Moving assets between Adobe Premiere Pro and Adobe Flash
In Adobe Premiere Pro, you can add Flash cue point markers to a timeline. Flash cue point
markers serve as cue points in a rich media application. There are two types of cue point
markers: event and navigational cue point markers. You can use navigational cue point markers
to navigate to different sections of FLV and F4V files, and to trigger the display of onscreen
texts. You can use event cue point markers for triggering action scripts at specified times in FLV
You can export a movie from Adobe Premiere Pro directly into the FLV and F4V formats. You
can choose from several Export Settings presets. These presets balance file size against audio
and video quality to achieve the bit rate needed for any target audience or device. If you export
the movie with an alpha channel, you can use the movie easily used as a layer in a rich media
project.
You can import the FLV or F4V file into Adobe Flash. Flash reads sequence markers as
navigational or event cue points. In Flash, you can also customize the interface that surrounds
your video. Alternatively, you can use Flash to create animations for use in movies. You can
create an animation in Flash. You can export the animation as an FLV or F4V file. Then, you can
import the FLV or F4V file into Adobe Premiere Pro for editing. In Adobe Premiere Pro, for
example, you could add titles or mix the animation with other video sources.
Follow these guidelines to deliver the best possible FLV or F4V files:
Work with video in the native format of your project until your final output
If you convert a pre compressed digital video format into another compressed format such as the
FLV or F4V format, the previous encoder can introduce video noise. The first compressor
already applied its encoding algorithm to the video, reducing its quality, frame size, and frame
rate. That compression could have introduced digital artifacts: noise. This noise affects the final
encoding process, and a higher data rate is often required to encode a good-quality file.
Avoid elaborate transitions, they don’t compress well and can make your final compressed video
look “chunky” during the change. Hard cuts compress better than dissolves.
When you deliver video over the Internet, produce files at lower data rates. Users with fast
Internet connections can view the files with little or no delay for loading, but dial-up users must
wait for files to download. Make the clips short to keep the download times within acceptable
Frame rate indicates frames per second (fps). If you have a higher data rate clip, a lower frame
rate can improve playback through limited bandwidth. For example, if you compress a clip with
little motion, cutting the frame rate in half can save you only 20% of the data rate. However, if
you compress high-motion video, reducing the frame rate has a much greater effect on the data
rate.
Because video looks much better at native frame rates, leave the frame rate high if your delivery
channels and playback platforms allow. For web delivery, get this detail from your hosting
service. For mobile devices, use the device-specific encoding presets and the device emulator
available through Adobe Media Encoder in Adobe Premiere Pro. If reducing the frame rate, the
best results come from dividing the frame rate by whole numbers.
Select a frame size that fits your data rate and frame aspect ratio
At a given data rate (connection speed), increasing the frame size decreases video quality. When
you select the frame size for your encoding settings, consider frame rate, source material, and
personal preferences. To prevent pillar boxing, choose a frame size of the same aspect ratio as
the frame aspect ratio of your source footage. For example, pillar boxing results when you
Adobe Premiere Pro makes several FLV and F4V file presets available through the Export
Settings dialog box. These include preset frame sizes and frame rates for the different television
standards at different data rates. Experiment with the various Adobe Media Encoder presets to
find the best setting for your project. Use the following list of common frame sizes (in pixels) as
a guide:
You can stream FLV and F4V files to eliminate download time. FLV and F4V files also have
deep interactivity and navigation capabilities when they are streamed. Streaming FLV and
F4V files allow you to monitor quality of service. You can stream FLV and F4V files with
the Flash Media Server. Alternatively, you can use a hosted service from one of the
FLV/F4V Streaming Service partners available through the Adobe website. For more
information, see “Delivering Flash Video: Understanding the Difference between Progressive
Learn how long it takes to download enough of your video so that it can play to the end
without pausing to finish downloading. While the first part of your video clip downloads, you
can display other content that disguises the download. For short clips, use the following
formula: Pause = download time – play time + 10% of play time. For example, if your clip is
30 seconds long and it takes 1 minute to download, give your clip a 33-second buffer. The
For the best encoding, remove noise and interlacing. The higher the quality of the original,
the better the final result. Frame rates and sizes of Internet video are smaller than frame rates
and sizes of television video. However, computer monitors typically have color fidelity,
saturation, sharpness, and resolution at least as good as high-definition televisions. Even with
a small window, image quality can be as important for digital video as for HDTV. Artifacts
FLV files, F4V files, and SWF files are intended for progressive display on computer screens
and other devices. Interlaced displays such as TVs do not typically play FLV or F4V files.
Interlaced footage viewed on a progressive display can exhibit alternating vertical lines in
high-motion areas.
Thus, all the FLV and F4V file presets in the Adobe Media Encoder have DE interlacing
turned on by default.
The same considerations apply to audio production as to video production. To achieve good
audio compression, begin with clean audio. If your project contains audio from a CD,
transfer the audio files directly from the CD to your hard disk. Do not record the sound
through the analog input of your sound card. The sound card introduces an unnecessary
digital-to-analog and analog-to-digital conversion that can create noise in your source audio.
Direct digital transfer tools are available for Windows and Macintosh® platforms. To record
from an analog source, use the highest quality sound card available.
Tight shots are better. Try to keep the subject separated from the background; the colors and
Be aware of lighting. Poor lighting is a greater problem with mobile devices and can reduce
visibility on small screens. Shoot and adjust with this limitation in mind.
Use the following tips when editing video with Adobe Premiere Pro and After Effects: Set
the frame rate for the output movie according to output device or output type. For example, a
commercial in After Effects might be rendered at 15 frames per second (fps) for distribution
on mobile devices, but at 29.97 fps for broadcast television in the USA. In general, use a
lower frame rate. A frame rate of 22 fps is a good compromise for reducing file size without
losing quality Make the movie as small as possible and remove any extraneous content,
especially empty frames. Many actions can be done pre-encoding to limit file size. Some of
them apply to shooting techniques, while others (for instance, using motion-stabilization
tools in After Effects or applying a noise-reduction or blur effect) are post-production tasks
You can export a data file that describes the project and enables you to recreate it either with
With Premiere Pro you can export your project as an edit decision list (EDL) in the
CMX3600 format. This format is the most widely accepted and most robust of the EDL
formats.
When you set up a Premiere Pro project from which you will export an EDL, you must
satisfy the following criteria: EDLs work best with projects that contain no more than one
video track, two stereo audio tracks, and no nested sequences. Most standard transitions,
frame holds, and clip speed changes also work well in EDLs.
Capture and log all the source material with the correct timecode.
The capture device (e.g., capture card or FireWire port) must have device control that uses
timecode. Videotapes must each have a unique reel number and be formatted with timecode
[Link] sure that a Timeline panel is active, and then choose File > Export > EDL.
[Link] the EDL Export dialog box, specify which video and audio tracks you want to
[Link] can export one video track and up to four audio channels, or two stereo tracks.
4. Specify the location and name for the EDL file, and click Save.
[Link] OK
Advanced Authoring Format (AAF) is a multimedia file format that allows you to exchange
digital media and metadata between platforms, systems, and applications. Authoring
applications that support AAF, such as Avid Media Composer, read and write the data in
Ensure that the project you want to export conforms to general AAF specifications and is
The AAF files exported by Premiere Pro are compatible with the Avid Media Composer
family of editing products. These AAF files have not been tested with other AAF importers.
Transitions should appear only between two clips, not adjacent to the beginning or end of a
clip. Each clip must be at least the same length as the transition.
If a clip has a transition at both its In and Out points, the clip must be at least the same length
as both transitions combined. When naming clips and sequences in Premiere Pro, avoid using
special characters, accented characters, or characters that affect the parsing of an XML file.
Some characters to avoid include /, >, <, ®, and ü. AAF files exported from Premiere Pro and
imported into Avid Media Composer do not automatically relink to the source footage. To
relink thefootage, use the Batch Import option in Avid Media Composer.
2. In the Save Converted Project As dialog box, browse to a location for the AAF file,
3. In the AAF Export Settings dialog box, select either Save As Legacy AAF, Embed
4. Premiere Pro saves the sequence to an AAF file at the specified location. The AAF
Cuts-only mono/stereo audio and video The plug-in fully supports these elements
of a project. The plug-in does not convert audio pan, gain, and level changes, and 5.1
audio. Stereo audio channels are separated into two tracks in the Avid Media
Composer sequence.
Clip speed The plug-in converts video clip speed changes (slow, fast, reverse
playback) to the Avid Media Composer Motion Effect, which is the only supported
effect. Clip speed applied to nested sequences is also converted. Avid Media
Composer does not have an equivalent to Motion Effect for audio. If the speed
change makes the audio clip longer than the source media, the plug-in stretches the
audio clip to the same length as the rest of the source media. The plug-in begins at the
StartTime, and places filler in the gap. You can fix these portions of the sequence
Batch captured or redigitized files The plug-in retains the tape name specified in
the AAF file. Use the Batch Record capability in Avid Media Composer to recapture
Footage of varying dimensions The plug-in exports the project at its full resolution.
However, importing scales all footage according to the resolution specified in the
Avid project.
Nested sequences The plug-in builds the master composition from the nested
sequences recursively (because Avid Media Composer does not support linking to the
nested sequences). Therefore, in the AAF file, there’s no linking between the master
Titles The plug-in converts titles to offline media in Avid Media Composer.
Bin hierarchy Avid Media Composer places all items into a single bin. Projects with
Graphic files The plug-in saves a reference to all original files, but compatibility in
Avid Media Composer is limited to the formats that it supports.(See the Avid Media
Project elements The plug-in converts synthetic clips, such as Bars and Tone, Black
Video, Color Matte, and Universal Counting Leader to offline media in XDV.
Sequence and clip markers The plug-in converts all sequence markers, except the
sequence In and Out markers, to locators on the timecode (TC1) track in Avid Media
Composer. The Chapter, URL, and Frame Target fields are not converted because
Avid Media Composer has no equivalents. The plug-in converts clip markers to
Note: The AAF Export plug-in ignores markers located beyond the end of the
sequence.
retains its original position if it is within the duration of the sequence. Otherwise, the
plug-in places the current-time indicator at the end of the Avid Media Composer
sequence.
Grouped clips Upon import, all grouped clips are ungrouped and treated separately.
Transitions and effects Transitions and effects exported from Premiere Pro to the
In the Save Converted Project As dialog box, browse to a location for the XML file, and type
a file name. Click Save. Premiere Pro saves the sequence to an XML file at the specified
location. Also, Premiere Pro saves a log of any conversion problems in a text file also at the
same location. The log file name contains the words FCP Translation Results.(Optional) If
necessary, read the log file for descriptions of any translation issues. Exporting a Final Cut
Pro XML file from Premiere Pro CS5.5 and later turns merged clips into nested sequences in
Final Cut Pro. The XML from Premiere Pro CS5 can also be imported into Final Cut Express
4.0.1.
You can record your edited sequence onto videotape directly from your computer, for
example, to create a master tape. When you start a new sequence, you specify the format and
quality for the videotape in the Editing Mode area of the New Sequence dialog box.
You can record a sequence directly to videotape on the following devices (decks or
camcorders) as specified:
HDV devices On Windows only with a FireWire connection between the device and
the computer.
HD devices On either Windows or Mac OS, provided your computer has a supported
video also requires serial device control; check the third-party solution provider's
capture card, converter, camcorder, or deck that can convert your sequence to an
analog format recordable by the device. Most DV, HDV, and HD cameras; all DV,
HDV, and HD videotape recorders; and some capture cards and converters are
capable of this conversion. Some digital camcorders require that you first record the
sequence to their digital tape, and then playback the tape in the digital camcorder to
For device control while exporting to analog devices, you must have a device controller
installed also.
Many video capture cards include compatible plug-in software that provides a menu
command for recording to videotape. If the options you see differ from those described here,
refer to your capture card or plug-in documentation for the most efficient way to export to
tape.
Before you begin, make sure the recording device (camcorder or deck) is connected to your
To give your recording deck additional time before your video sequence starts
and after it ends, add black before and after the sequence in the Timeline
window. If you plan to have a postproduction facility duplicate your
videotapes, add a minimum of 30 seconds of color bars and tone at the
beginning of the program to aid in video and audio calibration.
1. Connect the device to the computer, turn it on, and set it to VTR, VCR, or Play.
4. In the Export area of the Playback Settings dialog box, specify the appropriate format
in the External Device menu. Choose one of the following settings, and click OK to
interlaced fields.
b. DV 25i (720 x 576) Specifies PAL DV, which uses a timebase of 25 fps and
interlaced fields.
6. Close other programs that might be running on your computer. Your computer is now
Before you export to videotape using device control, make sure that both the computer and
the camera or deck is set up properly, as you would when capturing video with device control.
If you’re using equipment that comes with its own software plug-in for use with Premiere
Pro, it may provide device control options different from those described here, and in
different locations.
Before you can export a sequence to an HDV device, you must first transcode it to HDV
format. Premiere Pro does this transcoding automatically just before exporting the sequence
to an HDV device.
1. Make sure that your video recording device is on and that the correct tape is in the
device. If necessary, locate and note the timecode for the location at which you want
to begin recording.
2. Activate the sequence you want to export, and position the work area bar over the
4. To let Premiere Pro control your deck, select Activate Recording Device and do any
of the following:
Timecode and type the In point. If you don’t select this option, recording begins at
b. To synchronize a device’s timecode with the recording start time, select Delay
Movie Start and type the numbers of frames that you want to delay the movie.
Some devices need a delay between the time they receive the record command
and the time the movie starts playing from the computer.
c. To have Premiere Pro roll the tape before the specified start time so that the deck
can attain a constant speed, select Preroll and type the number of frames you want
the tape to play before recording begins. For many decks, 150 frames is sufficient.
Report Dropped Frames Generates a text report alerting you to dropped frames.
6. Click Record, or, for HDV devices click Render And Record.
If exporting to an HDV device, a rendering dialog box will open with a progress
bar showing the progress of the transcode to HDV. Typically, export to tape will
message appears in the Status option, click Cancel to close the Export To Tape dialog
box.
You can export to videotape without device control by operating the playback controls in
2. Make sure that the sequence plays back on your deck or camera. If it does not, review
the steps for preparing for exporting to tape (See Prepare for exporting to DV
3. Make sure that the video recording device is in Record-Pause mode, and that the tape
4. Position the current-time indicator at the beginning of the sequence (or work area, as
needed).
5. Press the Record or Pause button on the device, as needed to put the device into
Record mode.
7. When the program finishes, press the Stop button in the Program Monitor, and then
6. What should be the resolution if we are using Cable internet and want
to use PAL 4 x 3?
[Link]
[Link]
[Link]
[Link]
[Link]
premiere-pro/
[Link]
[Link]
[Link]
[Link]
[Link]
[Link]
Unit 9
Internship
1. Internship Introduction
1.1 Internship criteria
1.2 Why Internships
1.3 Benefits to Department
1.4 Benefits to Students
2. Internship coordinator
3. Interns
3.1 How to Begin
3.2 How to Apply
3.3 Responsibilities
3.4 Intern Rights
4. Internship Completion
5. Supervising an intern
6. Training
7. Orientation
9. Evaluations
Departments employ interns during the school throughout the year. Students can earn
Interning in the related field will stand out on a student’s resume and help them with their
job search after graduation. Participating interns gain on-the-job training that integrates
education, career development and public service, while agencies hosting interns benefit
Everyone a student meets during the course of their internship is now a contact. These
people can help guide their career path as they make their way into the business world.
These people know other people in the industry as well and can provide introductions.
The fellow interns they meet may also become great contacts in the future.
Internships allow students the opportunity to apply their knowledge and skills in
experiencewith the goal being togain additional knowledge fromon the jobexposure.
credits. Internships may be arranged independently from the curriculum in which students
Following is the criteria to meet for internships. According to certain standards listed
below:
Internships allow students the opportunity to apply their knowledge and skills in a
Professional setting while still doing course.
Internships offer carefully planned and monitored work experience with the goal
being togain additional knowledge from on the job exposure.
Internships may also be part of an educational program in which students can earn
academic credits from their college. Internships may be arranged independently
fromthe curriculum in which students would gain work experience only.
2. Internship Coordinator
• Conduct on-campus recruiting to ensure students are aware that the department is
offering internship opportunities.
• Advertise the department’s recruitment opportunities.
• Coordinate the recruiting and screening of intern applicants.
• Assist in the selection of interns.
• Promote internship opportunities within the department.
• Serve as the contact regarding the department’s internships.
• Review and revise the department’s internship procedures as needed.
• Serve as a liaison between intern supervisors and university.
3. Interns
• Internships allow students the opportunity to apply their knowledge and skills in a
professional setting while still completing course.
• Internships offer carefully planned and monitored work experience with the goal
being togain additional knowledge from on the job exposure.
• Internships may also be part of an educational program in which students can earn
academic credits from their college. Internships may be arranged independently
from the curriculum in which students would gain work experience only.
Interns should:
• Analyze their skills, values and interests to determine the location and working
environment desired.
• Prepare a resume and cover letter and have them critiqued at their career center.
• Network with alumni, college professors, friends, and family.
Internships are defined at the end of the course through departments, at Student
Internship Positions. Please follow the directions on each individual internship flyer.
3.3 Responsibilities
Interns should:
Unpaid interns have the same legal rights as employees inregards to protection against
discrimination and harassment. However, interns do nothave the same rights as
employees in the realms of unemployment compensation or termination procedures.
4. Internship Completion
• The intern supervisor will provide the student with a letter of recommendation.
• The student Intern will evaluate the overall internship experience. The evaluation
form must be returned to the internship coordinator.
5. Supervising an Intern
An intern will have a designated site supervisor who is responsible for providing
orientation and supervision. This will be someone, available to the student on a regular
basis, and possesses expertise in the area in which the intern will work. Even if the intern
will rotate through various departments in order to gain broad-based experience, there
still will be a single overall supervisor who oversees the internship as a whole. Dear
student on choosing a supervisor, it is important to choose someone who is interested in
working with university students; has the time to invest in the internship, especially
during the first few weeks; and possesses qualities such as leadership, strong
communication skills, and patience.
Because an internship is defined as a learning experience, proper supervision of the intern
is essential. The supervisor is very important element in internship and he/she will be
serving as a teacher, mentor, critic, and boss. Ongoing supervision of the student intern is
the key to the success of the internship. This is especially true for students who do not
have extensive work experience.
Acknowledging and identifying the different expectations between the workplace and
school will help interns make a successful transition to the world of work.
An effective method of intern supervision is to have a set time to meet with the intern to
review progress on projects, touch base, and provide feedback. Some supervisors do this
over lunch; others choose a more formal setting.
The supervisor will oversee and assign the student intern’s work. Supervisors will need to
monitor the intern’s time and submit an intern evaluation form provided by the intern’s
college for those receiving academic credit. The intern supervisor will also provide the
student with a letter of recommendation.
6. Training
Establish goals and objectives, and clarify these goals and objectives before the intern
begins working. Some interns need more guidance than others, and many factors must be
taken into consideration. Consider the intern’s cultural background, disabilities, learning
style and experience. Evaluate his or her level of maturity and confidence. Is the intern a
critical thinker or a creative problem-solver?
• Information about the organization. The university will review documents that
are important for them to understand the big picture. If available, include an
organizational chart that explains various roles and responsibilities of employees.
• Structure. Interns might not be familiar with formal workplace procedures (e.g.,
attendance policies, break times, days off). Make sure to clarify relevant policies
and procedures to interns on their first day.
• Introductions. Take time in the beginning of the internship to introduce the
intern to the people in your program. Allow more time for conversation with those
employees who are likely to interact with the intern on a regular basis. Some
interns, based on personality or culture, may be reluctant to seek out co-workers
on their own. By making a special effort to encourage those contacts early on,
interns will feel more comfortable asking for advice or support later.
8. Ongoing Training
Interns, as students, appreciate any opportunity to learn new skills or increase their
knowledge. Developing a plan for training throughout the internship will keep students
interested in the position and ready to tackle new challenges. Ongoing training may
include the following:
• Skill development. There may be a need for training in specific skills such as
computer programs, office equipment, or other tasks directly related to the job.
Even bright students with great potential will struggle if they are not instructed in
the specifics related to successful completion of duties.
• Shadowing. Allow interns to participate in activities and meetings. Interns may
have leadership potential but not understand the culture of your organization.
They will rely on their supervisor to educate them.
• Questions. Interns might not know when to speak or how or what to ask. Assist
them in actively learning by explaining and clarifying everything. Suggest and
encourage questions at appropriate times.
• Professional conferences or association meetings. If possible, offer interns the
opportunity to attend training or networking events. It helps interns to get a feel
for the overall mission of your organization, and at the same time make them feel
that they are valued.
9. Evaluations
The student will also evaluate the internship experience, which is important
indetermining the value of the work experience for future interns. Categories might
include:
[Link] Completion
An internship should have a clearly stated end date that is identified before the internship
begins. Completing a formal evaluation process such as the one described above can help
both the site supervisor and the intern bring closure to the experience. A letter of
recommendation from the Intern supervisor shall be given to the intern on the last day of
work.
You also may want to have some form of acknowledgment such as a lunch with
coworkers in the final week of the internship. Because co-workers often have extensive
contact with interns, this type of event can be a positive way to recognize the contribution
of other employees as well as the intern.
Internships allow students the opportunity to apply their knowledge and skills in a
professional setting. Students will gain valuable work experience and the opportunity to
explore career avenues.
The department advertises their intern positions at local radio stations and production
houses.
Is my internship paid?
There are no paid positions available. The department will provide internships to students
as volunteers or for academic credit.
You will receive a letter of recommendation from your internship supervisor. You will
also have an opportunity to evaluate the department’s internship program.
Institute of Educational Technology
Intern's Name:___________________________________________________________
Year: ______________
What resources did you use to find your internship? (Check all that apply)
Internship field:
_____________________________________________________
_____________________________________________________
____________________________________________________________
______________________________________________________
_________________________________________________________________________________
Department ____________________________ Date ________________________
Please rate the following aspects of your Internship placement on the basis of this scale:
Select one evaluation level for each area by marking an “X” under the level that
represents the internship.
Comments if any
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
Would you work for this supervisor again?
Yes No Uncertain
Would you work for this agency where doing internship again?
Yes No Uncertain
Would you recommend this agency where doing internship to other students?
Yes No Uncertain
____________________________________________________________________
____________________________________________________________________
____________________________________________________________________
Thank you very much for completing this evaluation of your internship. We take
your comments very seriously. Please return this evaluation to the university.
Supervisor Evaluation of Student Internship
Please rate the following aspects of your Internship placement on the basis of this scale:
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
________________________________________________________________________
Yes No Uncertain
Yes No Uncertain
Yes No Uncertain
Why or why not? ___________________________________________________
__________________________________________________________________
__________________________________________________________________
__________________________________________________________________
Thank you very much for completing this evaluation of your intern. We take your
comments very seriously. Please return this evaluation to the FAX number or address
listed above.