Admiralty Notices To Mariners: Weekly Edition 04
Admiralty Notices To Mariners: Weekly Edition 04
253 -- 366/22
T & P Notices in Force
ADMIRALTY
NOTICES TO MARINERS
Weekly Edition 04
27 January 2022
(Published on the ADMIRALTY website 17 January 2022)
CONTENTS
For information on how to update your ADMIRALTY products using ADMIRALTY Notices to
Mariners, please refer to NP294 How to Keep Your ADMIRALTY Products Up--to--Date.
Mariners are requested to inform the UKHO immediately of the discovery of new or suspected
dangers to navigation, observed changes to navigational aids and of shortcomings in both paper
and digital ADMIRALTY Charts or Publications.
The H--Note App helps you to send H--Notes to the UKHO, using your device’s camera, GPS and
email. It is available for free download on Google Play and on the App Store.
The Hydrographic Note Form (H102) should be used to forward this information and to report any
ENC display issues.
H102A should be used for reporting changes to Port Information.
H102B should be used for reporting GPS/Chart Datum observations.
Copies of these forms can be found at the back of this bulletin and on the UKHO website.
The following communication facilities are available:
NMs on ADMIRALTY website: Web: [Link]/msi
Searchable Notices to Mariners: Web: [Link]/nmwebsearch
Urgent navigational information: e--mail: navwarnings@[Link]
Phone: +44(0)1823 353448
+44(0)7989 398345
Fax: +44(0)1823 322352
H102 forms e--mail: sdr@[Link]
(see back pages of this Weekly Edition) Post: UKHO, Admiralty Way, Taunton,
Somerset, TA1 2DN, UK
All other enquiries/information e--mail: customerservices@[Link]
Phone: +44(0)1823 484444 (24/7)
Crown Copyright 2022. All rights Reserved. Permission is not required to make analogue or PDF copies
of these Notices, but such copies may not be sold without the permission of the UKHO. For permission to
sell copies of the Notices or to make (non -- PDF) digital copies please email
[Link]@[Link]
I
The Weekly Notices to Mariners (NM) updates for paper Charts and Publications can be accessed via
[Link]/msi or the searchable NM Website [Link]/nmwebsearch The latest
digital NM Weekly update is available 10 days prior to the paper publication date; there are no
subscription fees for access to the UKHO Notices to Mariners Website.
NB: The NM database includes historical NM data from 1 January 2000, for NMs prior to 2000 the
Cumulative List of Notices to Mariners (NP234B-00) must be used.
Software required:
Adobe Acrobat Reader (Version 6.0 or later). Reader software can be obtained direct from the Adobe
website ([Link]).
Enter the [Link]/nmwebsearch website and select the search option that you require
following the on screen instructions:
To view the NM, NM Note or full-colour NM Blocks, click on the relevant link.
Enter the [Link]/msi website, and then select Notices to Mariners. This will give you access
to the following range of Notice to Mariners services:
- ADMIRALTY NM Web Search
- Weekly NMs
- NM Block, Notes and Diagrams
- Annual NMs
- Cumulative NM List
For further details of the online NM facilities please see the NM Guidance Notes on the website,
additional detail includes:
File content and description
PC and printer specifications
CUSTOMER SERVICE
If you experience any difficulties, please contact the UKHO Customer Services Team in the UK on:
Tel: +44 (0) 1823 484444 (office hours Monday-Friday 6am-10pm GMT and an on call service for
emergency permits operated 24/7)
Email: customerservices@[Link]
Wk04/22 1.2
,
:KLOHHYHU\HIIRUWLVPDGHWRHQVXUHWKDWWKHGDWDSURYLGHGWKURXJKWKH1RWLFHVWR0DULQHUV
VHUYLFHLVDFFXUDWHWKHXVHUQHHGVWREHDZDUHRIWKHULVNVRIFRUUXSWLRQWRGDWD,WLVLPSRUWDQW
WKDWWKHXVHUVKRXOGRQO\XVHWKHGDWDRQVXLWDEOHHTXLSPHQWDQGWKDWRWKHUDSSOLFDWLRQVVKRXOG
QRW EH UXQQLQJ RQ WKH XVHU¶V PDFKLQH DW WKH VDPH WLPH 8VHUV VKRXOG H[HUFLVH WKHLU
SURIHVVLRQDOMXGJHPHQWLQWKHXVHRIGDWDDQGDOVRFRQVXOWWKH0DULQHUV¶+DQGERRN13
IRUIXUWKHUGHWDLOV
7KH XVHU QHHGV WR EH DZDUH WKDW WKHUH LV D SRVVLELOLW\ WKDW GDWD FRXOG EH FRUUXSWHG GXULQJ
WUDQVPLVVLRQRULQWKHSURFHVVRIGLVSOD\RUSULQWLQJRQWKHXVHU¶VHTXLSPHQWRULIFRQYHUWHG
WR RWKHU VRIWZDUH IRUPDWV DQG LV DFFRUGLQJO\ DGYLVHG WKDW WKH 8.+2 FDQQRW DFFHSW
UHVSRQVLELOLW\ IRU DQ\ VXFK FKDQJH RU DQ\ PRGLILFDWLRQV RU XQDXWKRULVHG FKDQJHV PDGH E\
OLFHQVHHVRURWKHUSDUWLHV
© Crown Copyright 2020. All rights reserved. Correct at the time of publishing.
Wk04/22
I
EXPLANATORY NOTES
Dating
Weekly Notices are dated for the Thursday appropriate to the week that the printed version is despatched from the UKHO.
They are available earlier from the UKHO website.
Section I - Publications List
At the beginning of the Publications List is an index of ADMIRALTY Charts affected by the Publications List. Thereafter
there are a number of standard lists which contain details and announcements concerning charts and publications relevant for
the particular Weekly Notice. Full details of how to use the various lists contained in Section I are available in NP294.
Special Announcements and Errata are occasionally included at the end of this Section.
Section IA - Temporary and Preliminary (T&P) Notices
A list of T&P Notices in force (along with a list of those cancelled during the previous month), is included in the Weekly NM
each month (see below).
Section IB - Current Nautical Publications
Information about Publications including the current edition numbers is included in the Weekly NM at the end of March,
June, September and December.
Section II - Updates to Standard Nautical Charts
The notices in Section II give instructions for the updating of standard nautical charts and selected thematic charts in the
ADMIRALTY series. Geographical positions refer to the horizontal datum of the current edition of each affected chart
which is stated in the notice alongside the appropriate chart number. Positions are normally given in degrees, minutes and
decimals of a minute, but may occasionally quote seconds for convenience when plotting from the graduation of some older-
style charts. Where Leisure Products are referred to different horizontal datums from the standard nautical charts for that
geographical area, positions in the notices cannot be plotted directly on these products. Bearings are true reckoned clockwise
from 000° to 359°; those relating to lights are from seaward. Symbols referred to are those shown in NP5011. Depths and
heights are given in metres or fathoms and/or feet as appropriate for the chart being updated (abbreviated where necessary to
m, fm and ft respectively). Blocks and notes accompanying notices in Section II are placed towards the end of the section.
T&P Notices. These are indicated by (T) or (P) after the notice number and are placed at the end of Section II. They are
printed on one side of the paper in order that they may be cut up and filed. To assist in filing, the year is indicated after the
notice number and an in-force list is published monthly. Information from these notices is not included on charts before
issue; charts should be updated in pencil on receipt. Associated diagrams are reproduced with Blocks at the end of Section II.
Original Information. A star (*) adjacent to the number of a notice indicates that the notice is based on original
information.
Section III - Navigational Warnings
NAVAREA I Navigational Warnings in force at the specified time quoted in the header are reprinted in Section III. It is
recommended that this reprint should be kept in a file or book, followed by subsequent weekly reprints. Only the most
convenient ADMIRALTY Chart is quoted. The full text of all Warnings in force is included in Weeks 1, 13, 26 and 39 each
year.
Section IV - Sailing Directions
Updates to all Sailing Directions are given in Section IV of ADMIRALTY Notices to Mariners. Those in force at the end of
the year are reprinted in NP247(2) Annual Summary of ADMIRALTY Notices to Mariners Part 2. A list of updates in force is
published in Section IV of the Weekly Edition quarterly. Full details of how to keep Sailing Directions up-to-date can be
found in NP294 How to Keep Your ADMIRALTY Products Up-to-Date.
In 2018, the UKHO began the process of removing AIS and Racon information from ADMIRALTY Sailing Directions, as
this is held in greater detail within ADMIRALTY Radio Signals publications. During this transition, AIS and Racon
information will be removed from new editions of each Sailing Direction volume, and AIS and Racon information present in
existing Sailing Direction volumes will no longer be updated. For accurate, up-to-date information on AIS and Racons, refer
to ADMIRALTY Radio Signals publications.
Section V - Lights
Updates to all the List of Lights are given in Section V and may be published in an earlier edition than the chart-updating
notice. The entire entry for each light updated will be printed (including minor changes) and an asterisk (*) will denote which
column contains a change. In the case of a new light, or where a new sequence is added below the main light, an asterisk (*)
will appear under all columns. All Section V entries are intended to be cut out and pasted into the appropriate volume. It is
emphasised that the List of Lights is the primary source of information on lights and that many alterations, especially those of
a temporary but operational nature, are promulgated only as updates to the List of Lights. Light positions should be
regarded as approximate and are intended to indicate the relative positions of lights only. Charts should be consulted for a
more authoritative position. When a light is affected by a separate chart-updating notice, its Light List number is always
included in the relevant text contained in Section II. The range of a light is normally the nominal range, except when the
responsible authority quotes luminous or geographical range - see special remarks for ranges used by each country.
Wk04/22 1.4
,
6HFWLRQ9,5DGLR6LJQDOV
8SGDWHVWRDOOWKH5DGLR6LJQDOVDUHJLYHQLQ6HFWLRQ9,:KHQDFKDUWXSGDWLQJQRWLFHLVLVVXHGIRULQIRUPDWLRQWKDWLVDOVR
LQFOXGHG ZLWKLQ WKH 5DGLR 6LJQDOV WKH DSSURSULDWH YROXPH UHIHUHQFH QXPEHU LV TXRWHG IROORZHG LQ SDUHQWKHVHV E\ WKH
QXPEHURIWKH:HHNO\(GLWLRQFRQWDLQLQJLQ6HFWLRQ9,WKHFRUUHVSRQGLQJXSGDWHWRWKHVHUYLFHGHWDLOV7KHXSGDWHVLQ
6HFWLRQ9,VKRXOGEHFXWRXWDQGSDVWHGLQWRWKHDSSURSULDWHYROXPHV
6HFWLRQ9,,0LVFHOODQHRXV3XEOLFDWLRQV
8SGDWHVWRWKHIROORZLQJVHOHFWHGPLVFHOODQHRXV1DXWLFDO3XEOLFDWLRQVDUHFRQWDLQHGLQ6HFWLRQ9,,
13 7KH0DULQHU¶V+DQGERRN
13$ 3DSHU&KDUW0DLQWHQDQFH5HFRUG
13& (1&0DLQWHQDQFH5HFRUG
13 $'0,5$/7<*XLGHWRWKH3UDFWLFDO8VHRI(1&V
13 $'0,5$/7<*XLGHWR,PSOHPHQWDWLRQ3ROLF\DQG3URFHGXUHV
13 +RZWR.HHS\RXU$'0,5$/7<3URGXFWV8SWRGDWH
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±$WODQWLF2FHDQ
13 $'0,5$/7<2FHDQ3DVVDJHVIRUWKH:RUOG±,QGLDQDQG3DFLILF2FHDQV
13 $'0,5$/7<'LVWDQFH7DEOHV±$WODQWLF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±3DFLILF2FHDQ
13 $'0,5$/7<'LVWDQFH7DEOHV±,QGLDQ2FHDQ
13 ,$/$0DULWLPH%XR\DJH6\VWHP
13 6\PEROVDQG$EEUHYLDWLRQVXVHGRQ$'0,5$/7<3DSHU&KDUWV
13 $'0,5$/7<*XLGHWR(1&6\PEROVXVHGLQ(&',6
$OO7LGHV3XEOLFDWLRQV
1DXWLFDO$OPDQDF3XEOLFDWLRQVLQFOXGLQJ6LJKW5HGXFWLRQ7DEOHV
6HFWLRQ9,,,±$'0,5$/7<'LJLWDO6HUYLFHV
,QIRUPDWLRQUHOHYDQWWR$'0,5$/7<'LJLWDO6HUYLFHV
)XUWKHU*XLGDQFH
7KH0DULQHU¶V+DQGERRN13JLYHVDIXOOHUH[SODQDWLRQRIWKHOLPLWDWLRQVRIFKDUWVDQGGHWDLOVRIWKH8.+2SROLF\IRU
WKHSURPXOJDWLRQDQGVHOHFWLRQRIQDYLJDWLRQDOO\VLJQLILFDQWLQIRUPDWLRQIRUFKDUWV'HWDLOVRIFKDUWXSGDWLQJPHWKRGVFDQEH
IRXQG LQ ³+RZ WR .HHS <RXU $'0,5$/7< 3URGXFWV 8SWRGDWH´ 13 $OO XVHUV DUH DGYLVHG WR VWXG\ WKHVH
SXEOLFDWLRQV
&$87,21$5<127(6
8SGDWLQJ
8SGDWLQJ LQIRUPDWLRQ LV SXEOLVKHG E\ :HHNO\ 1RWLFHV WR 0DULQHUV VXSSOHPHQWHG E\ QDYLJDWLRQDO ZDUQLQJV IRU LWHPV RI
LPPHGLDWHLPSRUWDQFH,WVKRXOGEHERUQHLQPLQGWKDWWKH\PD\EHEDVHGRQUHSRUWVZKLFKFDQQRWDOZD\VEHYHULILHGEHIRUH
SURPXOJDWLRQDQGWKDWLWLVVRPHWLPHVQHFHVVDU\WREHVHOHFWLYHDQGSURPXOJDWHRQO\WKHPRUHLPSRUWDQWLWHPVWRDYRLG
RYHUORDGLQJXVHUVWKHUHPDLQGHUEHLQJLQFOXGHGLQUHYLVHGHGLWLRQVRIWKHFKDUWVDQGSXEOLFDWLRQVFRQFHUQHG
/DZVDQG5HJXODWLRQV
:KLOHLQWKHLQWHUHVWVRIWKHVDIHW\RIVKLSSLQJWKH8.+2PDNHVHYHU\HQGHDYRXUWRLQFOXGHLQLWVSXEOLFDWLRQVGHWDLOVRIWKH
ODZVDQGUHJXODWLRQVRIDOOFRXQWULHVDSSHUWDLQLQJWRQDYLJDWLRQLWPXVWEHFOHDUO\XQGHUVWRRG
aWKDWQROLDELOLW\ZKDWVRHYHUFDQEHDFFHSWHGIRUIDLOXUHWRSXEOLVKGHWDLOVRIDQ\SDUWLFXODUODZRUUHJXODWLRQDQG
bWKDWSXEOLFDWLRQRIWKHGHWDLOVRIDODZRUUHJXODWLRQLVVROHO\IRUWKHVDIHW\DQGFRQYHQLHQFHRIVKLSSLQJDQGLPSOLHVQR
UHFRJQLWLRQRIWKHLQWHUQDWLRQDOYDOLGLW\RIWKHODZRUUHJXODWLRQ
5HOLDQFHRQ&KDUWVDQG$VVRFLDWHG3XEOLFDWLRQV
:KLOH HYHU\ HIIRUW LV PDGH WR HQVXUH WKH DFFXUDF\ RI WKH LQIRUPDWLRQ RQ $'0,5$/7< FKDUWV DQG ZLWKLQ QDXWLFDO
SXEOLFDWLRQVLWVKRXOGEHDSSUHFLDWHGWKDWLWPD\QRWDOZD\VEHFRPSOHWHDQGXSWRGDWH7KHPDULQHUPXVWEHWKHILQDOMXGJH
RIWKHUHOLDQFHKHFDQSODFHRQWKHLQIRUPDWLRQJLYHQEHDULQJLQPLQGKLVSDUWLFXODUFLUFXPVWDQFHVORFDOSLORWDJHJXLGDQFH
DQGWKHMXGLFLRXVXVHRIDYDLODEOHDLGVWRQDYLJDWLRQ
&KDUWV
&KDUWVVKRXOGEHXVHGZLWKSUXGHQFH WKHUHDUHDUHDVZKHUH WKHVRXUFHGDWDDUHROG LQFRPSOHWHRURISRRUTXDOLW\7KH
PDULQHUVKRXOGXVHWKHODUJHVWVFDOHDSSURSULDWHIRUKLVSDUWLFXODUSXUSRVHDSDUWIURPEHLQJWKHPRVWGHWDLOHGWKHODUJHU
VFDOHVDUHXVXDOO\XSGDWHGILUVW:KHQH[WHQVLYHQHZLQIRUPDWLRQVXFKDVDQHZK\GURJUDSKLFVXUYH\LVUHFHLYHGVRPH
PRQWKV PD\ HODSVH EHIRUH LW FDQ EH IXOO\ LQFRUSRUDWHG LQ SXEOLVKHG FKDUWV 2Q VPDOO VFDOH FKDUWV RI RFHDQ DUHDV ZKHUH
K\GURJUDSKLFLQIRUPDWLRQLVLQPDQ\FDVHVVWLOOVSDUVHFKDUWHGVKRDOVPD\EHLQHUURUDVUHJDUGVSRVLWLRQOHDVWGHSWKDQG
H[WHQW8QGLVFRYHUHGGDQJHUVPD\H[LVWSDUWLFXODUO\DZD\IURPZHOOHVWDEOLVKHGURXWHV
6DWHOOLWH'HULYHG3RVLWLRQVDQG&KDUW$FFXUDF\
0DULQHUVPXVWQRWDVVXPHWKDWFKDUWVZKLFKDUHUHIHUUHGWR:*6'DWXPRUWKRVHIRUZKLFKVKLIWVWR:*6'DWXPDUH
SURYLGHGKDYHEHHQVXUYH\HGWRPRGHUQVWDQGDUGVRIDFFXUDF\2QVRPHFKDUWVRZLQJWRWKHDJHDQGTXDOLW\RIWKHVRXUFH
LQIRUPDWLRQVRPHRIWKHFKDUWHGGHWDLOPD\QRWEHSRVLWLRQHGDFFXUDWHO\,QVXFKFDVHVPDULQHUVDUHDGYLVHGWRH[HUFLVH
SDUWLFXODUFDXWLRQZKHQQDYLJDWLQJLQWKHYLFLQLW\RIGDQJHUVHYHQZKHQXVLQJDQHOHFWURQLFSRVLWLRQLQJV\VWHPVXFKDV*36
)RUIXUWKHUGHWDLOVVHH7KH0DULQHU¶V+DQGERRN137KLVDSSOLHVWRERWKSDSHUDQGGLJLWDO$'0,5$/7<5DVWHU
&KDUW6HUYLFHDQG(1&YHUVLRQVRIFKDUWV
Wk04/22
I
[04/22]
ADMIRALTY Charts affected by the Publication List
UKHO Products and Services, including foreign charts, in the Baltic Sea region are changing to a
new vertical reference system for depth and height information. During this transition period,
Charts may be referred to either mean sea level or the new BSCD2000. For further information
please contact the national charting authority and see ADMIRALTY Sailing Directions.
This note is to be reviewed in 2026.
COVID-19 (CORONAVIRUS)
UPDATE ON THE EFFECTS ON THE DELIVERY OF NAUTICAL PUBLICATIONS
As a result of ongoing effects of COVID-19 on distribution infrastructure around the world, for
safety reasons, we took the decision a few months ago to delay the publication of any non-essential
ADMIRALTY Nautical Publications until further notice.
We have been continuously monitoring the situation ever since this decision was made.
In view of the progressively reduced effects of COVID-19 on our distribution network across the
world, we are now in a position to start easing the restrictions on the dispatch of our paper
publications.
We will publish a limited number of ADMIRALTY Nautical Publications in July 2020 and closely
monitor our distribution network capacities. Information gathered during this period will help us
finalise our future plans to resume to a normal publications schedule as soon as we are able to.
Wk04/22 1.6
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
Chart Title, limits and other remarks Scale Folio 2022 Catalogue
page
1446 International Chart Series, Scotland - East Coast, Aberdeen Harbour. 1:7,500 6 28
INT 1542 Approaches to Aberdeen. 1:15,000
2211 International Chart Series, Baltic Sea - Gulf of Finland, Porkkala and 1:25,000 11 36
INT 12511 Kantvik.
3819 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to 1:50,000 11 36
INT 1251 Porkkala and Kantvik.
1.7 Wk04/22
I
ADMIRALTY CHARTS AND PUBLICATIONS NOW PUBLISHED AND AVAILABLE
ADMIRALTY Publications
NP83 ADMIRALTY List of Lights and Fog Signals 27/01/2022 Updated to Week 50/21 (01/12/2021).
Western Pacific Ocean, South of the Equator First Updates in NM Week 04/22.
Including Bismarck, Solomon, Coral and Tasman Seas Volume K, Edition 1 (2021) is cancelled.
Volume K, 2nd Edition (2022)
Wk04/22 1.8
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
775 Cyprus - West Coast, Cape Arnauti to Cape Limniti and Cape 1:100,000 775 30 46
Aspro.
Includes significant safety-related information as follows: new
marine protected areas and changes to wrecks, lights, marine farms
and coastline.
821 International Chart Series, Sweden - East Coast, Stockholms 1:25,000 821 10 36
INT 1237 Skärgärd, Sandhamn to Östra Saxarfjärden. INT 1237
A Continuation at the same scale. 1:25,000
1283 China - East Coast, Dafeng Gang and Approaches. 1:50,000 1283 52 82
1716 China - Taiwan Strait, Nanri Qundao to Shenhu Wan. 1:120,000 1716 50 80
3875 Vietnam - North East Coast, Hai Phong to Cam Pha. 1:75,000 3875 47 76
1.9 Wk04/22
I
ADMIRALTY CHARTS AND PUBLICATIONS TO BE PUBLISHED
3881 Vietnam - North East Coast, Outer Approaches to Hai Phong. 1:25,000 3881 47 76
3882 Vietnam - North East Coast, Hai Phong and Approaches. 1:25,000 3882 47 76
A Hai Phong. 1:25,000
4754 International Chart Series, Nova Scotia / Nouvelle-Écosse, 1:10,000 4754 80 130
INT 4633 Southeast Coast / Côte Sud – Est, Halifax Harbour, Point Pleasant INT 4633
to/à Bedford Basin.
Ocean Terminals. 1:5,000
44° 37’·40 N — 44° 38’·60 N., 63° 33’·42 W — 63° 34’·10 W
4769 Canada, Golfe du Saint-Laurent/Gulf of St Lawrence, Baie des 1:36,360 4769 79 130
Chaleurs / Chaleur Bay, Rivière Ristigouche / Restigouche River.
Dalhousie Harbour. 1:7,200
Wk04/22 1.10
I
CHARTS TO BE AVAILABLE 10 FEBRUARY 2022
New Charts
Charts to be 2022
Chart Title, limits and other remarks Scale WITHDRAWN Folio Catalogue
page
IN259 International Chart Series, India - West Coast, Badagara to Kochi. 1:300,000 IN259 41 58
INT 7356 09° 48’·00 N — 11° 36’·00 N, 73° 48’·00 E — 76° 35’·00 E INT 7356
IN260 International Chart Series, India - West Coast, Kochi to 1:300,000 IN260 41 58, 64
INT 7362 Thiruvananthapuram. INT 7362
08° 17’·00 N — 10° 06’·00 N, 74° 20’·00 E — 77° 08’·00 E
IN261 International Chart Series, India - West Coast, Eight Degree Channel 1:300,000 IN261 41 58, 64
INT 7363 to Kanniyākumāri. INT 7363
06° 43’·00 N — 08° 31’·00 N, 74° 20’·00 E — 77° 34’·00 E
1.11 Wk04/22
I
ADMIRALTY Charts
Chart to be On publication of
WITHDRAWN Main Title New Chart/New Edition
1446 International Chart Series, Scotland - East Coast, Aberdeen Harbour. 1446
INT 1542 INT 1542
2211 International Chart Series, Baltic Sea - Gulf of Finland, Porkkala and Kantvik. 2211
INT 12511 INT 12511
3819 International Chart Series, Baltic Sea - Gulf of Finland, Approaches to 3819
INT 1251 Porkkala and Kantvik. INT 1251
Amend:
OneOcean (Singapore)
230 Victoria Street
Level 15 Bugis Junction Towers
188024
T: +65 6545 9880
F: +65 6545 8892
singapore@[Link]
[Link]
Paper, Digital
Wk04/22 1.12
I
Amend:
1.13 Wk04/22
IA
TEMPORARY AND PRELIMINARY NOTICES
In Force 21 January 2022
Cancelled Notices
2. BRITISH ISLES
397(T)/14 2792 ...................... IRELAND, West Coast: Light-beacons; Pontoon.............................................. 4
2521(P)/15 Q 6403, Q 6404...... SCOTLAND, West Coast: Firing practice area ................................................. 350
3304(P)/16 Q 6403, Q 6404...... SCOTLAND, West Coast: Military practice areas ............................................ 350
5111(P)/16 8156 ...................... ENGLAND, East Coast: Landmark................................................................... 8
5048(P)/17 8156 ...................... ENGLAND, East Coast: Landmarks ................................................................. 8
3771(P)/18 871, 1902 ............. ENGLAND, South Coast: Works....................................................................... 1
3869(P)/18 8156 ...................... ENGLAND, East Coast: Jetty; Berth................................................................. 8
4041(P)/18 8156 ...................... ENGLAND, East Coast: Note............................................................................ 8
2349(P)/19 2480, 2498 ........... SCOTLAND, West Coast: Depths ..................................................................... 5
2688(T)/19 536 ........................ ENGLAND, South Coast: Wreck ...................................................................... 1
2900(T)/19 106, 1503, 1504 .. ENGLAND, East Coast: Offshore installation; Works ...................................... 7
4297(T)/19 2388 ...................... SCOTLAND, West Coast: Scientific instruments ............................................. 5
4447(P)/19 44, 1192, 1468, IRISH SEA: Works; Submarine cables .............................................................. 3, 7
1981, 2094, 2182B,
2696 ......................
5544(T)/19 2022 ...................... ENGLAND, South Coast: Works; Lights .......................................................... 1
5730(P)/19 2905 ...................... SCOTLAND, West Coast: Works; Pontoons; Dredging area; Reclamation area 5
5785(P)/19 2702, 2725, 2767, IRELAND, West Coast: Works; Spoil ground ................................................... 4
2792 ......................
6028(P)/19 2793 ...................... ENGLAND, South Coast: Depths; Works; Pontoons ........................................ 1
6271(P)/19 2628 ...................... ENGLAND, South Coast: Maintained channels; Dredged areas; Depths; 1
Works; Jetty........................................................................................................
69(T)/20 2793 ...................... ENGLAND, South Coast: Buoy ........................................................................ 1
1A.1
Wk04/22
IA
2. BRITISH ISLES - continued
97(T)/20 3273, 3274 ........... WALES, South Coast: Buoy .............................................................................. 2
445(P)/20 1125, 2667, 2704. IRELAND, West Coast: Submarine cable ......................................................... 4
825(T)/20 1994, 2000 ........... SCOTLAND, West Coast: Pier .......................................................................... 3
1651(P)/20 2209, 2480, 2498, SCOTLAND, West Coast: Depths; Drying height............................................. 5
2534 ......................
1667(T)/20 1413, 2011............ WALES, North Coast: Wrecks ........................................................................... 3
1684(P)/20 2011....................... WALES, North Coast: Light; Obstructions; Buoy; Works................................. 3
1728(T)/20 2, 1127, 4010, IRELAND, West Coast: Buoy............................................................................ 5, 6, 15,19
4011, 4014, 4102.
1755(T)/20 741 ........................ SCOTLAND, East Coast: Wreck....................................................................... 6
2456(P)/20 1794, 2209, 2210, SCOTLAND, West Coast: Depths ..................................................................... 5
2479, 2480 ...........
3151(T)/20 104, 107, 1190..... ENGLAND, East Coast: Buoyage ..................................................................... 7
3360(P)/20 8156 ...................... ENGLAND, East Coast: Radio reporting point................................................. 8
3728(T)/20 2046 ...................... IRELAND, South Coast: Buoy .......................................................................... 2
3755(P)/20 8156 ...................... ENGLAND, East Coast: Restricted area ........................................................... 8
3862(T)/20 3741 ...................... ENGLAND, East Coast: Marine farms; Buoyage ............................................. 7
4224(P)/20 1463, 1977, 1978 WALES, North Coast: Depths............................................................................ 3
4385(T)/20 807, 808, 3140, CHANNEL ISLANDS, Guernsey: Buoyage; Measuring instruments .............. 16
3654 ......................
4981(T)/20 1161....................... WALES, South Coast: Pier ................................................................................ 2
5185(T)/20 1464 ...................... WALES, North Coast: Wreck ............................................................................ 3
5203(T)/20 104, 107, 1190, ENGLAND, East Coast: Radar beacon ............................................................. 7
2182A, 2182B......
5338(P)/20 1481 ...................... SCOTLAND, East Coast: Works ....................................................................... 6
5762(P)/20 1415 ...................... IRELAND, East Coast: Works........................................................................... 3
5791(P)/20 2207, 2208 ........... SCOTLAND, West Coast: Depths ..................................................................... 5
5864(T)/20 1951, 1953, 1978 ENGLAND, West Coast: Scientific instruments; Buoyage ............................... 3
6238(P)/20 1757, 2209, 2210, SCOTLAND, West Coast: Depths ..................................................................... 5
2479, 2480, 2498,
2534 ......................
6266(T)/20 219, 1127, 1128, SCOTLAND, West Coast: Scientific instruments ............................................. 5, 6
1785, 2635, 2720,
2721, 2722 ...........
195(T)/21 2036, 2045 ........... ENGLAND, South Coast: Beacon..................................................................... 1
202(T)/21 2254, 2739 ........... IRELAND, West Coast: Buoy............................................................................ 4
453(P)/21 223 ........................ SCOTLAND, East Coast: Depths ...................................................................... 6
552(T)/21 2172, 2175, 2611, ENGLAND, South Coast: Works; Buoyage ...................................................... 1
2615 ......................
601(P)/21 1794 ...................... SCOTLAND, West Coast: Depths ..................................................................... 5
1054(T)/21 1907, 2131, 2221, SCOTLAND, West Coast: Beacons................................................................... 3
2491, 2724 ...........
1219(P)/21 30, 1267, 1613, ENGLAND, South Coast: Depths; Drying heights; Rocks ............................... 1
1900 ......................
1302(P)/21 8002 ...................... ENGLAND, South Coast: Automatic Identification System............................. 1
1439(T)/21 152, 156 ............... ENGLAND, East Coast: Buoy........................................................................... 7
1468(T)/21 1994 ...................... SCOTLAND, West Coast: Buoyage .................................................................. 3
1572(T)/21 2209, 2480, 2498 SCOTLAND, West Coast: Restricted area......................................................... 5
1577(T)/21 2210 ...................... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 5
2077(P)/21 1834, 2482 ........... ENGLAND, East Coast: Works ......................................................................... 8
2132(P)/21 111, 160, 1612..... ENGLAND, East Coast: Depths; Drying heights .............................................. 7
2466(T)/21 1076, 1482 ........... WALES, South Coast: Buoy .............................................................................. 2
2524(T)/21 104, 107, 1190..... ENGLAND, East Coast: Buoy........................................................................... 7
2568(T)/21 146, 1446 ............. SCOTLAND, East Coast: Scientific instruments; Buoyage .............................. 6
2574(P)/21 1077, 1889 ........... SCOTLAND, East Coast: Works; Quay ............................................................ 6
2576(P)/21 2771 ...................... SCOTLAND, West Coast: Works; Causeway; Pontoons................................... 5
2581(P)/21 1078 ...................... SCOTLAND, East Coast: Depths; Dredged depths; Works .............................. 6
2582(T)/21 2652, 2771 ........... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 5
1A.2
Wk04/22
IA
2. BRITISH ISLES - continued
2587(T)/21 2474 ...................... SCOTLAND, West Coast: Works; Berth; Pontoon............................................ 5
2612(T)/21 1479 ...................... SCOTLAND, East Coast: Buoy......................................................................... 6
2636(T)/21 1826, 1978 ........... WALES, North Coast: Scientific instruments; Buoyage.................................... 3
2672(T)/21 105, 108, 1190, ENGLAND, East Coast: Buoyage ..................................................................... 7
1408, 1503 ...........
2699(P)/21 2515 ...................... SCOTLAND, Hebrides: Works; Bridge............................................................. 6
2762(P)/21 108 ........................ ENGLAND, East Coast: Depths; Drying heights .............................................. 7
2783(P)/21 1975 ...................... ENGLAND, East Coast: Buoyage ..................................................................... 7
2887(T)/21 2723, 2725, 2752 IRELAND, North Coast: Obstructions .............................................................. 3, 4
2889(P)/21 3292 ...................... SCOTLAND, Shetland Islands: Works; Marina ................................................ 6
2923(P)/21 2172, 2175 ........... ENGLAND, South Coast: Anchorage area ........................................................ 1
2925(T)/21 1934 ...................... ENGLAND, East Coast: Works ......................................................................... 7
2939(P)/21 2, 1104, 1123, ENGLAND, West Coast: Submarine cable........................................................ 1, 2, 6, 16,
1156, 1178, 2649, 18
4103 ......................
2960(T)/21 3292 ...................... SCOTLAND, Shetland Islands: Works; Pier ..................................................... 6
2967(P)/21 121, 1190.............. ENGLAND, East Coast: Depths ........................................................................ 7
2973(T)/21 1121, 1411, 1415, IRELAND, East Coast: Buoyage; Automatic Identification Systems ............... 3
1468 ......................
2991(T)/21 1866 ...................... SCOTLAND, West Coast: Works; Berth ........................................................... 3
3025(T)/21 1838 ...................... IRELAND, West Coast: Buoy............................................................................ 2
3027(T)/21 115, 219, 1239, SCOTLAND, North Coast: Light ...................................................................... 6
1942, 1954, 2162,
2182C, 2581.........
3243(P)/21 2253 ...................... ENGLAND, South Coast: Works; Buoyage; Lights .......................................... 1
3316(T)/21 1411, 1468............ IRELAND, East Coast: Buoyage; Automatic Identification Systems; Scientific 3
instrument; Depth...............................................................................................
3792(T)/21 115, 1409.............. SCOTLAND, East Coast: Scientific instruments .............................................. 6
3795(T)/21 1462 ...................... SCOTLAND, East Coast: Dredging area; Works; Depths................................. 6
3815(T)/21 2845 ...................... CHANNEL ISLANDS, Alderney: Beacon ........................................................ 16
3907(T)/21 219, 1119, 1239, SCOTLAND, Shetland Islands: Light ............................................................... 6
1942, 2182C, 3299
3979(T)/21 222, 1462 ............. SCOTLAND, East Coast: Works ....................................................................... 6
3981(T)/21 1121, 1123, 1178, WALES, West Coast: Moorings; Submarine cables .......................................... 1, 2, 3
2649 ......................
4077(T)/21 2 ............................ CELTIC SEA, Irish Sector: Scientific instruments ............................................ 6
4100(P)/21 1652, 2148, 2450, ENGLISH CHANNEL: Submarine cable.......................................................... 1, 16
2451, 2613, 2656,
2675 ......................
4133(T)/21 115, 1942, 1954, SCOTLAND, Orkney Islands: Obstructions...................................................... 6
2162, 2581 ...........
4238(T)/21 2045, 2450 ........... ENGLAND, South Coast: Measuring instruments; Buoyage............................ 1
4239(T)/21 1757, 1795, 2635 SCOTLAND, West Coast: Measuring instrument ............................................. 5
4382(T)/21 108, 1190, 1200... ENGLAND, East Coast: Light-float; Buoy ....................................................... 7
4400(T)/21 1864 ...................... SCOTLAND, West Coast: Buoy........................................................................ 3
4557(T)/21 1077, 1889 ........... SCOTLAND, East Coast: Wind turbine; Light.................................................. 6
4561(T)/21 2131, 2382 ........... SCOTLAND, West Coast: Scientific instruments; Buoyage ............................. 3, 5
4642(T)/21 2209, 2480, 2498 SCOTLAND, West Coast: Measuring instrument ............................................. 5
4663(T)/21 1772, 1787 ........... IRELAND, East Coast: Buoy ............................................................................ 3
4674(T)/21 1757, 1794, 2529 SCOTLAND, West Coast: Measuring instrument ............................................. 5
4676(T)/21 1951 ...................... ENGLAND, West Coast: Obstruction................................................................ 3
4681(T)/21 2021, 2035 ........... ENGLAND, South Coast: Works; Buoyage ...................................................... 1
4689(P)/21 2151 ...................... ENGLAND, East Coast: Pier; Works................................................................. 8
4771(T)/21 3683 ...................... ENGLAND, East Coast: Buoy; Moorings; Berth .............................................. 8
4797(P)/21 2021 ...................... ENGLAND, South Coast: Works....................................................................... 1
4977(T)/21 2254, 2739 ........... IRELAND, West Coast: Obstructions................................................................ 4
1A.3
Wk04/22
IA
2. BRITISH ISLES - continued
4984(P)/21 1121, 1237, 1411, SCOTLAND, West Coast: Submarine cables .................................................... 3, 5
1753, 2093, 2198,
2199, 2635, 2724
5005(P)/21 1188, 5614_16, ENGLAND, East Coast: Depths ........................................................................ 2, 7
5614_17 ................
5070(T)/21 3490 ...................... ENGLAND, West Coast: Dredging area; Works; Submarine pipeline; Lights; 3
Mooring; Chains and anchors; Buoy..................................................................
5145(T)/21 1121, 1123, 1178, WALES, West Coast: Buoy; Automatic Identification System.......................... 1, 2, 3
2649 ......................
5223(T)/21 1188, 5614_17...... ENGLAND, East Coast: Restricted area; Slipway; Works................................ 2, 7
5224(T)/21 1320, 1826, 5613_1 IRISH SEA: Buoyage; Automatic Identification Systems................................. 2, 3
5234(P)/21 1178, 1410, 1482, WALES, West Coast: Depths ............................................................................. 2, 3
1973, 5621_2 .......
5333(T)/21 2036, 2038, 2793, ENGLAND, South Coast: Scientific instruments.............................................. 1, 2
5600_9 ..................
5447(T)/21 3275, 5620_14 ..... WALES, South Coast: Scientific instrument; Buoy........................................... 2
88(P)/22 1535 ...................... ENGLAND, East Coast: Depths ........................................................................ 7
93(T)/22 1463, 5609_15 ..... WALES, North Coast: Outfall; Buoy................................................................. 2, 3
101(T)/22 105, 1408, 1503 .. ENGLAND, East Coast: Platform ..................................................................... 7
113(T)/22 152, 156, 5615_6 ENGLAND, East Coast: Buoyage ..................................................................... 2, 7
186(P)/22 2529 ...................... SCOTLAND, Hebrides: Lights.......................................................................... 5
188(P)/22 3496, 3497 ........... ENGLAND, East Coast: Depths ........................................................................ 7
194(T)/22 1407, 5615_3 ....... SCOTLAND, East Coast: Buoy......................................................................... 2, 6
312(T)/22 2770, 5616_22 ..... SCOTLAND, Hebrides: Measuring instruments; Buoyage............................... 2, 5
365(P)/22 5608_13 ................ ENGLAND, Bristol Channel: Buoyage; Intake; Outfalls; Works; Radio 2
reporting point....................................................................................................
3. NORTH RUSSIA, NORWAY, THE FÆROE ISLANDS AND ICELAND
4644(T)/12 2961 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
4973(T)/16 2966 ...................... RUSSIA, Barents Sea Coast: Mooring buoys.................................................... 14
3336(T)/18 2966 ...................... RUSSIA, Barents Sea Coast: Jetties .................................................................. 14
4351(T)/18 2966 ...................... RUSSIA, Barents Sea Coast: Buoy.................................................................... 14
1031(T)/19 2966 ...................... RUSSIA, Barents Sea Coast: Buoyage .............................................................. 14
1959(P)/19 1429, 4101 ........... NORWAY, West Coast: Works; Submarine pipeline; Offshore installation....... 13
6220(P)/19 3569 ...................... FØROYAR: Depths; Restricted area; Works; Light........................................... 15
4398(T)/20 2683, 3136, 3137, NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
4010, 4100 ...........
4776(T)/20 2683 ...................... NORWAY, North Coast: Buoy ........................................................................... 14
4860(T)/20 2683, 4100 ........... NORWAY, North Coast: Buoyage...................................................................... 14
6176(T)/20 2682, 2683, 3137, NORWEGIAN SEA, Svalbard: Measuring instruments.................................... 14, 15
4010 ......................
359(T)/21 2683 ...................... NORWAY, North Coast: Buoy ........................................................................... 14
2205(T)/21 1427, 1428, 2182D NORWAY, West Coast: Measuring instruments................................................. 13
2498(P)/21 2315, 2683 ........... NORWAY, North Coast: Submarine power cable; Works; Offshore installation 14
3597(T)/21 1430, 4101 ........... NORWAY, West Coast: Scientific instrument.................................................... 13
4485(P)/21 2683 ...................... NORWAY, North Coast: Offshore installation................................................... 14
4538(T)/21 2898 ...................... ICELAND: Buoy ............................................................................................... 15
4. BALTIC SEA AND APPROACHES
248(T)/17 857 ........................ SWEDEN, West Coast: Horizontal clearance; Works ....................................... 10
4859(T)/17 944 ........................ DENMARK, Islands: Leading line .................................................................... 10
3341(T)/18 902 ........................ DENMARK, Islands: Works; Buoyage.............................................................. 10
5393(T)/18 2292 ...................... LATVIA: Works; Buoyage................................................................................. 10
333(T)/19 911......................... SWEDEN, West Coast: Depths.......................................................................... 10
729(T)/19 2115, 2945............ GERMANY, Baltic Coast: Restricted area ........................................................ 10
747(T)/19 894 ........................ DENMARK, East Coast: Submarine pipelines; Buoyage ................................. 10
1062(T)/19 2014, 2018, 2816 POLAND: Buoy................................................................................................. 10
2348(P)/19 902 ........................ DENMARK, Islands: Dredged depths; Submarine cable .................................. 10
1A.4
Wk04/22
IA
4. BALTIC SEA AND APPROACHES - continued
2822(T)/19 857, 858 ............... SWEDEN, West Coast: Depths.......................................................................... 10
3389(T)/19 2215 ...................... ESTONIA: Buoy ................................................................................................ 10
3740(T)/19 811, 820................ SWEDEN, East Coast: Restricted area; Bridge; Works; Buoyage .................... 10
4290(T)/19 2264 ...................... RUSSIA, Baltic Sea Coast: Mooring buoys ...................................................... 11
4460(T)/19 875 ........................ SWEDEN, West Coast: Depth; Maximum authorised draught.......................... 10
6402(P)/19 2014, 2015, 2018, BALTIC SEA: Submarine pipelines .................................................................. 10, 11
2248, 2264, 2816,
2817, 2945 ...........
309(T)/20 2018, 2040, 2288 POLAND: Measuring instruments; Buoyage .................................................... 10
663(T)/20 2014, 2018, 2040, POLAND: Buoyage ........................................................................................... 10
2288, 2816 ...........
916(P)/20 2015, 2115, 2816, DENMARK, Islands: Works; Wind farm; Buoyage .......................................... 10
2945 ......................
917(T)/20 857, 858 ............... SWEDEN, West Coast: Depths.......................................................................... 10
973(T)/20 2018, 2040 ........... POLAND: Buoy................................................................................................. 10
1436(P)/20 940, 2583 ............. DENMARK, Islands: Bridge; Channels; Buoyage; Restricted areas ................ 10
1763(P)/20 888 ........................ SWEDEN, East Coast: Works............................................................................ 10
2285(T)/20 2014, 2015, 2018, POLAND: Measuring instruments..................................................................... 10
2040, 2288, 2679,
2688 ......................
2602(T)/20 2098, 3864 ........... FINLAND, West Coast: Buoyage ...................................................................... 11
2825(T)/20 2227, 2241, 2248 ESTONIA: Restricted area................................................................................. 10, 11
2964(T)/20 2620, 3863 ........... FINLAND, West Coast: Light............................................................................ 11
3318(T)/20 2014, 2018, 2040, POLAND: Explosives dumping ground ............................................................ 10
2816 ......................
4144(P)/20 929 ........................ DENMARK, East Coast: Works ........................................................................ 10
4366(T)/20 857 ........................ SWEDEN, West Coast: Berth ............................................................................ 10
4475(P)/20 810 ........................ SWEDEN, East Coast: Submarine cables.......................................................... 10
4583(T)/20 847 ........................ SWEDEN, East Coast: Quay; Works ................................................................. 10
4640(T)/20 2241, 2248 ........... ESTONIA: Restricted area................................................................................. 10, 11
5061(P)/20 902 ........................ DENMARK, Islands: Works.............................................................................. 10
5618(T)/20 2227 ...................... ESTONIA: Restricted area................................................................................. 11
5645(T)/20 2452 ...................... POLAND: Works; Piles; Buoyage ..................................................................... 10
5964(T)/20 2218, 3818 ........... FINLAND, South Coast: Spoil ground.............................................................. 11
6068(T)/20 2677, 2678 ........... POLAND: Buoyage ........................................................................................... 10
83(T)/21 2452 ...................... POLAND: Works; Buoyage............................................................................... 10
671(T)/21 811, 820................ SWEDEN, East Coast: Quay; Works ................................................................. 10
864(T)/21 2014, 2015, 2018, POLAND: Measuring instruments..................................................................... 10
2040, 2288, 2677,
2679, 2688 ...........
901(T)/21 900 ........................ DENMARK, East Coast: Works; Berth ............................................................. 10
936(T)/21 2264 ...................... RUSSIA, Baltic Sea Coast: Spoil ground .......................................................... 11
981(T)/21 2014, 2018 ........... POLAND: Measuring instruments..................................................................... 10
1152(T)/21 2688 ...................... POLAND: Obstruction....................................................................................... 10
1502(T)/21 911......................... SWEDEN, West Coast: Restricted area ............................................................. 10
1587(T)/21 2678 ...................... POLAND: Submarine pipeline; Works; Buoyage.............................................. 10
1588(T)/21 2018, 2816 ........... POLAND: Measuring instruments; Buoy.......................................................... 10
1753(T)/21 2677 ...................... POLAND: Submarine pipelines; Buoyage; Restricted areas............................. 10
1866(P)/21 2014, 2015, 2018, GERMANY, Baltic Coast: Submarine cables .................................................... 10
2945 ......................
1869(T)/21 2601, 2944 ........... DENMARK, Islands: Channel depths ............................................................... 10
2011(T)/21 2048, 2054, 2288, LATVIA: Scientific instrument.......................................................................... 10
2816, 2817 ...........
2143(T)/21 2227 ...................... ESTONIA: Restricted area................................................................................. 11
2331(T)/21 876 ........................ SWEDEN, West Coast: Depths.......................................................................... 10
2392(P)/21 2276 ...................... LITHUANIA: Depths; Maintained channels; Works; Submarine pipeline; 10
Restricted areas ..................................................................................................
1A.5
Wk04/22
IA
4. BALTIC SEA AND APPROACHES - continued
2425(P)/21 958, 2014, 2015, BALTIC SEA: Works; Submarine pipeline; Buoyage ....................................... 10
2018, 2115, 2679,
2816 ......................
2426(T)/21 923 ........................ DENMARK, Islands: Works.............................................................................. 10
2449(T)/21 2698, 2713 ........... RUSSIA, Baltic Sea Coast: Buoyage................................................................. 11, 14
2658(T)/21 832, 881 ............... SWEDEN, East Coast: Beacon .......................................................................... 10
2663(T)/21 2612, 3839 ........... FINLAND, West Coast: Fairways; Swept areas; Buoyage; Recommended 11
tracks ..................................................................................................................
2786(P)/21 2276 ...................... LITHUANIA: Breakwater; Works..................................................................... 10
2834(P)/21 889 ........................ SWEDEN, East Coast: Buoyage; Lights; Recommended track; Pilot boarding 11
place ...................................................................................................................
2921(T)/21 2276 ...................... LITHUANIA: Dolphins ..................................................................................... 10
2940(T)/21 2677 ...................... POLAND: Works ............................................................................................... 10
2997(T)/21 2185, 3824, 3825, FINLAND, Saaristomeri: Buoy ......................................................................... 11
3899 ......................
3065(T)/21 837, 839 ............... SWEDEN, East Coast: Works; Bridges; Fairway .............................................. 10
3082(P)/21 2817 ...................... BALTIC SEA: Submarine cable ........................................................................ 10
3332(T)/21 3830 ...................... FINLAND, West Coast: Buoyage ...................................................................... 11
3493(T)/21 3803, 3825, 3826, FINLAND, Saaristomeri: Radio reporting points; Vessel traffic service........... 11
3828, 3832, 3898
3585(T)/21 3821 ...................... FINLAND, South Coast: Buoy .......................................................................... 11
3828(T)/21 820 ........................ SWEDEN, East Coast: Works; Submarine pipeline; Buoyage .......................... 10
3839(T)/21 2844 ...................... SWEDEN, East Coast: Works; Quay ................................................................. 10
3880(T)/21 2843 ...................... SWEDEN, East Coast: Maximum authorised draughts; Berths ........................ 10
3881(P)/21 845 ........................ SWEDEN, East Coast: Works; Lights; Floodlights ........................................... 10
4123(T)/21 DE 26 ..................... GERMANY, Baltic Coast: Pontoons ................................................................. 10
4126(T)/21 3803, 3829 ........... FINLAND, West Coast: Measuring instrument ................................................. 11
4156(P)/21 2106, 2117, 2597, DENMARK, Islands: Restricted area; Buoyage ................................................ 10
2942 ......................
4189(P)/21 2108 ...................... DENMARK, Islands: Measuring instrument..................................................... 10
4199(T)/21 938, 2583 ............. DENMARK, Islands: Depth .............................................................................. 10
4229(T)/21 2597 ...................... DENMARK, Islands: Depths............................................................................. 10
4244(T)/21 2276 ...................... LITHUANIA: Restricted area............................................................................ 10
4256(T)/21 2452 ...................... POLAND: Works ............................................................................................... 10
4323(T)/21 938 ........................ DENMARK, Islands: Buoy ............................................................................... 10
4324(T)/21 798 ........................ SWEDEN, East Coast: Works; Berth................................................................. 10
4376(T)/21 3828 ...................... FINLAND, South Coast: Measuring instruments; Buoyage.............................. 11
4379(T)/21 2218, 3818 ........... FINLAND, South Coast: Works; Buoyage ........................................................ 11
4522(T)/21 944 ........................ DENMARK, Islands: Bridge ............................................................................. 10
4662(T)/21 902, 903, 2594, DENMARK, Islands: Works.............................................................................. 10
2595 ......................
4671(T)/21 2059, 2816, 2817 ESTONIA: Buoy ................................................................................................ 10
4710(T)/21 821, 831 ............... SWEDEN, East Coast: Works; Submarine pipeline .......................................... 10
4723(P)/21 821 ........................ SWEDEN, East Coast: Depths; Wrecks; Submarine cables; Outfall................. 10
4724(P)/21 821 ........................ SWEDEN, East Coast: Depths; Wrecks............................................................. 10
4850(T)/21 2592 ...................... DENMARK, Islands: Depths............................................................................. 10
5028(T)/21 2014, 2018, 2040, POLAND: Works ............................................................................................... 10
2816 ......................
5030(T)/21 2219, 3818 ........... FINLAND, South Coast: Works; Buoyage ........................................................ 11
5052(T)/21 876 ........................ SWEDEN, West Coast: Depth ........................................................................... 10
5053(T)/21 1009 ...................... SWEDEN, East Coast: Buoy; Virtual aid to navigation .................................... 11
5080(T)/21 2117, 2597, 2942. DENMARK, Islands: Buoy; Measuring instrument .......................................... 10
5163(T)/21 2082, 2252 ........... SWEDEN, East Coast: Depths; Measuring instrument ..................................... 11
5339(P)/21 810 ........................ SWEDEN, East Coast: Bridge; Fairway; Works................................................ 10
5404(P)/21 2106, 2117, 2942. GERMANY, Baltic Coast: Restricted areas; Buoyage; Works .......................... 10
5419(P)/21 2015 ...................... SWEDEN, South Coast: Coastline; Quay; Swept area; Works; Berths; Port 10
developments......................................................................................................
1A.6
Wk04/22
IA
4. BALTIC SEA AND APPROACHES - continued
5438(P)/21 837, 839 ............... SWEDEN, East Coast: Buoy ............................................................................. 10
5450(P)/21 3803 ...................... FINLAND, West Coast: Fairway ....................................................................... 11
5452(T)/21 2164 ...................... FINLAND, West Coast: Buoyage ...................................................................... 11
5453(P)/21 958, 2014, 2015, DENMARK, Islands: Buoyage .......................................................................... 10
2018, 2816 ...........
5471(T)/21 2106, 2117, 2942. GERMANY, Baltic Coast: Buoy........................................................................ 10
5475(T)/21 2117, 2942............ GERMANY, Baltic Coast: Buoyage .................................................................. 10
5477(T)/21 2098, 2252, 3800 FINLAND, West Coast: Virtual aids to navigation............................................ 11
5485(T)/21 3440, 3825 ........... FINLAND, Saaristomeri: Buoy ......................................................................... 11
60(T)/22 857 ........................ SWEDEN, West Coast: Bridge; Works; Fairway............................................... 10
146(T)/22 857 ........................ SWEDEN, West Coast: Bridge; Works; Fairway............................................... 10
298(P)/22 800, 802, 803, 810 SWEDEN, East Coast: Works; Buoyage; Lights; Depths.................................. 10
345(T)/22 2015, 2115, 2595. SWEDEN, West Coast: Measuring instruments ................................................ 10
358(P)/22 821 ........................ SWEDEN, East Coast: Submarine cable ........................................................... 10
360(T)/22 802 ........................ SWEDEN, East Coast: Works............................................................................ 10
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM
4360(T)/18 128 ........................ BELGIUM: Moorings ........................................................................................ 9
4715(T)/18 207 ........................ NETHERLANDS: Restricted area; Buoyage; Light-beacon............................. 9
1038(P)/19 1408, 2182A......... NORTH SEA, United Kingdom Sector: Works; Platform; Obstructions .......... 7
1648(T)/19 1457 ...................... NETHERLANDS: Pile ...................................................................................... 9
2320(T)/19 323, 1406, 1610, BELGIUM: Wreck; Virtual aid to navigation .................................................... 1, 7, 9
1872, 1873, 2449
1049(P)/20 2182A, 2182B, NETHERLANDS: Submarine power cable....................................................... 7, 9
DE 103 ...................
1688(P)/20 274, 292, 1405, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Offshore 6, 7, 13
1427, 2182C......... installation ..........................................................................................................
2778(T)/20 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Well ............................................................. 6, 13
4568(T)/20 294, 295, 1427 .... NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 13
5943(T)/20 1631, 1632, 1633, NETHERLANDS: Traffic separation scheme ................................................... 7, 9
2182A, 2182B,
DE 50, DE 87.........
6191(T)/20 1457 ...................... NETHERLANDS: Lights; Pile .......................................................................... 9
67(P)/21 122, 207, 1406, NETHERLANDS: Submarine power cable....................................................... 7, 9
1408, 1631, 2182A
1292(P)/21 2182B.................... NORTH SEA, Netherlands Sector: Submarine power cable ............................. 7
1494(T)/21 124 ........................ NETHERLANDS: Restricted area..................................................................... 9
1495(P)/21 1406, 2449, 8297 BELGIUM: Restricted area; Wind farm ............................................................ 7, 9
1578(T)/21 126, 1546 ............. NETHERLANDS: Fouls.................................................................................... 9
1774(T)/21 128, 8010 ............. BELGIUM: Breakwater; Buoyage..................................................................... 9
1872(T)/21 1422, 2182B, 4140 DENMARK, North Sea Coast: Works; Submarine pipeline; Restricted areas .. 7, 9
2167(T)/21 1872, 1873, 1874, BELGIUM: Buoy............................................................................................... 9
2449 ......................
2390(T)/21 124 ........................ NETHERLANDS: Restricted area; Buoyage .................................................... 9
2490(P)/21 274, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Offshore 6, 7, 13
2182C.................... installation ..........................................................................................................
2496(P)/21 295, 1427, 2182D NORTH SEA, Norwegian Sector: Works; Submarine pipeline ......................... 6, 13
2497(P)/21 274, 292, 1405, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 7, 13
1427 ......................
2686(T)/21 125, 130 ............... NETHERLANDS: Buoy.................................................................................... 9
2831(P)/21 1408, 1633 ........... NETHERLANDS: Wrecks................................................................................. 7, 9
2953(P)/21 152, 156, 267, 268, NORTH SEA: Works; Submarine cable ............................................................ 6, 7, 9, 13,
272, 274, 1191, 19
1192, 1405, 1422,
1427, 1626, 1935,
2182A, 2182B,
2182C, 4102.........
1A.7
Wk04/22
IA
5. NORTH SEA AND NORTH AND WEST COASTS OF DENMARK, GERMANY, NETHERLANDS AND
BELGIUM - continued
3014(P)/21 8297 ...................... NETHERLANDS: Platforms; Restricted areas ................................................. 9
3173(P)/21 125, 1406, 1408, NETHERLANDS: Works; Wind farm; Restricted areas ................................... 7, 9
8297 ......................
3182(P)/21 1546 ...................... NETHERLANDS: Obstruction.......................................................................... 9
3403(P)/21 8010 ...................... BELGIUM: Notes .............................................................................................. 9
3596(T)/21 274, 1405, 1427, NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 7, 13
2182C....................
3799(P)/21 1408, 1504, 1543 NORTH SEA: Submarine cable......................................................................... 7
4146(P)/21 125, 126, 1408, NETHERLANDS: Wind farm; Works ............................................................... 7, 9
1631 ......................
4159(T)/21 292, 294 ............... NORTH SEA, Norwegian Sector: Well ............................................................. 6
4161(P)/21 1405, 1427, 2182C, NORTH SEA, Norwegian Sector: Submarine cable.......................................... 6, 7, 13
4140 ......................
4227(T)/21 295, 1427 ............. NORTH SEA, Norwegian Sector: Buoy; Precautionary area ............................ 6, 13
4409(T)/21 126, 1546 ............. NETHERLANDS: Buoyage .............................................................................. 9
4417(P)/21 1405, 1427 ........... NORTH SEA, Norwegian Sector: Works; Wind farm; Submarine cable .......... 13
4725(P)/21 8012 ...................... BELGIUM: Dredged areas; Dredged depths ..................................................... 9
5156(T)/21 1408, 1631 ........... NETHERLANDS: Foul ..................................................................................... 7, 9
5178(T)/21 124 ........................ NETHERLANDS: Buoy.................................................................................... 9
5190(P)/21 8011....................... NETHERLANDS: Lights .................................................................................. 9
5251(P)/21 292, 1405, 1427, NORTH SEA, Norwegian Sector: Works; Submarine pipeline; Submarine 6, 13
2182C.................... cable ...................................................................................................................
5307(T)/21 116, 1872, 1874... NETHERLANDS: Buoy.................................................................................... 9
5407(T)/21 122, 125, 130 ...... NETHERLANDS: Works .................................................................................. 9
5492(P)/21 1422, 2182B......... DENMARK, North Sea Coast: Measuring instruments; Buoyage .................... 7, 9
5500(T)/21 295, 1427, 1428 .. NORTH SEA, Norwegian Sector: Buoy............................................................ 6, 13
153(P)/22 8010, 8011............ NETHERLANDS: Buoyage .............................................................................. 9
159(T)/22 110, 116, 122, 266, NORTH SEA, Netherlands Sector: Measuring instruments .............................. 7, 9
1874, DE 90 ..........
189(T)/22 1408, 1503, 1632, NORTH SEA, United Kingdom Sector: Lights ................................................. 2, 7, 9
2182A, 5614_25 ..
310(T)/22 272, 274, 1405, NORTH SEA, United Kingdom Sector: Offshore installation; Buoyage .......... 6, 7, 13
2182B, 2182C ......
361(P)/22 120 ........................ NETHERLANDS: Buoyage; Channel; Depths ................................................. 9
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL
1512(T)/18 3220 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
5180(P)/18 3258 ...................... PORTUGAL, West Coast: Buoyage; Light-beacons ......................................... 18
5450(T)/18 2522, 2986 ........... FRANCE, West Coast: Measuring instruments ................................................. 17
5805(P)/18 1764 ...................... SPAIN, West Coast: Depths; Maintained channel; Alongside depths................ 18
5809(T)/18 91, 93 ................... PORTUGAL, South Coast: Wreck..................................................................... 18
476(T)/19 3257 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
1573(T)/19 2148, 2451, 2613 FRANCE, North Coast: Buoy; Automatic Identification System...................... 1, 16
6434(T)/19 83 .......................... PORTUGAL, South Coast: Depths.................................................................... 18
6438(T)/19 3228 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
929(P)/20 1142....................... SPAIN, North Coast: Lights; Coastline; Wrecks................................................ 17
2884(T)/20 3224 ...................... PORTUGAL, West Coast: Scientific instrument ............................................... 18
2912(T)/20 87, 3634, 4011, PORTUGAL, West Coast: Buoy ........................................................................ 18, 19
4014, 4103 ...........
3447(T)/20 83 .......................... PORTUGAL, South Coast: Alongside depth ..................................................... 18
4135(T)/20 87, 3635, 4103 .... PORTUGAL, West Coast: Buoy ........................................................................ 18
4149(P)/20 2819, 2820 ........... FRANCE, West Coast: Depths; Drying height; Rock........................................ 17
4593(T)/20 3227 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
5099(T)/20 87, 3132, 3636 .... PORTUGAL, West Coast: Buoy ........................................................................ 18
5157(T)/20 2663, 2998, 2999 FRANCE, West Coast: Measuring instruments; Buoyage................................. 17
5580(P)/20 3636 ...................... PORTUGAL, West Coast: Breakwater; Works; Buoyage; Light....................... 18
1A.8
Wk04/22
IA
6. FRANCE AND SPAIN, NORTH AND WEST COASTS, AND PORTUGAL - continued
68(T)/21 323, 1872, 1873, FRANCE, North Coast: Buoy............................................................................ 1, 9
2449 ......................
501(T)/21 3258 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
505(T)/21 3227 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
529(T)/21 3224 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
532(T)/21 89, 3636 ............... PORTUGAL, South Coast: Marine farm; Works; Buoyage .............................. 18
807(P)/21 2522, 2986 ........... FRANCE, West Coast: Submarine cable; Wind farm........................................ 17
1179(T)/21 3257 ...................... PORTUGAL, West Coast: Anchorage area........................................................ 18
1568(T)/21 2522, 2986 ........... FRANCE, West Coast: Restricted areas; Works ................................................ 17
1687(T)/21 3257, 3634 ........... PORTUGAL, West Coast: Works; Spoil ground ............................................... 18
1708(T)/21 3258, 3634 ........... PORTUGAL, West Coast: Buoy ........................................................................ 18
1829(T)/21 2136, 2146, 2613 FRANCE, North Coast: Buoy; Wreck; Restricted area ..................................... 16
2013(T)/21 3258 ...................... PORTUGAL, West Coast: Buoyage .................................................................. 18
2014(T)/21 3220, 3635 ........... PORTUGAL, West Coast: Buoy; Virtual aid to navigation ............................... 18
2015(T)/21 3258 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
2937(T)/21 1730, 1731 ........... SPAIN, West Coast: Buoy; Automatic Identification System............................ 18
3602(T)/21 3258 ...................... PORTUGAL, West Coast: Buoy ........................................................................ 18
3888(T)/21 89, 3636 ............... PORTUGAL, South Coast: Buoy ...................................................................... 18
4019(T)/21 3221, 3222 ........... PORTUGAL, West Coast: Buoy ........................................................................ 18
4184(T)/21 3221, 3222 ........... PORTUGAL, West Coast: Dredged area; Depths.............................................. 18
4456(T)/21 3634 ...................... PORTUGAL, West Coast: Measuring instruments; Buoyage; Restricted area.. 18
5118(P)/21 2029, 2648, 2669, FRANCE, North Coast: Channel limits; Buoyage; Light; Obstructions ........... 1, 16
2675, 3659 ...........
5202(P)/21 1175....................... FRANCE, West Coast: Depths; Wrecks; Coastline; Piers; Reclamation area ... 18
5416(T)/21 20, 2522, 2986 .... FRANCE, West Coast: Works; Wind farm; Restricted areas; Automatic 16, 17
Identification Systems ........................................................................................
5462(T)/21 2148, 2451 ........... FRANCE, North Coast: Restricted area............................................................. 1, 16
5484(P)/21 2835 ...................... FRANCE, West Coast: Rock.............................................................................. 17
40(P)/22 2136 ...................... FRANCE, North Coast: Depths; Obstruction; Rocks ........................................ 16
185(P)/22 3259 ...................... PORTUGAL, West Coast: Depths; Light........................................................... 18
321(T)/22 3220, 3221 ........... PORTUGAL, West Coast: Depths ..................................................................... 18
324(P)/22 2029, 2648, 2669, FRANCE, North Coast: Wrecks; Obstructions; Buoy ....................................... 1, 16
2675, 3659 ...........
7. NORTH ATLANTIC OCEAN
2974(T)/14 4407 ...................... NORTH ATLANTIC OCEAN: Sub-surface oceanographic buoys and 82
moorings.............................................................................................................
5962(T)/19 4012, 4013, 4216, NORTH ATLANTIC OCEAN: Buoy ................................................................ 19, 82, 87
4407 ......................
110(P)/20 306, 311, 595, 658, NORTH ATLANTIC OCEAN: Works; Submarine cables ................................ 18, 20, 34,
1381, 1383, 1384, 35
1385, 1684, 1685,
1771, 1831, 3100,
3118, 3432, 3635,
3636, 3859, 4138,
4146, 4148, 4150,
4151, 4152, 4175,
4176 ......................
3448(T)/20 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Anchorage area........ 19
4148(P)/20 332, 334, 867, 868, NORTH ATLANTIC OCEAN, Bermuda: Depths; Drying heights ................... 82
1073, 1315 ...........
5648(P)/20 2, 20, 1104, 1123, NORTH ATLANTIC OCEAN: Submarine cable .............................................. 1, 2, 6, 16,
1148, 1149, 1156, 17, 78, 80,
1227, 2427, 2483, 81
2492, 2649, 2664,
2666, 2670, 4746
1A.9
Wk04/22
IA
7. NORTH ATLANTIC OCEAN - continued
116(P)/21 2, 87, 305, 306, NORTH ATLANTIC OCEAN: Works............................................................... 1, 2, 6, 18,
307, 311, 312, 595, 20, 34, 35
1000, 1123, 1156,
1381, 1383, 1384,
1385, 1386, 1392,
1663, 1856, 1861,
1862, 2649, 3100,
3101, 3118, 3133,
3134, 3135, 3220,
3286, 3325, 3327,
3328, 3432, 3635,
3859, 4138, 4146,
4151, 4175, 4176,
4177, 4178 ...........
4163(T)/21 1895 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Works; Restricted 19
areas; Piles; Buoyage .........................................................................................
4276(T)/21 1957 ...................... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Platform; Buoyage; 19
Restricted areas; Spoil ground ...........................................................................
5081(T)/21 1950, 1956 ........... NORTH ATLANTIC OCEAN, Arquipélago dos Açores: Buoyage .................. 19
8. MEDITERRANEAN AND BLACK SEAS
938(T)/12 2214, 2233 ........... RUSSIA, Black Sea Coast: Scientific instruments ............................................ 31
2188(T)/13 965 ........................ ITALY, Sicilia: Piers........................................................................................... 24
4821(T)/13 1578 ...................... MONTENEGRO: Buoy ..................................................................................... 27
4017(T)/16 1211....................... ITALY, Sardegna: Wreck; Restricted area.......................................................... 25
4211(T)/16 3318 ...................... RUSSIA, Black Sea Coast: Works; Buoyage..................................................... 31
5194(T)/16 2216 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
5398(T)/16 2233 ...................... RUSSIA, Black Sea Coast: Measuring instruments .......................................... 31
6572(P)/16 2203 ...................... UKRAINE: Legend............................................................................................ 31
2108(T)/17 3312 ...................... RUSSIA, Black Sea Coast: Scientific instruments; Mooring buoys.................. 31
3738(P)/17 3402 ...................... LIBYA: Anchorage areas; Submarine pipelines; Buoyage; Restricted area ...... 24
4926(T)/17 2242 ...................... UKRAINE: Buoy ............................................................................................... 31
5712(T)/17 1996 ...................... CROATIA: Buoyage .......................................................................................... 27
741(P)/18 167, 176 ............... TUNISIA: Platform; Restricted area.................................................................. 24
2683(T)/18 2166 ...................... FRANCE, South Coast: Buoyage; Restricted areas........................................... 25
3440(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
3459(P)/18 8121 ...................... TURKEY, Marmara Denizi: Note...................................................................... 29
4393(P)/18 8121 ...................... TURKEY, Marmara Denizi: Works ................................................................... 29
4669(T)/18 2242 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4852(T)/18 1580 ...................... CROATIA: Buoy................................................................................................ 27
4997(T)/18 1158, 3930............ TURKEY, Black Sea Coast: Buoy ..................................................................... 29, 31
5625(T)/18 140 ........................ ITALY, East Coast: Restricted area .................................................................... 27
6126(T)/18 2203 ...................... UKRAINE: Works ............................................................................................. 31
376(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Light-beacon.......................................................... 31
1195(P)/19 8121 ...................... TURKEY, Marmara Denizi: Pilotage................................................................. 29
1568(T)/19 1591 ...................... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
1659(T)/19 3318 ...................... RUSSIA, Black Sea Coast: Buoy....................................................................... 31
1665(P)/19 8121 ...................... TURKEY, Marmara Denizi: Note...................................................................... 29
1694(P)/19 8121 ...................... TURKEY, Marmara Denizi: Legends ................................................................ 29
1853(T)/19 2216, 2242 ........... RUSSIA, Black Sea Coast: Anchorage area ...................................................... 31
2203(P)/19 3313, 3317 ........... GEORGIA: Depths ............................................................................................ 31
3088(T)/19 1569, 2122 ........... TUNISIA: Foul .................................................................................................. 24
3604(P)/19 1683 ...................... GREECE, Aegean Sea Coast: Dredging area; Works ........................................ 28
4366(P)/19 1445 ...................... ITALY, East Coast: Dredged area ...................................................................... 27
4697(T)/19 1417 ...................... ITALY, South Coast: Measuring instruments..................................................... 27
5310(T)/19 1426 ...................... SLOVENIA: Works ........................................................................................... 27
5467(T)/19 1710 ...................... ALGERIA: Buoy ............................................................................................... 24
5822(P)/19 8121 ...................... TURKEY, Marmara Denizi: Buoy; Wreck ........................................................ 29
1A.10
Wk04/22
IA
8. MEDITERRANEAN AND BLACK SEAS - continued
6397(P)/19 2214, 2216, 2217, UKRAINE: General information ....................................................................... 31
2232, 2233, 2234,
2242 ......................
6406(T)/19 2284 ...................... ROMANIA: Buoyage ........................................................................................ 31
611(T)/20 1996, 2719 ........... CROATIA: Buoy................................................................................................ 27
679(T)/20 36 .......................... MALTA: Wreck; Buoy....................................................................................... 24
1147(T)/20 1585 ...................... ISRAEL, Mediterranean Sea Coast: Buoy; Wreck ............................................ 30
1189(T)/20 183, 2634 ............. ISRAEL, Mediterranean Sea Coast: Works; Submarine pipeline...................... 24, 30
1352(T)/20 964 ........................ ITALY, Sicilia: Obstruction................................................................................ 24
1409(T)/20 580 ........................ MOROCCO, North Coast: Works; Buoy ........................................................... 24
1526(T)/20 966, 973 ............... ITALY, Sicilia: Works ........................................................................................ 24
1635(T)/20 2203 ...................... UKRAINE: Buoyage ......................................................................................... 31
1696(T)/20 1180....................... SPAIN, Mediterranean Sea Coast: Buoyage ...................................................... 25
1721(T)/20 1585 ...................... ISRAEL, Mediterranean Sea Coast: Buoy......................................................... 30
2210(T)/20 2282 ...................... ROMANIA: Wreck ............................................................................................ 31
2248(T)/20 954 ........................ ITALY, West Coast: Port development; Works; Buoyage .................................. 26
2972(P)/20 2284 ...................... ROMANIA: Depth information......................................................................... 31
3265(T)/20 200, 1443 ............. ITALY, East Coast: Moored storage tanker; Restricted area.............................. 27
3314(T)/20 1591, 2634 ........... ISRAEL, Mediterranean Sea Coast: Restricted area.......................................... 30
4110(T)/20 1417 ...................... ITALY, South Coast: Works ............................................................................... 27
4143(T)/20 3034, 3035 ........... SPAIN, Islas Baleares: Light-beacons; Works; Beacons; Buoyage ................... 25
4196(T)/20 580 ........................ MOROCCO, North Coast: Works; Dolphin; Buoyage ...................................... 24
4744(P)/20 1426, 1461 ........... SLOVENIA: Works ........................................................................................... 27
4805(T)/20 2284 ...................... ROMANIA: Works ............................................................................................ 31
5235(T)/20 2242 ...................... RUSSIA, Black Sea Coast: Works ..................................................................... 31
5237(T)/20 3318 ...................... RUSSIA, Black Sea Coast: Works; Light-beacons ............................................ 31
5326(P)/20 812 ........................ ALGERIA: Depths; Lights; Works .................................................................... 24
5448(P)/20 1636 ...................... GREECE, Aegean Sea Coast: Depths; Obstructions; Buoyage ......................... 29
5622(P)/20 2214, 2230, 2232 ROMANIA: Submarine pipeline ....................................................................... 31
5926(P)/20 1443 ...................... ITALY, East Coast: Works; Piers; Breakwaters ................................................. 27
384(T)/21 3313 ...................... GEORGIA: Marine farm.................................................................................... 31
451(T)/21 473, 1700 ............. SPAIN, Mediterranean Sea Coast: Marine farm; Buoyage................................ 25
985(T)/21 194, 2123, 2124 .. MALTA: Restricted area .................................................................................... 24
1059(T)/21 200 ........................ ITALY, East Coast: Buoy ................................................................................... 27
1126(T)/21 3403 ...................... TUNISIA: Wreck ............................................................................................... 24
1305(T)/21 2120, 2170 ........... FRANCE, South Coast: Buoy............................................................................ 25
1766(P)/21 8121 ...................... TURKEY, Marmara Denizi: Restricted area...................................................... 29
1856(T)/21 2203 ...................... UKRAINE: Buoy ............................................................................................... 31
1992(T)/21 204, 1461 ............. SLOVENIA: Buoyage; Automatic Identification System ................................. 27
2012(T)/21 1275 ...................... TURKEY, Black Sea Coast: Wreck; Buoy......................................................... 31
2142(T)/21 354 ........................ ITALY, West Coast: Restricted areas; Buoyage; Works..................................... 26
2417(P)/21 2574, 2681 ........... EGYPT, North Coast: Works; Reclamation area ............................................... 24
2670(T)/21 2282, 2284 ........... ROMANIA: Dredged area; Spoil grounds......................................................... 31
3192(P)/21 518, 562 ............... SPAIN, Mediterranean Sea Coast: Depths; Light .............................................. 25
3270(P)/21 1941, 2123, 2124 ITALY, Sicilia: Submarine cables ...................................................................... 24, 26
3480(T)/21 1193....................... SPAIN, Mediterranean Sea Coast: Works; Buoyage.......................................... 25
3538(T)/21 855 ........................ ALGERIA: Buoy ............................................................................................... 24
3557(P)/21 2429, 5507 ........... TURKEY, Çanakkale Boğazi: Bridge; Works; Buoyage; Vertical clearance..... 29
3561(T)/21 2214, 2230, 2232, ROMANIA: Firing practice areas ...................................................................... 31
2282 ......................
3577(T)/21 167, 3403 ............. TUNISIA: Wreck ............................................................................................... 24
3633(P)/21 8121 ...................... TURKEY, Marmara Denizi: Anchorage areas ................................................... 29
3886(P)/21 2573, 2574, 2578 EGYPT, North Coast: Breakwater; Works; Dredging area; Reclamation area .. 24
3931(T)/21 3317 ...................... GEORGIA: Buoyage; Scientific instrument; Restricted area ............................ 31
3938(P)/21 118......................... ITALY, West Coast: Dredged areas; Maximum authorised draught; Light........ 26
3996(P)/21 118......................... ITALY, West Coast: Depths; Fairways; Restricted area ..................................... 26
4117(T)/21 2243 ...................... UKRAINE: Works ............................................................................................. 31
1A.11
Wk04/22
IA
8. MEDITERRANEAN AND BLACK SEAS - continued
4128(T)/21 2217, 2232 ........... UKRAINE: Buoy ............................................................................................... 31
4219(T)/21 2773 ...................... CROATIA: Foul; Buoy ...................................................................................... 27
4246(T)/21 269 ........................ CROATIA: Buoyage .......................................................................................... 27
4263(T)/21 2216, 2242 ........... RUSSIA, Black Sea Coast: Buoyage ................................................................. 31
4414(T)/21 2216, 2233, 3311. RUSSIA, Black Sea Coast: Buoy; Scientific instruments ................................. 31
4525(T)/21 1212 ...................... ITALY, Sardegna: Buoy ..................................................................................... 25
4529(T)/21 963, 1976 ............. ITALY, Sicilia: Works; Breakwater; Buoyage.................................................... 26
4677(T)/21 2216, 2233, 3311. RUSSIA, Black Sea Coast: Buoy....................................................................... 31
4801(T)/21 848, 850, 851 ...... CYPRUS: Scientific instruments; Buoyage....................................................... 30
4835(T)/21 1180, 1196............ SPAIN, Mediterranean Sea Coast: Works; Buoyage.......................................... 25
5076(T)/21 3403 ...................... TUNISIA: Buoyage ........................................................................................... 24
5172(T)/21 1159, 1198............ TURKEY, İstanbul Boğazi: Buoy ...................................................................... 29
5174(T)/21 246, 2104 ............. TURKEY, South Coast: Buoy............................................................................ 30
5212(P)/21 1590 ...................... ALBANIA: Depths ............................................................................................ 27
5361(T)/21 2712 ...................... CROATIA: Buoy................................................................................................ 27
5436(T)/21 166, 167, 2121 .... TUNISIA: Buoy ................................................................................................. 24, 25
5451(P)/21 775 ........................ CYPRUS: Coastline; Wrecks; Lights; Breakwaters; Restricted areas; Works... 30
42(P)/22 775, 849, 2074 .... CYPRUS: Submarine cable ............................................................................... 30
163(P)/22 1590 ...................... ALBANIA: Buoyage; Pilotage; Recommended track; Depths; Restricted area 27
175(T)/22 1162, 3403............ TUNISIA: Wreck ............................................................................................... 24
227(P)/22 2203 ...................... UKRAINE: Depths; Buoy; Obstructions; Alongside depths; Dredged area...... 31
9. AFRICA, WEST COAST AND SOUTH ATLANTIC
3064(T)/13 3101 ...................... IVORY COAST: Wreck ..................................................................................... 34
4735(P)/14 607 ........................ SENEGAL: Depths ............................................................................................ 20
1277(T)/18 601, 1147.............. GUINEA: Barge................................................................................................. 20
3504(T)/18 1699 ...................... MAURITANIA: Buoyage .................................................................................. 20
5016(T)/18 306, 307 ............... ANGOLA: Buoy ................................................................................................ 34
231(T)/19 1322 ...................... GABON: Buoyage ............................................................................................. 34
3718(T)/19 1661, 1699 ........... MAURITANIA: Wreck...................................................................................... 20
5265(T)/19 1661, 3134 ........... MAURITANIA: Wreck...................................................................................... 20
5317(T)/19 1661, 1690, 1699, MAURITANIA: Wreck; Restricted area............................................................ 20
3134 ......................
6179(P)/19 1661, 1690, 1699 MAURITANIA: Works; Spoil grounds.............................................................. 20
1389(T)/20 4137, 4138 ........... NAMIBIA: Radar beacon .................................................................................. 34
2045(T)/20 1000, 1001 ........... SENEGAL: Depths ............................................................................................ 20
2262(P)/20 1661, 1690, 1699 MAURITANIA: Depths; Wrecks; Obstructions; Dredged area......................... 20
2294(T)/20 1383 ...................... GHANA: Fog signal; Superbuoy ....................................................................... 34
2885(T)/20 1000, 1001 ........... SENEGAL: Works ............................................................................................. 20
4392(P)/20 856, 860, 861, MOROCCO, West Coast: Buoyage; Lights; Radar beacon ............................... 18, 20
3132, 3133 ...........
5473(P)/20 3103 ...................... IVORY COAST: Works ..................................................................................... 34
173(P)/21 1562 ...................... GUINEA: Depths; Maintained channel ............................................................. 20
877(P)/21 3103 ...................... IVORY COAST: Works; Bridge ........................................................................ 34
1310(T)/21 1387, 3118............ CAMEROON: Buoy .......................................................................................... 34
1324(P)/21 3108 ...................... IVORY COAST: Works; Breakwaters ............................................................... 34
1464(T)/21 1000, 1001, 1662, SENEGAL: Works; Offshore installation; Channel; Buoyage; Restricted area 20
1663 ......................
3228(T)/21 3112....................... GHANA: Wreck................................................................................................. 34
4720(P)/21 595, 1384, 1392 .. TOGO: Wreck .................................................................................................... 34
4838(T)/21 1392 ...................... TOGO: Buoy ...................................................................................................... 34
5225(P)/21 1381, 1385 ........... NIGERIA: Submarine cables ............................................................................. 34
5465(P)/21 862 ........................ MOROCCO, West Coast: Anchorage areas; Pilot boarding place; Dredging 20
areas....................................................................................................................
5519(P)/21 859, 860 ............... MOROCCO, West Coast: Buoyage ................................................................... 20
108(P)/22 1001 ...................... SENEGAL: Port development; Works; Submarine pipeline ............................. 20
124(P)/22 3103 ...................... IVORY COAST: Dredged area .......................................................................... 34
1A.12
Wk04/22
IA
10. AFRICA, SOUTH AND EAST COASTS, AND MADAGASCAR
209(T)/18 4153, 4155 ........... SOUTH AFRICA, South Coast: Buoy............................................................... 35
576(T)/18 1236, 4142 ........... SOUTH AFRICA, South Coast: Wreck ............................................................. 35
2060(T)/18 643, 4170 ............. SOUTH AFRICA, East Coast: Buoy ................................................................. 35
4924(P)/18 663, 3310, 3361 .. TANZANIA: Depths; Lights; Buoyage; Beacons; Leading line; Submarine 36
pipelines; Jetty; Rocks........................................................................................
210(T)/19 643 ........................ SOUTH AFRICA, East Coast: Depths............................................................... 35
403(T)/19 4142 ...................... SOUTH AFRICA, West Coast: Depth ............................................................... 35
1875(T)/19 2078, 4177 ........... SOUTH AFRICA, West Coast: Current meters ................................................. 34
2589(T)/19 1846 ...................... SOUTH AFRICA, West Coast: Depths; Dredged depths .................................. 35
2590(T)/19 4158 ...................... SOUTH AFRICA, South Coast: Depth.............................................................. 35
2591(T)/19 4162 ...................... SOUTH AFRICA, South Coast: Depths ............................................................ 35
2592(T)/19 4174 ...................... SOUTH AFRICA, East Coast: Depths............................................................... 35
6161(P)/19 663 ........................ TANZANIA: Buoyage; Light-beacons; Works.................................................. 36
6566(T)/19 1236, 4142 ........... SOUTH AFRICA, West Coast: Rocks; Depths.................................................. 35
42(P)/20 668 ........................ KENYA: Works; Buoyage; Leading lights; Pilot boarding place ...................... 36
1714(P)/20 3530 ...................... SOMALIA: Platform; Buoyage ......................................................................... 32
3553(T)/20 1236, 1922, 4142, SOUTH AFRICA, West Coast: Obstructions; Buoyage .................................... 35
4145, 4146, 4150,
4151, 4152, 4153,
4154, 4155 ...........
5303(P)/20 1310, 1812 ........... TANZANIA: Rocks; Buoyage; Reported anchorage; Depths ........................... 36
160(T)/21 1236, 4142 ........... SOUTH AFRICA, West Coast: Shellfish bed; Buoyage.................................... 35
276(T)/21 4150 ...................... SOUTH AFRICA, South Coast: Buoy; Radar beacon....................................... 35
4965(P)/21 666 ........................ KENYA: Works; Depths; Drying height; Submarine pipeline; Restricted areas 36
11. RED SEA, ARABIA, IRAQ AND IRAN
2035(T)/13 2884 ...................... IRAN: Wreck; Buoy........................................................................................... 40
3234(T)/13 1229 ...................... IRAQ: Wreck ..................................................................................................... 40
5236(T)/14 2523, 2883, 2886, QATAR: Buoyage .............................................................................................. 40
2887, 3950 ...........
1182(T)/16 333, 2374 ............. EGYPT, Red Sea Coast: Platform; Light ........................................................... 32
4281(P)/16 63 .......................... SAUDI ARABIA, Red Sea Coast: Harbour developments; Depths .................. 32
4492(P)/16 11, 1268, 2882, IRAN: Platforms; Submarine cables; Submarine pipelines ............................... 40
2884, 3774 ...........
5105(P)/16 16 ..........................
SAUDI ARABIA, Red Sea Coast: Depths; Wrecks; Submarine pipeline; 32
Rocks; Coral.......................................................................................................
2363(P)/17 6, 12, 15, 143, 157, RED SEA: Routeing measures........................................................................... 32
158, 159, 164, 452,
453, 1925, 2375,
2658, 2659, 2964
2822(T)/17 2523, 3790 ........... QATAR: Buoy .................................................................................................... 40
3559(P)/17 2837, 2889, 3178, UNITED ARAB EMIRATES: Submarine pipeline; Obstruction ...................... 40
3179, 3413 ...........
4031(P)/17 1265, 3842, 3843, IRAQ: Channel; Depths; Wrecks ....................................................................... 40
3844, 3845, 3846
5287(T)/17 1235, 1265 ........... ARABIA: Buoyage ............................................................................................ 40
5518(P)/17 1228 ...................... IRAQ: Jetty; Dolphins; Mooring buoys; Floating dock; Dredged area ............. 40
1453(T)/18 1235, 1265, 3773 ARABIA, Shaţţ al'Arab: Buoyage ..................................................................... 40
2528(T)/18 2133, 2373 ........... EGYPT, Red Sea Coast: Buoy ........................................................................... 32
4030(P)/18 3772, 3781 ........... QATAR: Depths; Buoyage ................................................................................. 40
994(P)/19 1229, 1235, 2847, IRAQ: Works; Buoyage; Channel...................................................................... 40
2884 ......................
1646(P)/19 3737, 3738, 3759 BAHRAIN: Works ............................................................................................. 40
1855(P)/19 3759 ...................... BAHRAIN: Works; Lights; Breakwater; Buoyage; Channel; Restricted area; 40
Submarine pipeline; Submarine cable; Radar beacon........................................
1937(T)/19 333, 2374 ............. EGYPT, Red Sea Coast: Buoy ........................................................................... 32
2208(T)/19 2523, 2837, 2847, QATAR: Buoy .................................................................................................... 40
2886, 3772, 3950
1A.13
Wk04/22
IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
3126(P)/19 2837, 2889, 3178, UNITED ARAB EMIRATES: Works; Offshore installations ........................... 40
3179 ......................
3154(P)/19 3176, 3412 ........... UNITED ARAB EMIRATES: Restricted area .................................................. 40
3202(P)/19 3812 ...................... SAUDI ARABIA, East Coast: Depths ............................................................... 40
6162(T)/19 2523 ...................... QATAR: Buoy .................................................................................................... 40
6524(T)/19 11........................... IRAN: Buoy ....................................................................................................... 40
6699(P)/19 3718 ...................... SAUDI ARABIA, East Coast: Works; Buoyage; Dredged area ........................ 40
163(P)/20 2884 ...................... KUWAIT: Works; Buoyage; Causeways ........................................................... 40
1822(T)/20 2854 ...................... OMAN: Wreck ................................................................................................... 40
2062(T)/20 3736 ...................... BAHRAIN: Buoyage ......................................................................................... 40
3127(P)/20 15, 16 ................... SAUDI ARABIA, Red Sea Coast: General information ................................... 32
3623(P)/20 27, 2884 ............... IRAN: Channel; Buoyage; Dredged depths; Light-beacons; Dredged areas; 40
Dolphins; Reclamation area; Coastline; Swinging circle; Anchor berths ..........
4448(P)/20 12 .......................... SAUDI ARABIA, Red Sea Coast: Depths; Obstruction; Dredged areas; 32
Coastline; Beacons .............................................................................................
4469(T)/20 3812 ...................... SAUDI ARABIA, East Coast: Buoy.................................................................. 40
4569(P)/20 3736 ...................... BAHRAIN: Floating barriers; Lights................................................................. 40
4645(P)/20 2132, 2133, 2373 EGYPT, Red Sea Coast: Works; Lights; Dredged area; Virtual aids to 32
navigation ...........................................................................................................
5242(T)/20 1214, 3773 ........... KUWAIT: Light-beacon; Lights ........................................................................ 40
6028(P)/20 3175 ...................... UNITED ARAB EMIRATES: Works; Restricted area; Outfall; Buoyage ........ 40
6265(P)/20 2837, 2847, 2883, BAHRAIN: Marine Reserve .............................................................................. 40
2886, 3738, 3788,
3790 ......................
121(T)/21 3777, 3812 ........... SAUDI ARABIA, East Coast: Wreck; Buoyage................................................ 40
361(T)/21 3763, 3785 ........... OMAN: Works ................................................................................................... 32, 40
1563(P)/21 3752 ...................... UNITED ARAB EMIRATES: Buoyage; Works................................................ 40
2031(T)/21 1223, 2882, 2884, KUWAIT: Lights................................................................................................ 40
3773 ......................
3072(P)/21 3778, 3779, 3780 UNITED ARAB EMIRATES: Works; Restricted areas; Buoyage .................... 40
3318(P)/21 2523, 2837, 2847, QATAR: Works; Offshore installation ............................................................... 40
2886 ......................
3623(P)/21 2577 ...................... SAUDI ARABIA, Red Sea Coast: Depths......................................................... 32
3693(T)/21 3520, 3723 ........... UNITED ARAB EMIRATES: Buoy.................................................................. 40
3859(T)/21 2523, 2837, 2847, BAHRAIN: Buoy............................................................................................... 40
2858, 2886, 3738,
3790 ......................
4008(T)/21 2837, 2887, 2888, UNITED ARAB EMIRATES: Buoy.................................................................. 40
3174 ......................
4070(P)/21 8054 ...................... UNITED ARAB EMIRATES: Buoyage; Light-beacons; Restricted areas........ 40
4104(T)/21 2882, 2883, 3719, SAUDI ARABIA, East Coast: Obstruction ....................................................... 40
3775, 3788 ...........
4429(P)/21 8101 ...................... UNITED ARAB EMIRATES: Buoy.................................................................. 40
4609(T)/21 8054 ...................... UNITED ARAB EMIRATES: Breakwater ........................................................ 40
4611(P)/21 8054 ...................... UNITED ARAB EMIRATES: Light; Works; Buoyage; Breakwaters; Channel 40
4615(P)/21 8054 ...................... UNITED ARAB EMIRATES: Anchorage area; Maritime limit........................ 40
5210(T)/21 3734, 3736, 3737 BAHRAIN: Works; Submarine pipeline............................................................ 40
5369(T)/21 12, 159, 2375, 4704 EGYPT, Red Sea Coast: Works ......................................................................... 32
271(P)/22 2442, 2837, 2858, UNITED ARAB EMIRATES: Restricted area .................................................. 40
2887, 2888, 2889,
3175, 3176 ...........
272(P)/22 8101 ...................... UNITED ARAB EMIRATES: Light.................................................................. 40
1A.14
Wk04/22
IA
11. RED SEA, ARABIA, IRAQ AND IRAN - continued
362(P)/22 12, 38, 58, 158, ARABIAN SEA: Submarine cables; Works ...................................................... 32, 40, 41
159, 327, 801,
1268, 2375, 2441,
2442, 2443, 2444,
2523, 2599, 2658,
2659, 2851, 2882,
2883, 2884, 2886,
2887, 2888, 2889,
2895, 3171, 3172,
3174, 3175, 3176,
3520, 3723, 3734,
3736, 3737, 3738,
3759, 3760, 3761,
3774, 3775, 3786,
3788, 3790, 3842,
3950 ......................
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA
4002(P)/12 569 ........................ INDIA, East Coast: Port developments ............................................................. 43
2877(T)/17 IN 2036 .................. INDIA, West Coast: Buoyage ............................................................................ 41
5395(T)/17 39, 707, 4705 ...... PAKISTAN: Wreck ............................................................................................ 32, 41
2839(P)/18 IN 3010, IN 3041 ... INDIA, East Coast: Anchorage areas; Submarine pipelines; Restricted area .... 43
2951(T)/18 90 .......................... BANGLADESH: Obstruction............................................................................ 43
3911(P)/18 IN 2016, IN 2076 ... INDIA, West Coast: Works ................................................................................ 41
4921(T)/18 90 .......................... BANGLADESH: Wreck .................................................................................... 43
5442(T)/18 1488, IN 207, INDIA, West Coast: Dredging areas .................................................................. 41
IN 253, IN 254 .......
5548(P)/18 IN 206, IN 253 ....... INDIA, West Coast: Works ................................................................................ 41
5576(P)/18 920 ........................ INDIAN OCEAN, Chagos: Restricted areas; Anchorage areas; Depths ........... 38
6120(P)/18 3265, 3700 ........... SRI LANKA, South Coast: Depths; Rocks........................................................ 42
105(P)/19 319 ........................ INDIA, East Coast: Channel limit; Buoyage; Dredged depths; Berth; Floating 43
dock; Pilot boarding places ................................................................................
1066(T)/19 84, 90 ................... BANGLADESH: Wrecks; Buoy........................................................................ 43
1217(P)/19 IN 292 .................... INDIA, West Coast: Traffic separation scheme ................................................. 41
1600(T)/19 84, 90 ................... BANGLADESH: Wrecks................................................................................... 43
2078(P)/19 IN 3012 .................. INDIA, East Coast: Works ................................................................................. 43
2106(P)/19 IN 211, IN 255, INDIA, West Coast: Works; Buoyage................................................................ 41
IN 292, IN 293,
IN 2016, IN 2076 ...
2556(T)/19 732 ........................ BANGLADESH: Wreck .................................................................................... 43
2869(P)/19 IN 203, IN 2013, INDIA, West Coast: Works ................................................................................ 41
IN 2031 ..................
2871(P)/19 IN 220, IN 259, INDIA, West Coast: Works ................................................................................ 41
IN 2004, IN 2029,
IN 2045 ..................
3115(P)/19 IN 203, IN 2033, INDIA, West Coast: Works ................................................................................ 41
IN 2083 ..................
3861(T)/19 833 ........................ BURMA: Buoy .................................................................................................. 43
3935(T)/19 IN 2002, IN 2359 ... INDIA, West Coast: Buoy.................................................................................. 41
3986(T)/19 722 ........................ INDIAN OCEAN, Seychelles: Beacon.............................................................. 36
4184(T)/19 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
4267(T)/19 1885 ...................... BURMA: Buoy .................................................................................................. 43
4326(P)/19 1488, IN 207, INDIA, West Coast: Works ................................................................................ 41
IN 253, IN 254,
IN 292 ....................
4612(T)/19 84, 90 ................... BANGLADESH: Wrecks................................................................................... 43
4977(T)/19 84 .......................... BANGLADESH: Works .................................................................................... 43
5223(T)/19 90 .......................... BANGLADESH: Obstruction............................................................................ 43
5331(T)/19 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
1A.15
Wk04/22
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
5332(T)/19 90 .......................... BANGLADESH: Wreck .................................................................................... 43
5363(T)/19 830 ........................ BURMA: Works................................................................................................. 45
5373(T)/19 3877, 3895, 4701, INDIAN OCEAN, Comores: Volcanic activity ................................................. 36, 38
4702 ......................
5624(T)/19 90, 732 ................. BANGLADESH: Buoyage ................................................................................ 43
6550(P)/19 84, 90 ................... BANGLADESH: Submarine pipelines.............................................................. 43
468(T)/20 90, 817 ................. BANGLADESH: Wreck .................................................................................... 43
579(P)/20 IN 254, IN 292 ....... INDIA, West Coast: Depths ............................................................................... 41
1004(T)/20 90 .......................... BANGLADESH: Wreck .................................................................................... 43
1168(P)/20 69, IN 262 ............. INDIA, East Coast: Depths; Recommended anchorage; Buoyage .................... 42
1380(T)/20 IN 223, IN 260, INDIA, West Coast: Buoyage ............................................................................ 41
IN 261 ....................
1802(P)/20 IN 211, IN 255, INDIA, West Coast: Bridge; Jetty...................................................................... 41
IN 2016, IN 2076 ...
2164(P)/20 725, 727 ............... INDIAN OCEAN, Chagos: Rocks; Obstructions .............................................. 38
2332(T)/20 IN 214, IN 215, INDIA, West Coast: Buoyage ............................................................................ 41
IN 2022 ..................
2821(T)/20 2760, 4070, 4071, INDIAN OCEAN: Buoyage .............................................................................. 35, 42, 46
4073, 4707 ...........
3168(P)/20 IN 3037, IN 3038 ... INDIA, East Coast: Dredging area; Channel limits; Buoyage........................... 43
3175(T)/20 823, 826, 833 ...... BURMA: Wreck................................................................................................. 43
3503(T)/20 39, 58 ................... PAKISTAN: Quarantine anchorage ................................................................... 41
3630(T)/20 709, 4703, 4706, INDIA, East Coast: Buoyage ............................................................................. 42
4707 ......................
4221(T)/20 90, IN 31 ............... BANGLADESH: Dredging area........................................................................ 43
4277(P)/20 711, 3048.............. INDIAN OCEAN, Mauritius: Depths................................................................ 38
4292(P)/20 1470, IN 203 ......... INDIA, West Coast: Depths; Drying heights ..................................................... 41
4378(P)/20 IN 33 ...................... INDIAN OCEAN, Nicobar Islands: Depths; Obstructions; Lights ................... 42
4980(P)/20 IN 203 .................... INDIA, West Coast: Buoy; Depths .................................................................... 41
5051(T)/20 2741, 2756 ........... INDIAN OCEAN, Comores: Light.................................................................... 36
5101(T)/20 817, 4706, IN 31 .. BURMA: Offshore installations......................................................................... 42, 43
5786(T)/20 IN 22, IN 211, INDIA, West Coast: Works ................................................................................ 41, 42
IN 255, IN 292,
IN 293, IN 2015,
IN 2016, IN 2076 ...
6303(P)/20 823, 826, 830, 833 BURMA: Submarine cable; Works.................................................................... 43, 45
220(P)/21 709, 813, 1013, SRI LANKA, West Coast: Submarine cable...................................................... 42
3323, 3700, 4703,
4706, 4707, IN 32,
IN 263 ....................
603(T)/21 IN 22, IN 32, IN 220, INDIA, West Coast: Measuring instruments...................................................... 41, 42
IN 259 ....................
1A.16
Wk04/22
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
605(T)/21 317, 319, 514, 569, INDIAN OCEAN: Buoyage .............................................................................. 36, 38, 41,
707, 709, 716, 717, 42, 43
721, 740, 742,
1398, 1470, 2069,
IN 22, IN 31, IN 33,
IN 205, IN 206,
IN 211, IN 212,
IN 213, IN 215,
IN 216, IN 219,
IN 221, IN 223,
IN 253, IN 257,
IN 258, IN 259,
IN 260, IN 261,
IN 262, IN 263,
IN 272, IN 273,
IN 292, IN 293,
IN 308, IN 351,
IN 352, IN 473,
IN 2008, IN 3002,
IN 3035 ..................
874(P)/21 12, 15, 159, 164, INDIAN OCEAN: Submarine cables ................................................................ 32, 40, 41,
263, 264, 333, 818, 42, 43, 45,
830, 2375, 2441, 46
2442, 2760, 3784,
3943, 4705, 4706,
IN 273, IN 293,
IN 2036 ..................
879(T)/21 2069, IN 32 ........... INDIA, East Coast: Scientific instruments ........................................................ 42, 43
982(T)/21 IN 3010, IN 3041 ... INDIA, East Coast: Buoyage ............................................................................. 43
1025(T)/21 39, 707, 709, IN 22, INDIA, West Coast: Obstructions; Scientific instruments................................. 41, 42
IN 32, IN 214,
IN 221, IN 253,
IN 258, IN 259,
IN 261, IN 263,
IN 272, IN 292,
IN 293 ....................
1276(T)/21 39, 58 ................... PAKISTAN: Wrecks........................................................................................... 41
1431(P)/21 IN 3010 .................. INDIA, East Coast: Depths; Quay; Anchorage areas......................................... 43
1A.17
Wk04/22
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
1953(P)/21 6, 143, 151, 153, INDIAN OCEAN: Works; Submarine cables .................................................... 24, 25, 26,
157, 158, 159, 167, 32, 34, 35,
171, 240, 264, 265, 36, 38
327, 333, 355, 356,
452, 453, 616, 644,
646, 666, 671, 674,
716, 717, 721, 722,
740, 742, 964,
1180, 1196, 1704,
1705, 1913, 1925,
1926, 1998, 2116,
2122, 2123, 2124,
2133, 2373, 2374,
2375, 2573, 2574,
2578, 2926, 2930,
2949, 2964, 2968,
3310, 3361, 3795,
3797, 3877, 3878,
4146, 4148, 4150,
4151, 4152, 4156,
4157, 4169, 4171,
4177, 4178, 4179,
4180 ......................
2203(T)/21 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
2269(P)/21 318, IN 31, IN 32 .. INDIA, East Coast: Buoy................................................................................... 42, 43
2317(T)/21 317, 318, 319, INDIA, East Coast: Obstructions; Scientific instruments.................................. 42, 43
2069, 4706, IN 31,
IN 32, IN 33, IN 308,
IN 352 ....................
2409(P)/21 33, 38 ................... PAKISTAN: Depths; Lights ............................................................................... 41
2620(T)/21 813, IN 263 ........... SRI LANKA, West Coast: Wreck ...................................................................... 42
2825(P)/21 IN 203, IN 2068, INDIA, West Coast: Berth; Works ..................................................................... 41
IN 2079, IN 2106 ...
3514(P)/21 Q 6099, Q 6111 ...... INDIAN OCEAN: Maritime limit ..................................................................... None, 0
3518(P)/21 IN 32, IN 223, IN 262 INDIA, East Coast: Works ................................................................................. 41, 42
3779(T)/21 84 .......................... BANGLADESH: Wreck; Buoy ......................................................................... 43
4020(P)/21 732 ........................ BANGLADESH: Drying heights; Depths; Wrecks; Buoyage; Lights; 43
Coastline; Ferry route.........................................................................................
4122(T)/21 84, 90 ................... BANGLADESH: Wreck .................................................................................... 43
4125(T)/21 IN 211, IN 255, INDIA, West Coast: Works ................................................................................ 41
IN 292, IN 293,
IN 2016, IN 2076 ...
4222(T)/21 90 .......................... BANGLADESH: Wrecks; Buoy........................................................................ 43
4544(P)/21 84, 90 ................... BANGLADESH: Depths; Drying heights; Islets; Wrecks; Platform; Restricted 43
areas; Buoyage; Submarine pipeline; Jetties; Signal station; Lights; Leading
lights; Beacons; Landmarks; Tide gauge; Pontoons; Piers; Automatic
Identification Systems; Virtual aids to navigation .............................................
4834(T)/21 90, IN 31 ............... BANGLADESH: Buoy...................................................................................... 43
5362(T)/21 58, 59 ................... PAKISTAN: Buoy.............................................................................................. 41
5413(T)/21 84 .......................... BANGLADESH: Wreck; Buoy ......................................................................... 43
5497(T)/21 84 .......................... BANGLADESH: Wreck .................................................................................... 43
1A.18
Wk04/22
IA
12. INDIAN OCEAN, PAKISTAN, INDIA, SRI LANKA, BANGLADESH AND BURMA - continued
92(T)/22 529, 716, 721, 724, INDIAN OCEAN: Buoyage .............................................................................. 19, 20, 34,
2760, 2781, 2785, 35, 36, 38,
3877, 4070, 4071, 42, 43, 46,
4072, 4073, 4104, 47, 53, 64,
4115, 4202, 4203, 87, 89, 92,
4209, 4215, 4216, 95
4508, 4510, 4701,
4702, 4703, 4706,
4707, 4708, 4714,
4806, 4810, IN 31
221(T)/22 707, 709, 4703, INDIA, West Coast: Data buoys ........................................................................ 32, 41, 42
4705, 4706, 4707,
IN 22, IN 273, IN 292
222(T)/22 317, 830, 1398, INDIA, East Coast: Data buoys ......................................................................... 42, 43, 45
2069, 4706, 4707,
IN 31, IN 32, IN 33,
IN 313, IN 472,
IN 473, IN 3001,
IN 3004 ..................
237(T)/22 90, IN 31 ............... BANGLADESH: Wreck .................................................................................... 43
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA
1030(T)/16 1140, 3946............ MALAYSIA, Peninsular Malaysia, West Coast: Obstruction............................ 45
2152(T)/17 3831, 3833, 4041 SINGAPORE STRAIT: Buoy............................................................................ 45
4448(P)/17 8232, 8233 ........... MALAYSIA, Peninsular Malaysia, West Coast: Maintained channel............... 45
1401(P)/18 1312, 2422, 2435, INDONESIA, Sumatera: Submarine cables ...................................................... 45, 46, 47,
2436, 2470, 2868, 48
2870, 3947 ...........
4349(P)/18 8233 ...................... MALACCA STRAIT: Anchorage areas............................................................. 45
4527(P)/18 8233 ...................... MALACCA STRAIT: Note ............................................................................... 45
4673(P)/18 2873, 3947 ........... INDONESIA, Sumatera: Submarine cable ........................................................ 45, 46
4930(P)/18 8284 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Pilot boarding place .............. 45
461(P)/19 8232, 8233 ........... MALAYSIA, Peninsular Malaysia, West Coast: Dredged depth....................... 45
637(T)/19 3471 ...................... INDONESIA, Sumatera: Buoy .......................................................................... 46
1082(P)/19 8175 ...................... SINGAPORE: Maritime limit............................................................................ 45
1335(T)/19 3949 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
1939(P)/19 8176 ...................... SINGAPORE: Light........................................................................................... 45
2617(P)/19 8177 ...................... SINGAPORE: Light........................................................................................... 45
3628(P)/19 8232 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Note....................................... 45
4676(T)/19 2152, 2155 ........... MALAYSIA, Peninsular Malaysia, West Coast: Buoyage ................................ 45
5772(P)/19 8175 ...................... SINGAPORE: Buoy........................................................................................... 45
6060(P)/19 1146, 3946, 3947. MALAYSIA, Peninsular Malaysia, West Coast: Depths ................................... 45
1226(P)/20 8176 ...................... SINGAPORE: Dredged depths .......................................................................... 45
1282(P)/20 8175 ...................... SINGAPORE: Dredged areas; Dredged depths; Jetty ....................................... 45
1558(P)/20 8175 ...................... SINGAPORE: Maritime limits; Buoy ............................................................... 45
2024(P)/20 3940, 3946, 3947 MALACCA STRAIT: Submarine cable ............................................................ 45
2031(P)/20 3833 ...................... SINGAPORE STRAIT: Anchorage areas.......................................................... 45
2218(P)/20 3833, 8175 ........... SINGAPORE: Works ......................................................................................... 45
2221(P)/20 3833 ...................... SINGAPORE: Submarine cables ....................................................................... 45
2529(T)/20 3948 ...................... INDONESIA, Sumatera: Wreck ........................................................................ 46
2629(P)/20 8175, 8176 ........... SINGAPORE: Dredged depths .......................................................................... 45
2741(T)/20 2403, 3833, 3902, INDONESIA, Sumatera: Wreck ........................................................................ 45, 46
3948 ......................
2752(P)/20 8285 ...................... SINGAPORE: Automatic Identification System ............................................... 45
3077(P)/20 8284 ...................... MALAYSIA, Peninsular Malaysia, West Coast: Anchorage area ..................... 45
3146(P)/20 8175 ...................... SINGAPORE: Dredged depths .......................................................................... 45
3438(P)/20 8176 ...................... SINGAPORE: Vertical clearance....................................................................... 45
1A.19
Wk04/22
IA
13. MALACCA STRAIT, SINGAPORE STRAIT AND SUMATERA - continued
3927(P)/20 8232, 8233 ........... MALACCA STRAIT: Berths; Dredged depths; Dredging areas; Pontoon; 45
Depths ................................................................................................................
4003(P)/20 8175, 8176 ........... SINGAPORE: Dredged depths; Wreck ............................................................. 45
4198(T)/20 3902, 3947 ........... MALAYSIA, Peninsular Malaysia, West Coast: Works .................................... 45
4423(P)/20 8175, 8176 ........... SINGAPORE: Dredged depths; Berths ............................................................. 45
4424(P)/20 1312, 2403, 2869, INDONESIA, Sumatera: Light-beacon ............................................................. 45, 46, 47
3831 ......................
5851(P)/20 8175 ...................... SINGAPORE: Dredged depth............................................................................ 45
5973(P)/20 8285 ...................... SINGAPORE: Radio reporting points ............................................................... 45
6179(P)/20 2917 ...................... INDONESIA, Sumatera: Fairways; Anchorage areas ....................................... 45
165(T)/21 3831, 3833, 3937, INDONESIA, Sumatera: Wreck ........................................................................ 45
4041 ......................
490(P)/21 8176 ...................... SINGAPORE: Automatic Identification System ............................................... 45
1189(P)/21 2403, 3833, 3902, INDONESIA, Sumatera: Submarine cables ...................................................... 45, 46
3948 ......................
2067(P)/21 1312, 2403, 2414, SINGAPORE STRAIT: Submarine cable.......................................................... 45, 46, 47
2422, 2436, 2470,
2869, 3445, 3482,
3831, 3949 ...........
2267(T)/21 3833, 4039, 4040 SINGAPORE STRAIT: Wreck .......................................................................... 45
2428(P)/21 1312, 1348, 2403, SINGAPORE STRAIT: Submarine cables ........................................................ 45, 46, 47,
2414, 2422, 2435, 48
2436, 2470, 2868,
2869, 3445, 3482,
3831 ......................
2578(P)/21 8175 ...................... SINGAPORE: Dredged depths .......................................................................... 45
2969(P)/21 3584, 3901, 3921 INDONESIA, Sumatera: Submarine pipelines; Mooring .................................. 45
3009(P)/21 1312, 2403, 2414, SINGAPORE STRAIT: Works; Submarine cable ............................................. 45, 46, 47
2422, 2436, 2470,
2869, 3482, 3831,
3949 ......................
4262(P)/21 8233 ...................... MALACCA STRAIT: Harbour limit; Legend ................................................... 45
4687(P)/21 1312, 2403, 2869, INDONESIA, Sumatera: Light-beacon ............................................................. 45, 46, 47
3831, 5527 ...........
4739(T)/21 4031, 4032, 8176 SINGAPORE: Buoy; Works .............................................................................. 45
4740(P)/21 4037, 8177 ........... SINGAPORE: Dredged depths .......................................................................... 45
4746(P)/21 4032, 4034, 8176 SINGAPORE: Dredged depths; Berths ............................................................. 45
4770(P)/21 8177 ...................... SINGAPORE: Restricted area ........................................................................... 45
4872(P)/21 8233 ...................... MALACCA STRAIT: Wreck; Buoy.................................................................. 45
5066(T)/21 4030, 4031, 4032, SINGAPORE: Dredging area; Works ................................................................ 45
4033, 4038, 4039,
4040, 8175, 8176
5090(T)/21 4038 ...................... SINGAPORE: Buoyage ..................................................................................... 45
5449(T)/21 8175, 8176, 8177 SINGAPORE: Maritime limits; Radio reporting lines; Legends....................... 45
142(T)/22 4031, 4032, 4039, SINGAPORE: Light-beacon; Buoy ................................................................... 45
4040, 8176 ...........
154(T)/22 2403, 3833, 3902, SINGAPORE: Radar beacon ............................................................................. 45
4030, 4031, 4038,
4040, 5524, 8175
155(P)/22 4044, 8285 ........... SINGAPORE: Dredged depths .......................................................................... 45
229(P)/22 8175 ...................... SINGAPORE: General information................................................................... 45
230(P)/22 8176 ...................... SINGAPORE: General information................................................................... 45
14. CHINA SEA WITH ITS WEST SHORE AND CHINA
2855(T)/06 1251 ...................... CHINA, Yellow Sea Coast: Restricted area ....................................................... 52
5172(T)/10 341, 937, 1555, CHINA, South Coast: Obstruction..................................................................... 47, 50
1962, 3026, 4127
3997(T)/12 341, 3026 ............. CHINA, South Coast: Light-beacons................................................................. 47, 50
5137(T)/13 2409 ...................... TAIWAN: Buoyage ............................................................................................ 50
1A.20
Wk04/22
IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
5218(T)/14 67, 2414, 3965 .... THAILAND, Gulf of Thailand Coast: Platforms............................................... 47
650(T)/15 1286, 1287 ........... CHINA, Bo Hai: Restricted area........................................................................ 52
5355(T)/15 1059 ...................... VIETNAM: Dredged area.................................................................................. 47
6200(T)/15 1962, 1968 ........... CHINA, South Coast: Buoy............................................................................... 50
6450(T)/15 1304 ...................... CHINA, East Coast: Wreck................................................................................ 50
877(P)/16 1254, 1256, 1289, CHINA, Yellow Sea Coast: Precautionary area ................................................. 52
3480 ......................
1407(T)/16 2103, 3879, 3967 GULF OF THAILAND: Platform...................................................................... 47
3206(T)/16 3987 ...................... VIETNAM: Buoyage ......................................................................................... 47
3891(P)/16 8153 ...................... CHINA, Yellow Sea Coast: Note ....................................................................... 52
3897(T)/16 1555, 3488, 3892 CHINA, South Coast: Buoy............................................................................... 47
4494(T)/16 1968, 3489 ........... TAIWAN STRAIT: Buoy................................................................................... 48, 50
4630(T)/16 2103 ...................... GULF OF THAILAND: Buoy........................................................................... 47
5455(P)/16 8153 ...................... CHINA, Yellow Sea Coast: Buoyage; Radar beacons ....................................... 52
5686(T)/16 3359 ...................... CHINA, South Coast: Buoyage; Light-beacons ................................................ 47
491(T)/17 1046, 3727, 3965, THAILAND, Gulf of Thailand Coast: Restricted areas..................................... 47
3966 ......................
3865(T)/17 1144, 1303, 1306. CHINA, East Coast: Works; Breakwater ........................................................... 50
4123(P)/17 2641, 2642 ........... CHINA, Bo Hai: Works ..................................................................................... 52
1180(T)/18 3874 ...................... VIETNAM: Obstruction .................................................................................... 47
1219(P)/18 3875, 3888 ........... VIETNAM: Harbour limit ................................................................................. 47
2358(P)/18 1036 ...................... VIETNAM: Works; Buoyage............................................................................. 47
3056(T)/18 3875 ...................... VIETNAM: Wreck............................................................................................. 47
4337(T)/18 1249, 1255, 3697 CHINA, Yellow Sea Coast: Buoy ...................................................................... 52
5260(T)/18 2422, 3446, 3482 MALAYSIA, Peninsular Malaysia, East Coast: Wreck ..................................... 47
5631(P)/18 1965, 3875, 3888, VIETNAM: Dredged areas; Depths; Anchor berths; Buoyage; Pilot boarding 47
3889 ...................... place; Overhead cable; Swept area; Restricted area; Jetties; Harbour limit;
Reclamation areas; Channels .............................................................................
660(P)/19 8219 ...................... CHINA, East Coast: Legend .............................................................................. 50
835(P)/19 3879 ...................... VIETNAM: Buoyage ......................................................................................... 47
1028(P)/19 1379 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Breakwater; Lights; Quay; 47
Depths; Maintained channels .............................................................................
1656(T)/19 2412 ...................... EASTERN CHINA SEA: Buoy ......................................................................... 53
1948(P)/19 341, 343, 4123, CHINA, South Coast: Works; Buoyage; Automatic Identification Systems ..... 47, 50
4129 ......................
2660(T)/19 3875, 3888 ........... VIETNAM: Wreck............................................................................................. 47
3109(T)/19 1199, 2412, 3480. CHINA, East Coast: Buoy ................................................................................. 50, 52, 53
3365(P)/19 8217 ...................... CHINA, East Coast: Note .................................................................................. 50
3987(P)/19 1130....................... CHINA, East Coast: Bridge; Vertical clearance................................................. 50
4141(T)/19 3232 ...................... TAIWAN: Works ................................................................................................ 50
4195(T)/19 3874 ...................... VIETNAM: Wrecks; Buoyage ........................................................................... 47
4212(P)/19 8217 ...................... CHINA, East Coast: Note .................................................................................. 50
4270(T)/19 2376 ...................... TAIWAN: Breakwater........................................................................................ 50
4562(T)/19 2426, 3985 ........... GULF OF THAILAND: Wreck ......................................................................... 47
4737(P)/19 1304 ...................... CHINA, East Coast: Submarine pipeline........................................................... 50
5101(T)/19 1760, 1968, 2409, TAIWAN: Obstruction ....................................................................................... 48, 50, 53
2412, 3489 ...........
5304(T)/19 1716, 1761, 2401 CHINA, South Coast: Works ............................................................................. 50
5381(T)/19 343 ........................ CHINA, South Coast: Works ............................................................................. 47
5385(T)/19 2657 ...................... CHINA, Bo Hai: Depth...................................................................................... 52
5571(T)/19 1221 ...................... CHINA, Bo Hai: Dredging area......................................................................... 52
5627(T)/19 1716, 1723, 2401 CHINA, South Coast: Works ............................................................................. 50
6039(P)/19 8219 ...................... CHINA, East Coast: Note .................................................................................. 50
6488(T)/19 1505, 1506 ........... CHINA, Yellow Sea Coast: Works; Channel; Restricted area ........................... 52
77(T)/20 2409, 3231 ........... TAIWAN: Spoil ground; Works ......................................................................... 50
361(T)/20 1059, 1100............ VIETNAM: Wreck............................................................................................. 47
629(P)/20 1304 ...................... CHINA, East Coast: Pier.................................................................................... 50
1A.21
Wk04/22
IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
668(T)/20 1760, 2409 ........... TAIWAN: Buoyage; Restricted area; Wreck; Works ......................................... 50
749(P)/20 1289 ...................... CHINA, Yellow Sea Coast: Light ...................................................................... 52
1096(T)/20 1537, 1555, 3892 CHINA, South Coast: Submarine cable............................................................. 47
1188(P)/20 1303, 1304 ........... CHINA, East Coast: Submarine cable ............................................................... 50
1209(P)/20 1130....................... CHINA, East Coast: Works................................................................................ 50
1277(T)/20 2619 ...................... TAIWAN: Works ................................................................................................ 50
1660(T)/20 1046, 3724, 3727 THAILAND, Gulf of Thailand Coast: Buoyage ................................................ 47
1827(T)/20 1199, 2412............ CHINA, East Coast: Buoy ................................................................................. 50, 53
2025(P)/20 3231 ...................... TAIWAN: Depths ............................................................................................... 50
2225(P)/20 1604 ...................... CHINA, East Coast: Vertical clearance.............................................................. 50
2620(T)/20 1505, 1506, 8152 CHINA, Yellow Sea Coast: Pier ........................................................................ 52
2636(T)/20 3348, 3351, 3892 CHINA, South Coast: Virtual aids to navigation; Buoyage............................... 47
2676(T)/20 3488, 3989, 3990 CHINA: Works................................................................................................... 47
3073(P)/20 8218 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
3680(P)/20 8215 ...................... CHINA, East Coast: Anchorage areas ............................................................... 50
3766(P)/20 2642 ...................... CHINA, Bo Hai: Depths; Berths; Coastline ...................................................... 52
3867(T)/20 3447 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Anchorage area ...................... 47
3887(P)/20 8215 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
3980(P)/20 8218 ...................... CHINA, East Coast: Pilot boarding places ........................................................ 50
4138(T)/20 3884 ...................... VIETNAM: Wreck............................................................................................. 47
4220(P)/20 8215 ...................... CHINA, East Coast: Radio reporting lines; Legends......................................... 50
4226(P)/20 8215 ...................... CHINA, East Coast: Fairways ........................................................................... 50
4361(P)/20 8215 ...................... CHINA, East Coast: Restricted areas................................................................. 50
4453(P)/20 8215 ...................... CHINA, East Coast: Anchorage area ................................................................. 50
4470(P)/20 8218 ...................... CHINA, East Coast: Maritime limit; Pilot boarding place ................................ 50
4482(P)/20 8217, 8218 ........... CHINA, East Coast: Pilot boarding place.......................................................... 50
4506(P)/20 1761, 3231, 3658 TAIWAN: Works; Buoyage................................................................................ 50
4508(T)/20 1968, 3489 ........... TAIWAN STRAIT: Wreck ................................................................................. 48, 50
4813(P)/20 1250, 2645 ........... CHINA, Bo Hai: Depths .................................................................................... 52
4863(T)/20 3351 ...................... CHINA, South Coast: Light-vessel; Automatic Identification System; Radar 47
beacon; Virtual aid to navigation .......................................................................
5048(P)/20 8218 ...................... CHINA, East Coast: Anchorage areas; Pilot boarding places; Legend ............. 50
5054(P)/20 8218 ...................... CHINA, East Coast: Anchorage areas ............................................................... 50
5109(P)/20 1036 ...................... VIETNAM: Works; Bridge; Buoyage................................................................ 47
5184(T)/20 1536, 1537 ........... CHINA, South Coast: Works ............................................................................. 47
5204(T)/20 2376, 3230, 3232 TAIWAN: Works ................................................................................................ 50
5455(P)/20 8152, 8153 ........... CHINA, Yellow Sea Coast: Radio reporting lines; Legend ............................... 52
5637(P)/20 967, 1338, 3483, SOUTH CHINA SEA: Fish havens ................................................................... 47, 48, 57,
3489, 4411, 4414, 59
4464, 4507, 4508,
4509 ......................
6096(T)/20 2618 ...................... TAIWAN: Depths ............................................................................................... 50
6104(T)/20 3989 ...................... VIETNAM: Wreck............................................................................................. 47
6229(T)/20 3992, 3999 ........... CHINA, South Coast: Buoyage ......................................................................... 47
6251(P)/20 1252 ...................... CHINA, Bo Hai: Piers........................................................................................ 52
6269(T)/20 3988 ...................... VIETNAM: Wreck............................................................................................. 47
158(T)/21 4123 ...................... CHINA, South Coast: Works; Buoyage ............................................................. 50
170(T)/21 2409, 3232 ........... TAIWAN: Works ................................................................................................ 50
356(P)/21 341, 343, 3026 .... CHINA, South Coast: General information ....................................................... 47, 50
589(P)/21 8127 ...................... CHINA, East Coast: Radio reporting points ...................................................... 50
596(T)/21 2412, 3235, 3236 TAIWAN: Restricted area .................................................................................. 50, 53
614(T)/21 341, 937, 3026, CHINA, South Coast: Restricted area; Scientific instrument ............................ 47, 50
4129 ......................
751(T)/21 1761, 1968, 3231 TAIWAN: Obstructions...................................................................................... 50
831(T)/21 1506 ...................... CHINA, Yellow Sea Coast: Dredging area ........................................................ 52
906(P)/21 8216 ...................... CHINA, East Coast: Legends ............................................................................ 50
999(P)/21 341, 3026, 4129 .. CHINA, South Coast: Works ............................................................................. 47, 50
1A.22
Wk04/22
IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
1320(T)/21 2645 ...................... CHINA, Bo Hai: Wreck ..................................................................................... 52
1435(T)/21 341, 3026, 4129 .. CHINA, South Coast: Works; Buoyage; Reclamation area; Automatic 47, 50
Identification Systems ........................................................................................
1454(T)/21 1760, 2409 ........... TAIWAN: Obstruction ....................................................................................... 50
1470(T)/21 3488, 3988, 3989 VIETNAM: Works; Offshore installation.......................................................... 47
1471(P)/21 3874 ...................... VIETNAM: Submarine power cable; Buoyage ................................................. 47
1565(T)/21 4117, 4126, 4127. CHINA, South Coast: Works ............................................................................. 47
1612(P)/21 8153 ...................... CHINA, Yellow Sea Coast: Obstruction ............................................................ 52
1664(P)/21 809 ........................ CHINA, Yellow Sea Coast: Berth; Depth .......................................................... 52
1678(T)/21 1536 ...................... CHINA, South Coast: Dredging area; Works .................................................... 47
1823(P)/21 54 .......................... CHINA, South Coast: Breakwater ..................................................................... 47
1983(P)/21 3831, 5527 ........... MALAYSIA, Peninsular Malaysia, East Coast: Jetty; Anchorage areas ........... 45
2042(T)/21 3999 ...................... CHINA, South Coast: Dredged area .................................................................. 47
2215(T)/21 341, 937, 4127 .... CHINA, South Coast: Works ............................................................................. 47, 50
2260(T)/21 4117, 4126............ CHINA, South Coast: Works; Buoyage ............................................................. 47
2336(P)/21 1760, 1968, 2409, TAIWAN: Works ................................................................................................ 50
3231 ......................
2471(P)/21 5527 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Restricted area; Legend ......... 45
2711(P)/21 8216 ...................... CHINA, East Coast: Radio reporting lines; Legends......................................... 50
2769(T)/21 4117, 4126............ CHINA, South Coast: Buoyage; Works ............................................................. 47
2868(P)/21 8216 ...................... CHINA, East Coast: Radio reporting lines; Legends......................................... 50
3111(T)/21 3938 ...................... CHINA, South Coast: Works ............................................................................. 47
3254(T)/21 1760, 1761, 1968, TAIWAN STRAIT: Firing practice areas........................................................... 48, 50, 53
2409, 2412, 3236,
3489, 3658, 4410
3265(T)/21 1968, 3236, 3489, TAIWAN: Firing practice areas.......................................................................... 48, 50
4410 ......................
3282(T)/21 2376, 3230 ........... TAIWAN: Works ................................................................................................ 50
3363(T)/21 2618 ...................... TAIWAN: Works; Buoyage................................................................................ 50
3513(P)/21 2657 ...................... CHINA, Bo Hai: Depths .................................................................................... 52
3525(P)/21 1100....................... VIETNAM: Works; Buoyage............................................................................. 47
3775(T)/21 1304 ...................... CHINA, East Coast: Buoyage............................................................................ 50
3954(T)/21 1059, 1100............ VIETNAM: Works ............................................................................................. 47
4119(T)/21 809 ........................ CHINA, Yellow Sea Coast: Works..................................................................... 52
4124(T)/21 1221 ...................... CHINA, Bo Hai: Works ..................................................................................... 52
4131(P)/21 8216 ...................... CHINA, East Coast: Lights; Radar beacons ...................................................... 50
4157(T)/21 1249, 1256 ........... CHINA, Bo Hai: Obstruction; Area to be avoided ............................................ 52
4313(P)/21 1536, 1537, 1555, CHINA, South Coast: Submarine power cable.................................................. 47
3892 ......................
4347(T)/21 1505, 1506, 8152 CHINA, Yellow Sea Coast: Virtual aid to navigation ........................................ 52
4399(P)/21 1254, 1256 ........... CHINA, Yellow Sea Coast: Wind farm.............................................................. 52
4493(T)/21 2645 ...................... CHINA, Bo Hai: Works ..................................................................................... 52
4496(T)/21 1143, 1199............ CHINA, East Coast: Works................................................................................ 50
4553(T)/21 1126, 1130, 1304, CHINA, East Coast: Buoyage; Wreck; Virtual aid to navigation ...................... 50
1305 ......................
4555(T)/21 809 ........................ CHINA, Yellow Sea Coast: Pier; Works ............................................................ 52
4622(P)/21 103, 341, 937, CHINA, South Coast: Submarine cable............................................................. 47, 48, 50
1555, 1962, 1968,
3026, 3488, 3489,
3890, 3892 ...........
4647(T)/21 1760, 2409 ........... TAIWAN: Buoyage ............................................................................................ 50
4679(T)/21 4043, 4044 ........... MALAYSIA, Peninsular Malaysia, East Coast: Light-beacon; Buoy ............... 45
4767(T)/21 1537, 1555 ........... CHINA, South Coast: Submarine cable............................................................. 47
4802(P)/21 1965, 3875, 3881, VIETNAM: Channels; Buoyage; Depths; Drying heights; Port developments; 47
3882 ...................... Bridges; Works; Harbour limits; Swinging circle; Anchorage areas; Overhead
cables; Light-beacon; Vertical clearances ..........................................................
4822(T)/21 1249, 1255, 3697 CHINA, Yellow Sea Coast: Light-vessel; Buoy ................................................ 52
4825(P)/21 8152 ...................... CHINA, Yellow Sea Coast: Legend................................................................... 52
1A.23
Wk04/22
IA
14. CHINA SEA WITH ITS WEST SHORE AND CHINA - continued
4840(T)/21 1760, 2409, 3231 TAIWAN: Works ................................................................................................ 50
4845(P)/21 1285 ...................... CHINA, East Coast: Drying patch ..................................................................... 52
4851(T)/21 1281 ...................... CHINA, East Coast: Buoy; Wreck..................................................................... 52
4857(T)/21 2645 ...................... CHINA, Bo Hai: Dredging area; Works ............................................................ 52
4862(T)/21 1760, 2409 ........... TAIWAN: Buoyage ............................................................................................ 50
4873(P)/21 1059, 1100............ VIETNAM: Buoyage; Beacons; Depths; Jetty; Channels; Automatic 47
Identification System; Wreck; Anchorage areas; Swinging circle .....................
5027(T)/21 1738 ...................... CHINA, East Coast: Buoyage; Wreck; Virtual aid to navigation ...................... 50
5069(P)/21 8217 ...................... CHINA, East Coast: Buoy ................................................................................. 50
5084(P)/21 8127 ...................... CHINA, East Coast: Virtual aid to navigation ................................................... 50
5104(P)/21 8217 ...................... CHINA, East Coast: Legend .............................................................................. 50
5177(P)/21 8152, 8153 ........... CHINA, Yellow Sea Coast: Virtual aids to navigation ...................................... 52
5203(P)/21 3378 ...................... CHINA, Bo Hai: Depths; Light ......................................................................... 52
5206(P)/21 8216 ...................... CHINA, East Coast: Fairways; Bridges; Depths; Submarine pipelines ............ 50
5247(T)/21 1379 ...................... MALAYSIA, Peninsular Malaysia, East Coast: Buoy....................................... 47
5314(T)/21 1134, 1306............ CHINA, East Coast: Buoyage; Virtual aid to navigation; Wreck ...................... 50
5350(P)/21 1126, 8218............ CHINA, East Coast: Overhead cable; Safe vertical clearance........................... 50
5358(P)/21 1283 ...................... CHINA, East Coast: Depths; Anchorage area; Spoil ground; Vessel traffic 52
service; Drying patch; Drying contour...............................................................
5443(P)/21 1716 ...................... CHINA, South Coast: Anchorage areas; Pilot boarding place........................... 50
5458(P)/21 1249, 1250 ........... CHINA, Bo Hai: Anchorage areas ..................................................................... 52
5461(P)/21 94 .......................... SOUTH CHINA SEA: Submarine cables; Depth .............................................. 47
5499(T)/21 2619 ...................... TAIWAN: Buoy.................................................................................................. 50
76(P)/22 3695 ...................... CHINA, Yellow Sea Coast: Depths; Obstruction............................................... 52
166(P)/22 1761 ...................... TAIWAN STRAIT: Restricted areas .................................................................. 50
238(P)/22 1286, 1287 ........... CHINA, Bo Hai: Buoyage; Channel .................................................................. 52
246(P)/22 1721 ...................... CHINA, East Coast: Buoyage; Radar beacon; Virtual aid to navigation........... 50
266(P)/22 2665 ...................... CHINA, Bo Hai: Lights; Buoyage; Light-beacons ............................................ 52
288(P)/22 1537 ...................... CHINA, South Coast: Buoyage ......................................................................... 47
355(P)/22 1720 ...................... CHINA, East Coast: Buoyage; Virtual aid to navigation................................... 50
356(P)/22 1130, 1199, 1304. CHINA, East Coast: Wreck................................................................................ 50
357(P)/22 2400 ...................... CHINA, East Coast: Buoyage............................................................................ 50
15. JAPAN
2962(T)/07 JP 1087................... JAPAN, Honshū: Depths.................................................................................... 53
3852(T)/07 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
2050(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
2051(T)/09 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
2667(T)/09 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3043(T)/09 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3781(T)/09 2024, JP 226.......... JAPAN, Nansei Shotō: Depth; Rock.................................................................. 53
4060(T)/09 JP 107..................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
4209(T)/09 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
4523(T)/09 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5182(T)/09 JP 1062, JP 1067 .... JAPAN, Honshū: Depths.................................................................................... 53
5469(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
6128(T)/09 JP 213, JP 1222 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
803(T)/10 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2781(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
3116(T)/10 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
3611(T)/10 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 1228...................
5507(T)/10 JP 213..................... JAPAN, Kyūshū: Rock....................................................................................... 53
6140(T)/10 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
526(T)/11 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
785(T)/11 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1A.24
Wk04/22
IA
15. JAPAN - continued
1866(T)/11 JP 104, JP 132 ........ JAPAN, Seto Naikai: Depth ............................................................................... 54
2285(T)/11 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
3253(T)/11 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
4930(T)/11 JP 131..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4931(T)/11 JP 106, JP 131 ........ JAPAN, Seto Naikai: Wreck .............................................................................. 54
5883(T)/11 JP 137A.................. JAPAN, Seto Naikai: Depth ............................................................................... 54
538(T)/12 JP 131..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
640(T)/12 JP 106, JP 137A, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 153.....................
2143(T)/12 JP 1106................... JAPAN, Seto Naikai: Drying patch.................................................................... 54
3857(T)/12 JP 132..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
5197(T)/12 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
5697(T)/12 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
58(T)/13 JP 87....................... JAPAN, Honshū: Depths.................................................................................... 53
1029(T)/13 JP 187..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1909(T)/13 JP 137A.................. JAPAN, Seto Naikai: Rock ................................................................................ 54
2368(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2692(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
2831(T)/13 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
2832(T)/13 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
3137(T)/13 JP 106, JP 150A, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 150C ..................
3833(T)/13 JP 151, JP 1102 ...... JAPAN, Shikoku: Depths ................................................................................... 53, 54
3834(T)/13 JP 198, JP 1228 ...... JAPAN, Kyūshū: Depth ..................................................................................... 53
3835(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4132(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
4133(T)/13 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
5219(T)/13 JP 137A, JP 153 ..... JAPAN, Seto Naikai: Depth ............................................................................... 54
196(T)/14 996, 1648, JP 77, JAPAN, Seto Naikai: Wreck .............................................................................. 53, 54
JP 150C ..................
2751(T)/14 JP 179..................... JAPAN, Honshū: Depths.................................................................................... 53
2916(T)/14 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depth ............................................................................... 54
3693(T)/14 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
4183(T)/14 JP 1102................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4687(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
4805(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
4963(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5209(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depth ..................................................................................... 53
5210(T)/14 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
5470(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
5725(T)/14 JP 90....................... JAPAN, Honshū: Depths.................................................................................... 53
5727(T)/14 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
33(T)/15 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
968(T)/15 JP 80....................... JAPAN, Honshū: Depth ..................................................................................... 53
1444(T)/15 JP 151, JP 1102 ...... JAPAN, Seto Naikai: Depths ............................................................................. 53, 54
1698(T)/15 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
2493(T)/15 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
3163(T)/15 JP 108..................... JAPAN, Shikoku: Depth .................................................................................... 53
3298(T)/15 JP 54....................... JAPAN, Honshū: Depth ..................................................................................... 55
3552(T)/15 JP 179, JP 187, JAPAN, Kyūshū: Obstruction ............................................................................ 53
JP 1228...................
3553(T)/15 JP 179, JP 198 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
3684(T)/15 JP 1051................... JAPAN, Honshū: Depth ..................................................................................... 53
3685(T)/15 JP 1053................... JAPAN, Honshū: Depth ..................................................................................... 53
3806(T)/15 JP 93, JP 1051 ........ JAPAN, Honshū: Depth ..................................................................................... 53
3929(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
3930(T)/15 JP 1051, JP 1053 .... JAPAN, Honshū: Depths.................................................................................... 53
1A.25
Wk04/22
IA
15. JAPAN - continued
4168(T)/15 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
4924(T)/15 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
1638(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1773(T)/16 JP 1102................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2485(T)/16 JP 142..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2705(T)/16 JP 93, JP 1051 ........ JAPAN, Honshū: Depths.................................................................................... 53
3085(T)/16 JP 1098................... JAPAN, Honshū: Depths.................................................................................... 55
3157(T)/16 JP 141, JP 142 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
3160(T)/16 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3282(T)/16 JP 131, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4045(T)/16 JP 1192................... JAPAN, Honshū: Obstruction ............................................................................ 55
5126(T)/16 JP 187, JP 213 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
5264(T)/16 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
6268(T)/16 JP 179, JP 187 ........ JAPAN, Kyūshū: Depth ..................................................................................... 53
431(T)/17 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
435(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
782(T)/17 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
784(T)/17 JP 187..................... JAPAN, Kyūshū: Wreck..................................................................................... 53
899(T)/17 JP 79....................... JAPAN, Honshū: Obstruction ............................................................................ 55
1155(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1395(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
1396(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1509(T)/17 JP 198..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1626(T)/17 JP 107..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1627(T)/17 JP 141..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1907(T)/17 JP 93....................... JAPAN, Honshū: Depths.................................................................................... 53
2047(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2048(T)/17 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
2162(T)/17 JP 79....................... JAPAN, Honshū: Islets....................................................................................... 55
2444(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
3351(T)/17 JP 137B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3465(T)/17 JP 201, JP 1228 ...... JAPAN, Kyūshū: Depths.................................................................................... 53
3957(T)/17 JP 1051, JP 1052 .... JAPAN, Honshū: Depths.................................................................................... 53
3958(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Depths.................................................................................... 53
JP 213.....................
4214(T)/17 JP 187, JP 213, JAPAN, Kyūshū: Depth ..................................................................................... 53
JP 1222...................
4358(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
4482(T)/17 JP 179, JP 187, JAPAN, Kyūshū: Wreck..................................................................................... 53
JP 198, JP 213 ........
4847(T)/17 JP 106, JP 150A ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
4953(T)/17 JP 1052................... JAPAN, Honshū: Depths.................................................................................... 53
5216(T)/17 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053...................
5218(T)/17 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
5220(T)/17 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
5941(T)/17 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
6023(T)/17 JP 54....................... JAPAN, Honshū: Depths.................................................................................... 55
144(T)/18 JP 90....................... JAPAN, Honshū: Depth ..................................................................................... 53
768(T)/18 JP 63....................... JAPAN, Honshū: Obstructions........................................................................... 55
856(T)/18 JP 1062................... JAPAN, Honshū: Depths.................................................................................... 53
1083(T)/18 JP 79....................... JAPAN, Honshū: Obstructions........................................................................... 55
1507(T)/18 JP 1101, JP 1102 .... JAPAN, Seto Naikai: Obstructions .................................................................... 54
1609(T)/18 JP 1051, JP 1052, JAPAN, Honshū: Depths.................................................................................... 53
JP 1053, JP 1064 ....
1613(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1614(T)/18 JP 151..................... JAPAN, Kyūshū: Depths.................................................................................... 53
1A.26
Wk04/22
IA
15. JAPAN - continued
1615(T)/18 JP 151..................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1694(T)/18 JP 1103................... JAPAN, Seto Naikai: Depths ............................................................................. 54
3153(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
3420(T)/18 JP 1086................... JAPAN, Honshū: Depths.................................................................................... 53
4747(T)/18 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5095(T)/18 JP 70, JP 1051, JAPAN, Honshū: Depths.................................................................................... 53
JP 1052, JP 1053,
JP 1064...................
5368(T)/18 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Depths ............................................................................. 54
5484(T)/18 JP 1112A ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
5485(T)/18 JP 1112A, JP 1112B JAPAN, Seto Naikai: Depths ............................................................................. 54
5486(T)/18 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
5699(T)/18 JP 149..................... JAPAN, Honshū: Fish trap ................................................................................. 55
5701(T)/18 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
559(T)/19 JP 104, JP 153, JAPAN, Seto Naikai: Depth ............................................................................... 54
JP 1108...................
859(T)/19 JP 139..................... JAPAN, Honshū: Depth ..................................................................................... 55
1012(T)/19 JP 1055A................ JAPAN, Honshū: Depths.................................................................................... 53
1355(T)/19 JP 226..................... JAPAN, Nansei Shotō: Depth ............................................................................ 53
2273(T)/19 JP 1107................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2410(T)/19 JP 1206................... JAPAN, Nansei Shotō: Depths........................................................................... 53
2649(T)/19 JP 112..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2796(T)/19 JP 112..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2891(T)/19 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
3066(T)/19 JP 94....................... JAPAN, Honshū: Depths.................................................................................... 53
3255(T)/19 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
3327(T)/19 JP 107..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
5880(T)/19 JP 226..................... JAPAN, Nansei Shotō: Depths........................................................................... 53
6045(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
6048(T)/19 JP 150A.................. JAPAN: Depths .................................................................................................. 54
6114(T)/19 JP 1192................... JAPAN, Honshū: Depths.................................................................................... 55
6136(T)/19 JP 31....................... JAPAN, Hokkaidō: Depths ................................................................................ 55
6287(T)/19 JP 1088................... JAPAN, Honshū: Depths.................................................................................... 53
38(T)/20 JP 123..................... JAPAN, Seto Naikai: Obstruction ...................................................................... 54
318(T)/20 JP 70, JP 1051, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1052...................
602(T)/20 JP 66....................... JAPAN, Honshū: Depths.................................................................................... 53
1649(T)/20 JP 135, JP 1262, JAPAN, Seto Naikai: Works; Vertical clearance ................................................ 54
JP 1263...................
1786(T)/20 JP 190, JP 1227 ...... JAPAN, Kyūshū: Drying heights ....................................................................... 53
2204(T)/20 JP 1030, JP 1034, JAPAN, Hokkaidō: Obstruction......................................................................... 55
JP 1036...................
2699(T)/20 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2940(T)/20 JP 1109................... JAPAN, Seto Naikai: Depth ............................................................................... 54
3744(T)/20 JP 1056................... JAPAN, Honshū: Depths.................................................................................... 53
3947(T)/20 JP 94....................... JAPAN, Honshū: Depths.................................................................................... 53
4077(T)/20 JP 1141................... JAPAN, Seto Naikai: Depths ............................................................................. 54
4185(T)/20 JP 150A, JP 1103, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1141...................
4436(T)/20 JP 1102, JP 1108 .... JAPAN, Seto Naikai: Depths ............................................................................. 54
4529(T)/20 JP 1195................... JAPAN, Honshū: Buoy ...................................................................................... 55
4718(T)/20 JP 67, JP 1061, JAPAN, Honshū: Depths.................................................................................... 53
JP 1062...................
4823(T)/20 JP 67....................... JAPAN, Honshū: Depth ..................................................................................... 53
4914(T)/20 JP 1112A ................ JAPAN, Seto Naikai: Depth ............................................................................... 54
5074(T)/20 JP 90, JP 1062, JAPAN, Honshū: Obstruction ............................................................................ 53
JP 1081, JP 1085 ....
1A.27
Wk04/22
IA
15. JAPAN - continued
5263(T)/20 JP 1088................... JAPAN, Honshū: Depth ..................................................................................... 53
5423(T)/20 JP 1049................... JAPAN, Honshū: Obstruction ............................................................................ 53
5530(T)/20 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
5533(T)/20 JP 66....................... JAPAN, Honshū: Depths.................................................................................... 53
6001(T)/20 JP 91....................... JAPAN, Honshū: Depths.................................................................................... 53
6003(T)/20 JP 1107................... JAPAN, Seto Naikai: Depths ............................................................................. 54
6121(T)/20 JP 106..................... JAPAN, Seto Naikai: Rock ................................................................................ 54
6122(T)/20 JP 106, JP 137A, JAPAN, Seto Naikai: Rocks............................................................................... 54
JP 153.....................
370(T)/21 JP 1155B ................ JAPAN, Honshū: Obstruction ............................................................................ 55
372(T)/21 JP 101A.................. JAPAN, Seto Naikai: Works............................................................................... 54
374(T)/21 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
847(T)/21 JP 1155A ................ JAPAN, Honshū: Depths.................................................................................... 55
974(T)/21 JP 63....................... JAPAN, Honshū: Depth ..................................................................................... 55
976(T)/21 JP 106, JP 107, JAPAN, Seto Naikai: Obstructions; Fish havens ............................................... 54
JP 131, JP 150A .....
1069(T)/21 JP 79....................... JAPAN, Honshū: Depth ..................................................................................... 55
1073(T)/21 JP 187, JP 213 ........ JAPAN, Kyūshū: Offshore installation; Obstruction; Submarine power cables 53
1170(T)/21 JP 134B .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
1171(T)/21 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1172(T)/21 JP 187, JP 213 ........ JAPAN, Kyūshū: Depths.................................................................................... 53
1447(T)/21 JP 1052, JP 1057A, JAPAN, Honshū: Depths.................................................................................... 53
JP 1057B ................
1541(T)/21 JP 1180................... JAPAN, Honshū: Depths.................................................................................... 55
1542(T)/21 JP 1197................... JAPAN, Honshū: Depths.................................................................................... 55
1543(T)/21 JP 123, JP 1103 ...... JAPAN, Seto Naikai: Restricted area ................................................................. 54
1544(T)/21 JP 104, JP 141 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
1636(T)/21 JP 149..................... JAPAN, Honshū: Works..................................................................................... 55
1637(T)/21 JP 148, JP 1192 ...... JAPAN, Honshū: Wind turbine; Works.............................................................. 55
1639(T)/21 JP 107..................... JAPAN, Seto Naikai: Obstruction; Depth .......................................................... 54
1641(T)/21 JP 129..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
1740(T)/21 JP 1197................... JAPAN, Honshū: Fish traps ............................................................................... 55
1743(T)/21 JP 1088................... JAPAN, Honshū: Depths; Obstruction............................................................... 53
1745(T)/21 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
1747(T)/21 JP 127, JP 129 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
1748(T)/21 JP 1227................... JAPAN, Kyūshū: Depth ..................................................................................... 53
1749(T)/21 JP 214A, JP 214B... JAPAN, Kyūshū: Depth ..................................................................................... 53
1850(T)/21 JP 1172................... JAPAN, Honshū: Obstruction ............................................................................ 55
1851(T)/21 JP 150A, JP 1103, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1141...................
1931(T)/21 JP 1049................... JAPAN, Honshū: Depth ..................................................................................... 53
1932(T)/21 JP 1067................... JAPAN, Honshū: Depths.................................................................................... 53
1933(T)/21 JP 67....................... JAPAN, Honshū: Works..................................................................................... 53
2193(T)/21 JP 101A.................. JAPAN, Seto Naikai: Works............................................................................... 54
2194(T)/21 JP 1109................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2195(T)/21 JP 1227................... JAPAN, Kyūshū: Works..................................................................................... 53
2292(T)/21 JP 1137................... JAPAN, Seto Naikai: Works............................................................................... 54
2293(T)/21 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
2367(T)/21 JP 1110 ................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2368(T)/21 JP 123..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
2439(T)/21 1800, 2293, JP 10, JAPAN: Submarine cables; Works..................................................................... 55
JP 1195...................
2440(T)/21 JP 148..................... JAPAN, Honshū: Depths.................................................................................... 55
2442(T)/21 JP 148, JP 1192 ...... JAPAN, Honshū: Breakwater; Works; Restricted area ...................................... 55
2444(P)/21 JP 90, JP 1062, JAPAN, Honshū: Spoil ground .......................................................................... 53
JP 1067, JP 1081 ....
1A.28
Wk04/22
IA
15. JAPAN - continued
2447(T)/21 JP 1101................... JAPAN, Seto Naikai: Depths ............................................................................. 54
2560(T)/21 JP 1127B ................ JAPAN, Seto Naikai: Works............................................................................... 54
2561(T)/21 JP 135, JP 1262, JAPAN, Seto Naikai: Dredged area; Works ....................................................... 54
JP 1263...................
2610(T)/21 JP 104, JP 132, JAPAN, Seto Naikai: Wreck .............................................................................. 54
JP 141, JP 1108 ......
2644(T)/21 1800, 1803, 2293, JAPAN, Hokkaidō: General information ........................................................... 53, 55
4510, 4511, JP 1030,
JP 1032...................
2645(T)/21 JP 1155B ................ JAPAN, Honshū: Depths.................................................................................... 55
2647(T)/21 JP 134B .................. JAPAN, Seto Naikai: Depths; Drying heights ................................................... 54
2732(T)/21 2293, 2347, JP 145 JAPAN, Honshū: Works..................................................................................... 53, 55
2733(T)/21 JP 63....................... JAPAN, Honshū: Works; Submarine pipeline.................................................... 55
2735(T)/21 JP 1137................... JAPAN, Seto Naikai: Works............................................................................... 54
2806(T)/21 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
2807(T)/21 JP 106, JP 150A, JAPAN, Seto Naikai: Obstruction ...................................................................... 54
JP 1103...................
2808(T)/21 JP 106, JP 131 ........ JAPAN, Seto Naikai: Depths ............................................................................. 54
2809(T)/21 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
2810(T)/21 JP 127, JP 128, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1101...................
2909(T)/21 JP 1172................... JAPAN, Honshū: Works..................................................................................... 55
2910(T)/21 JP 1155A ................ JAPAN, Honshū: Works..................................................................................... 55
2912(T)/21 JP 87, JP 90, JP 1061, JAPAN, Honshū: Works..................................................................................... 53
JP 1086...................
2913(T)/21 JP 1057A................ JAPAN, Honshū: Depths.................................................................................... 53
2915(T)/21 JP 137A.................. JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
2916(T)/21 JP 127, JP 128, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1101...................
2917(T)/21 JP 128..................... JAPAN, Seto Naikai: Works............................................................................... 54
3039(T)/21 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
3040(T)/21 JP 1150................... JAPAN, Seto Naikai: Works............................................................................... 54
3041(T)/21 JP 137A, JP 137B, JAPAN, Seto Naikai: Works............................................................................... 54
JP 153.....................
3042(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
3164(T)/21 JP 1055A, JP 1055B JAPAN, Honshū: Obstruction ............................................................................ 53
3207(T)/21 JP 31....................... JAPAN, Hokkaidō: Works.................................................................................. 55
3208(T)/21 JP 31....................... JAPAN, Hokkaidō: Scientific instruments......................................................... 55
3209(T)/21 JP 1162A ................ JAPAN, Honshū: Depths.................................................................................... 55
3210(T)/21 JP 65....................... JAPAN, Honshū: Depths.................................................................................... 55
3212(T)/21 JP 1049................... JAPAN, Honshū: Depths.................................................................................... 53
3215(T)/21 JP 1137................... JAPAN, Seto Naikai: Buoy ................................................................................ 54
3216(T)/21 JP 151..................... JAPAN, Shikoku: Depths ................................................................................... 53
3295(T)/21 JP 1056................... JAPAN, Honshū: Works..................................................................................... 53
3297(T)/21 JP 1055A................ JAPAN, Honshū: Works..................................................................................... 53
3371(T)/21 JP 1085................... JAPAN, Honshū: Obstruction ............................................................................ 53
3373(T)/21 JP 1127B ................ JAPAN, Seto Naikai: Depth ............................................................................... 54
3375(T)/21 JP 127, JP 128, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1101...................
3458(T)/21 JP 137B, JP 153, JAPAN, Seto Naikai: Dredging areas................................................................. 54
JP 1121...................
3549(T)/21 2293, 2347, JP 145 JAPAN, Honshū: Submarine cables; Works ...................................................... 53, 55
3550(T)/21 2293, JP 145.......... JAPAN, Honshū: Submarine cable; Works ........................................................ 55
3551(T)/21 JP 1127B ................ JAPAN, Seto Naikai: Works............................................................................... 54
3552(T)/21 JP 137B, JP 153 ..... JAPAN, Seto Naikai: Works............................................................................... 54
3553(T)/21 JP 1263................... JAPAN, Seto Naikai: Works............................................................................... 54
3554(T)/21 JP 214A, JP 214B... JAPAN, Kyūshū: Works..................................................................................... 53
3663(T)/21 JP 65....................... JAPAN, Honshū: Virtual aid to navigation ........................................................ 55
1A.29
Wk04/22
IA
15. JAPAN - continued
3760(T)/21 JP 1169................... JAPAN, Honshū: Depth ..................................................................................... 55
3761(T)/21 JP 148, JP 1192 ...... JAPAN, Honshū: Submarine cable; Works ........................................................ 55
3762(T)/21 JP 1103, JP 1141 .... JAPAN, Seto Naikai: Works............................................................................... 54
3764(T)/21 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
3765(T)/21 JP 101B .................. JAPAN, Seto Naikai: Works............................................................................... 54
3766(T)/21 JP 1127B ................ JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
3767(T)/21 JP 153, JP 1108 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
3768(T)/21 JP 198, JP 1228 ...... JAPAN, Kyūshū: Works..................................................................................... 53
3869(T)/21 JP 1195................... JAPAN, Honshū: Buoy ...................................................................................... 55
3870(T)/21 JP 1061................... JAPAN, Honshū: Restricted area; Works ........................................................... 53
3871(T)/21 JP 80....................... JAPAN, Honshū: Wreck..................................................................................... 53
3872(T)/21 JP 126..................... JAPAN, Seto Naikai: Pier; Works ...................................................................... 54
3963(T)/21 JP 148..................... JAPAN, Honshū: Works..................................................................................... 55
3965(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4083(T)/21 JP 65....................... JAPAN, Honshū: Fish trap ................................................................................. 55
4084(T)/21 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
4085(T)/21 JP 1049................... JAPAN, Honshū: Works..................................................................................... 53
4087(T)/21 JP 127, JP 128, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1101...................
4215(T)/21 JP 148..................... JAPAN, Honshū: Works..................................................................................... 55
4217(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Dredging area; Works...................................................... 54
4362(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Depths ............................................................................. 54
4363(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4364(T)/21 JP 1227................... JAPAN, Kyūshū: Depth ..................................................................................... 53
4365(T)/21 JP 198, JP 1228 ...... JAPAN, Kyūshū: Works..................................................................................... 53
4366(T)/21 JP 153..................... JAPAN, Seto Naikai: Wreck .............................................................................. 54
4502(T)/21 JP 1103, JP 1141 .... JAPAN, Seto Naikai: Works............................................................................... 54
4503(T)/21 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
4504(T)/21 JP 1120................... JAPAN, Seto Naikai: Drying height .................................................................. 54
4505(T)/21 JP 127, JP 128 ........ JAPAN, Seto Naikai: Depth ............................................................................... 54
4506(T)/21 JP 127, JP 1101 ...... JAPAN, Seto Naikai: Works............................................................................... 54
4507(T)/21 JP 135, JP 1262, JAPAN, Seto Naikai: Works............................................................................... 54
JP 1263...................
4508(T)/21 1648, JP 1220........ JAPAN, Kyūshū: Superbuoy.............................................................................. 53
4636(T)/21 JP 63....................... JAPAN, Honshū: Breakwater; Works ................................................................ 55
4637(T)/21 JP 95, JP 1051 ........ JAPAN, Honshū: Wreck..................................................................................... 53
4638(T)/21 JP 95, JP 1055B ..... JAPAN, Honshū: Obstruction ............................................................................ 53
4639(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
4789(T)/21 JP 64B .................... JAPAN, Honshū: Buoyage ................................................................................. 55
4790(T)/21 JP 1067................... JAPAN, Honshū: Depths.................................................................................... 53
4791(T)/21 JP 127, JP 129 ........ JAPAN, Seto Naikai: Works............................................................................... 54
4904(T)/21 JP 31....................... JAPAN, Hokkaidō: Dredging areas; Works ....................................................... 55
4905(T)/21 JP 11....................... JAPAN, Hokkaidō: Depth .................................................................................. 55
4906(T)/21 JP 63....................... JAPAN, Honshū: Depths; Obstruction............................................................... 55
4907(T)/21 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
4908(T)/21 JP 123..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
5012(T)/21 JP 1055A................ JAPAN, Honshū: Depths.................................................................................... 53
5013(T)/21 JP 131, JP 150A ..... JAPAN, Seto Naikai: Buoyage........................................................................... 54
5014(T)/21 JP 153..................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5015(T)/21 JP 1137................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5016(T)/21 JP 1120................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5017(T)/21 JP 1247A................ JAPAN, Seto Naikai: Obstruction; Light ........................................................... 53
5018(T)/21 1648, JP 1220........ JAPAN, Kyūshū: Buoy ...................................................................................... 53
5139(T)/21 JP 1061, JP 1065 .... JAPAN, Honshū: Works..................................................................................... 53
5140(T)/21 JP 134B .................. JAPAN, Seto Naikai: Works............................................................................... 54
5141(T)/21 JP 1263................... JAPAN, Seto Naikai: Drying patches ................................................................ 54
5265(T)/21 JP 63....................... JAPAN, Honshū: Buoyage ................................................................................. 55
1A.30
Wk04/22
IA
15. JAPAN - continued
5266(T)/21 JP 63....................... JAPAN, Honshū: Works..................................................................................... 55
5267(T)/21 JP 1061................... JAPAN, Honshū: Works; Restricted area ........................................................... 53
5268(T)/21 JP 150C .................. JAPAN, Seto Naikai: Depths ............................................................................. 54
5269(T)/21 JP 126, JP 1106 ...... JAPAN, Seto Naikai: Depth ............................................................................... 54
5401(T)/21 JP 1061, JP 1065 .... JAPAN, Honshū: Light-beacons ........................................................................ 53
5402(T)/21 JP 1103, JP 1141 .... JAPAN, Seto Naikai: Spoil ground; Works........................................................ 54
5403(T)/21 JP 129..................... JAPAN, Seto Naikai: Works............................................................................... 54
5511(T)/21 JP 64A.................... JAPAN, Honshū: Buoy ...................................................................................... 55
5512(T)/21 JP 67....................... JAPAN, Honshū: Obstruction ............................................................................ 53
5513(T)/21 JP 123..................... JAPAN, Seto Naikai: Works............................................................................... 54
5514(T)/21 JP 1137................... JAPAN, Seto Naikai: Depths ............................................................................. 54
5515(T)/21 JP 127, JP 129 ........ JAPAN, Seto Naikai: Works............................................................................... 54
71(T)/22 JP 1150................... JAPAN, Seto Naikai: Depth ............................................................................... 54
72(T)/22 JP 107..................... JAPAN, Seto Naikai: Depth ............................................................................... 54
73(T)/22 JP 135, JP 1262, JAPAN, Seto Naikai: Depths ............................................................................. 54
JP 1263...................
74(T)/22 JP 1227................... JAPAN, Kyūshū: Depths.................................................................................... 53
75(T)/22 JP 190, JP 1227 ...... JAPAN, Kyūshū: Breakwater............................................................................. 53
200(T)/22 JP 1100................... JAPAN, Honshū: Buoyage ................................................................................. 55
201(T)/22 1648, JP 108.......... JAPAN, Shikoku: Buoy...................................................................................... 53
202(T)/22 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
203(T)/22 JP 214A, JP 214B... JAPAN, Kyūshū: Drying heights ....................................................................... 53
204(T)/22 JP 101A, JP 101B... JAPAN, Seto Naikai: Works............................................................................... 54
339(T)/22 JP 1033A, JP 1036 . JAPAN, Hokkaidō: Works.................................................................................. 55
340(T)/22 JP 1162A, JP 1162B JAPAN, Honshū: Buoyage ................................................................................. 55
341(T)/22 JP 1086................... JAPAN, Honshū: Depths.................................................................................... 53
342(T)/22 JP 1083................... JAPAN, Honshū: Depths; Obstructions ............................................................. 53
343(T)/22 1648, JP 77, JP 108 JAPAN, Shikoku: Buoy...................................................................................... 53
344(T)/22 JP 1127B ................ JAPAN, Seto Naikai: Depths ............................................................................. 54
16. KOREA AND THE PACIFIC COASTS OF RUSSIA
2427(T)/13 1802, 1803 ........... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 55
1933(T)/14 1230 ...................... RUSSIA, Pacific Ocean Coast: Wreck............................................................... 56
2746(T)/14 3340 ...................... RUSSIA, Pacific Ocean Coast: Restricted area ................................................. 56
3546(T)/16 2432 ...................... RUSSIA, Pacific Ocean Coast: Mooring buoy .................................................. 56
955(T)/17 4512 ...................... RUSSIA, Pacific Ocean Coast: Obstructions; Area to be avoided .................... 56
1076(T)/18 3041 ...................... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
3252(T)/18 3041 ...................... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
4188(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Restricted areas................................................ 56
4192(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Wrecks ............................................................. 56
4193(T)/18 3044 ...................... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
212(T)/19 2128 ...................... RUSSIA, Pacific Ocean Coast: Buoy ................................................................ 56
867(T)/19 3039 ...................... RUSSIA, Pacific Ocean Coast: Floating dock................................................... 56
2345(T)/19 3044 ...................... RUSSIA, Pacific Ocean Coast: Works............................................................... 56
5767(T)/19 1065 ...................... KOREA, South Coast: Buoy.............................................................................. 52
6063(T)/19 3044 ...................... RUSSIA, Pacific Ocean Coast: Buoyage........................................................... 56
748(P)/20 127, 1065, 1259, KOREA, West Coast: Submarine cable ............................................................. 52, 53
3480, 3666 ...........
5085(T)/20 127, 3365 ............. KOREA, South Coast: Buoy; Automatic Identification System........................ 52, 53
6144(T)/20 127, 2347, 3391, KOREA, South Coast: Buoy.............................................................................. 52, 53
3480 ......................
1188(T)/21 913, 3365, 3480 .. KOREA, West Coast: Light-floats ..................................................................... 52
1259(T)/21 913 ........................ KOREA, West Coast: Buoy ............................................................................... 52
1278(T)/21 3480 ...................... KOREA, West Coast: Buoy ............................................................................... 52
1336(T)/21 127, 1065 ............. KOREA, South Coast: Buoyage ........................................................................ 52, 53
1350(T)/21 127, 3666 ............. KOREA, East Coast: Buoyage........................................................................... 52, 53
1472(T)/21 1258 ...................... KOREA, West Coast: Dredging areas; Works ................................................... 52
1A.31
Wk04/22
IA
16. KOREA AND THE PACIFIC COASTS OF RUSSIA - continued
1879(T)/21 896, 1065 ............. KOREA, East Coast: Buoy ................................................................................ 52
1896(T)/21 3666 ...................... KOREA, East Coast: Buoy ................................................................................ 52
1897(T)/21 1258 ...................... KOREA, West Coast: Buoy ............................................................................... 52
1917(T)/21 127, 3666 ............. KOREA, East Coast: Buoyage........................................................................... 52, 53
1989(T)/21 3365, 3480 ........... KOREA, South Coast: Buoyage ........................................................................ 52
3047(T)/21 913 ........................ KOREA, West Coast: Buoy ............................................................................... 52
3051(T)/21 127, 1065, 1163, KOREA, South Coast: Current meters............................................................... 52, 53
1259, 2347, 3391,
3480, 3666 ...........
3134(T)/21 898 ........................ KOREA, East Coast: Buoyage........................................................................... 52
3984(T)/21 1258 ...................... KOREA, West Coast: Buoy ............................................................................... 52
4166(T)/21 882 ........................ KOREA, East Coast: Buoy ................................................................................ 56
4392(T)/21 1008 ...................... KOREA, West Coast: Buoyage.......................................................................... 52
4521(T)/21 127, 3666 ............. KOREA, South Coast: Buoyage ........................................................................ 52, 53
4675(T)/21 1259 ...................... KOREA, South Coast: Buoyage ........................................................................ 52
4765(T)/21 913, 1256, 3480 .. KOREA, West Coast: Buoyage.......................................................................... 52
5371(T)/21 1259 ...................... KOREA, South Coast: Buoy.............................................................................. 52
5520(T)/21 127, 3480, 3666 .. KOREA, East Coast: Buoyage........................................................................... 52, 53
80(T)/22 913, 1256, 3480 .. KOREA, West Coast: Buoyage.......................................................................... 52
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA
2773(T)/15 1748 ...................... MALAYSIA, Sarawak: Works........................................................................... 48
1103(T)/16 2134 ...................... BRUNEI: Beacon; Buoy .................................................................................... 48
4195(P)/16 1420, 2786 ........... INDONESIA, Molucca Sea: Submarine cables................................................. 58
1256(T)/17 2109 ...................... BRUNEI: Buoy .................................................................................................. 48
3651(P)/17 1293 ...................... INDONESIA, Molucca Sea: Submarine cables................................................. 59
4085(T)/17 2056, 2797, 2862, INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
3729 ......................
4899(T)/17 3931, 3932 ........... PHILIPPINE ISLANDS, Luzon: Buoy.............................................................. 48
711(T)/18 921 ........................ INDONESIA, Jawa: Light-beacon..................................................................... 60
3280(P)/18 3747, 3749 ........... INDONESIA, Papua: Works; Dredging area; Platforms; Submarine pipeline .. 58
4195(T)/18 945, 2796, 2876 .. INDONESIA, Java Sea: Buoy ........................................................................... 60
4332(P)/18 3931, 3932 ........... PHILIPPINE ISLANDS, Luzon: Fish haven..................................................... 48
5227(T)/18 2638, 2893, 2894 INDONESIA, Sulawesi: General information................................................... 58, 59
5672(T)/18 975, 977, 978 ...... INDONESIA, Jawa: Buoy ................................................................................. 60
1489(T)/19 2470, 2797, 2862 INDONESIA, Java Sea: Buoy ........................................................................... 46, 60
1567(T)/19 1338, 2111, 2112. MALAYSIA, Sabah: Buoy ................................................................................ 48
2217(P)/19 1844, 2134 ........... BRUNEI: Works; Lights; Channel; Piles; Restricted areas ............................... 48
2861(T)/19 1338, 2109, 3483, BRUNEI: Scientific instruments........................................................................ 48
3838 ......................
6173(T)/19 1844, 2134 ........... BRUNEI: Buoy; Light-beacons ......................................................................... 48
6188(T)/19 1066, 1312, 2470, INDONESIA, Kalimantan: Wreck..................................................................... 46, 60
2872, 3757, 3758
6398(T)/19 1822 ...................... MALAYSIA, Sarawak: Buoy ............................................................................ 48
950(T)/20 2137, 2873 ........... INDONESIA, Java Sea: Wreck.......................................................................... 46
1276(T)/20 1338, 2109 ........... BRUNEI: Jetty; Works....................................................................................... 48
1543(T)/20 2099 ...................... INDONESIA, Kalimantan: Obstruction ............................................................ 59
1992(T)/20 2473, 2791, 2916, INDONESIA, Banda Sea: Scientific instruments .............................................. 60, 63
4721, Aus 310 .......
2770(P)/20 909, 918 ............... INDONESIA, Jawa: Works; Spoil ground......................................................... 46, 60
2779(T)/20 1338, 2109 ........... BRUNEI: Extraction area; Buoyage .................................................................. 48
3521(T)/20 3482, 3483 ........... MALAYSIA, Sarawak: Offshore installations................................................... 47, 48
3590(P)/20 3484, 3809, 3811, PHILIPPINE ISLANDS, Bohol: Submarine cables .......................................... 48, 58
4416, 4417, 4473
3997(P)/20 3809, 3811............ PHILIPPINE ISLANDS, Sulu Sea: Reef........................................................... 48, 58
4576(T)/20 2134 ...................... BRUNEI: Barge; Lights ..................................................................................... 48
5111(P)/20 2797, 2862 ........... INDONESIA, Jawa: Submarine pipeline; Works; Platform .............................. 46, 60
1A.32
Wk04/22
IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
5550(P)/20 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4414, 4416, 4484,
4485, 4487, 4488,
4489 ......................
5974(P)/20 945, 1066, 2470, INDONESIA, Java Sea: Submarine cables........................................................ 46, 59, 60
2471, 2794, 2795,
2796, 2876, 3029,
3731 ......................
6035(T)/20 3558 ...................... PHILIPPINE ISLANDS, Luzon: Wreck............................................................ 48
6064(P)/20 3426, 3484, 3809, PHILIPPINE ISLANDS, Sulu Sea: Submarine cable........................................ 48, 58
3811, 4416, 4471,
4473 ......................
6142(T)/20 1338, 2109 ........... BRUNEI: Scientific instruments........................................................................ 48
6158(P)/20 3484, 3489, 3809, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
4413, 4414, 4416,
4417, 4477, 4478,
4484, 4489 ...........
6183(T)/20 1844 ...................... BRUNEI: Anchorage area.................................................................................. 48
833(P)/21 3484, 3489, 4413, PHILIPPINE ISLANDS, Luzon: Submarine cables .......................................... 48, 58
4416, 4417, 4485,
4486, 4487 ...........
1434(T)/21 1949 ...................... MALAYSIA, Sarawak: Buoy ............................................................................ 48
1852(P)/21 2797, 2862, 3729 INDONESIA, Jawa: Works; Buoyage ............................................................... 46, 60
2009(P)/21 2134 ...................... BRUNEI: Depths; Dredged areas; Alongside depths......................................... 48
2220(P)/21 2391, 3484, 3489, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3809, 3811, 4413,
4416, 4417, 4471,
4472, 4473, 4477,
4478, 4479, 4480,
4485, 4487, 4488
2239(P)/21 2471, 2639, 2893 INDONESIA, Kalimantan: Works; Platforms; Submarine pipelines ................ 59
2897(P)/21 3558 ...................... PHILIPPINE ISLANDS, Luzon: Development area; Jetty ............................... 48
3101(P)/21 3931, 3932, 4491 PHILIPPINE ISLANDS, Luzon: Works; Reclamation area .............................. 48
3146(P)/21 2795, 2892, 3015, INDONESIA, Kalimantan: Buoyage ................................................................. 59, 60
3017 ......................
3510(P)/21 4416 ...................... PHILIPPINE ISLANDS, Negros: Lights........................................................... 58
3528(P)/21 3484, 3489, 4413, PHILIPPINE ISLANDS: Submarine cable........................................................ 48, 58
4414, 4416, 4484,
4485 ......................
3677(P)/21 1949, 3838 ........... MALAYSIA, Sarawak: Platform; Submarine pipeline...................................... 48
4158(T)/21 3931, 4491 ........... PHILIPPINE ISLANDS, Luzon: Dredging area; Works ................................... 48
4235(P)/21 3729 ...................... INDONESIA, Jawa: Works; Buoyage ............................................................... 46
4356(T)/21 4491 ...................... PHILIPPINE ISLANDS, Luzon: Measuring instruments; Buoyage ................. 48
4404(P)/21 1844, 2134 ........... BRUNEI: Works; Buoyage ................................................................................
48
4413(T)/21 2134 ...................... BRUNEI: Light-beacon; Buoy...........................................................................
48
4497(P)/21 3484, 3489, 4412, PHILIPPINE ISLANDS, Luzon: Submarine cable ........................................... 48, 57, 58,
4413, 4507, 4509 59
4649(T)/21 1312, 2870, 3720, INDONESIA, Kalimantan: Wreck..................................................................... 46, 48
3721 ......................
4827(P)/21 1312, 1336, 2403, MALAYSIA, Sarawak: Submarine cable .......................................................... 45, 46, 47,
2414, 2422, 2436, 48
2470, 2868, 2869,
2870, 3482, 3720,
3831, 3834, 3835,
4042 ......................
1A.33
Wk04/22
IA
17. PHILIPPINE ISLANDS, BORNEO AND INDONESIA EXCEPT SUMATERA - continued
4848(P)/21 967, 3483, 3484, PHILIPPINE ISLANDS: Submarine cables ...................................................... 48, 58
3489, 3809, 3811,
4413, 4414, 4416,
4417, 4472, 4473,
4474, 4482, 4483,
4484, 4485, 4489,
4490 ......................
5077(T)/21 2892 ...................... INDONESIA, Makasar Strait: Buoy.................................................................. 59
5382(P)/21 933, 1066, 2056, INDONESIA, Java Sea: Submarine cable ......................................................... 46, 59, 60
2470, 2471, 2794,
2796, 2797, 2862,
2872, 2873, 2877,
2892, 2893, 3017,
3729 ......................
5427(P)/21 161, 1336, 3835, MALAYSIA, Sarawak: Reef; Works ................................................................. 47, 48
3836 ......................
18. AUSTRALIA AND PAPUA NEW GUINEA
3900(T)/11 Aus 252 .................. AUSTRALIA, Queensland: Depths................................................................... 66
5328(P)/15 Aus 318, Aus 319... AUSTRALIA, Western Australia: Depths ......................................................... 63
3414(T)/16 Aus 242 .................. AUSTRALIA, Queensland: Depth .................................................................... 66
3938(T)/16 Aus 813 .................. AUSTRALIA, New South Wales: Obstructions ................................................ 66
3946(T)/16 Aus 327, Aus 328... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
5541(P)/16 Aus 320, Aus 323... AUSTRALIA, Western Australia: Depths ......................................................... 63
1609(T)/17 Aus 4 ...................... AUSTRALIA, Queensland: Buoy ..................................................................... 63
3039(T)/17 Aus 781 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3041(T)/17 Aus 485, Aus 780... AUSTRALIA, South Australia: Restricted area; Hulk ...................................... 65
3534(P)/17 Aus 821, Aus 824, AUSTRALIA, Queensland: Depths................................................................... 66
Aus 825 ..................
4470(T)/17 Aus 242 .................. AUSTRALIA, Queensland: Restricted area ...................................................... 66
5441(P)/17 Aus 833, Aus 834... AUSTRALIA, Queensland: Depths................................................................... 66
5635(T)/17 Aus 200, Aus 808... AUSTRALIA, New South Wales: Scientific instruments.................................. 65, 66
5857(P)/17 Aus 377 .................. AUSTRALIA, Queensland: Reefs ..................................................................... 66
1358(T)/18 Aus 157 .................. AUSTRALIA, Victoria: Buoyage; Virtual aids to navigation ........................... 65
1601(T)/18 Aus 236 .................. AUSTRALIA, Queensland: Depths................................................................... 66
1802(T)/18 Aus 242 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
3004(T)/18 Aus 235, Aus 236... AUSTRALIA, Queensland: Buoy ..................................................................... 66
3488(T)/18 Aus 235 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3494(T)/18 Aus 236 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
4219(T)/18 Aus 236 .................. AUSTRALIA, Queensland: Depths................................................................... 66
4723(T)/18 4622 ...................... PAPUA NEW GUINEA: Fish traps ................................................................... 67
343(T)/19 Aus 236 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
771(T)/19 Aus 163 .................. AUSTRALIA, Tasmania: Works........................................................................ 65
1191(P)/19 Aus 367, Aus 822... AUSTRALIA, Queensland: Depths................................................................... 66
2363(P)/19 PNG 646 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2533(T)/19 Aus 26 .................... AUSTRALIA, Northern Territory: Scientific instruments ................................ 63
2534(T)/19 Aus 4 ...................... AUSTRALIA, Queensland: Works.................................................................... 63
2626(T)/19 PNG 643 ................ PAPUA NEW GUINEA: Buoy .......................................................................... 67
2783(T)/19 Aus 236 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
3009(T)/19 Aus 303 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
3035(T)/19 Aus 238 .................. AUSTRALIA, Queensland: Buoy; Jetty............................................................ 66
3038(T)/19 Aus 777 .................. AUSTRALIA, South Australia: Works .............................................................. 65
3258(P)/19 Aus 821, Aus 824... AUSTRALIA, Queensland: Depths................................................................... 66
3490(P)/19 Aus 115 .................. AUSTRALIA, Western Australia: Depths ......................................................... 64
3499(T)/19 Aus 4 ...................... AUSTRALIA, Queensland: Scientific instruments ........................................... 63
3507(T)/19 Aus 53 .................... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
4072(T)/19 Aus 4, Aus 301....... AUSTRALIA, Queensland: Tidal gauge; Buoy................................................. 63
4075(T)/19 Aus 831 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
1A.34
Wk04/22
IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
4078(T)/19 Aus 347 .................. AUSTRALIA, South Australia: Wreck.............................................................. 65
4080(T)/19 Aus 140, Aus 348, AUSTRALIA, Victoria: Scientific instruments ................................................. 65
Aus 349 ..................
4833(T)/19 Aus 235, Aus 236... AUSTRALIA, Queensland: Buoy ..................................................................... 66
5106(T)/19 2472, 4721, Aus 312 AUSTRALIA, Western Australia: Tanker mooring buoy; Radar beacon .......... 58, 60, 63
5154(T)/19 Aus 151 .................. AUSTRALIA, Victoria: Depths......................................................................... 65
5893(T)/19 Aus 59 .................... AUSTRALIA, Western Australia: Buoy ............................................................ 63
6087(T)/19 Aus 117 .................. AUSTRALIA, Western Australia: Obstruction; Buoy ....................................... 64
47(P)/20 Aus 255 .................. AUSTRALIA, Queensland: Depth .................................................................... 66
59(T)/20 Aus 55 .................... AUSTRALIA, Western Australia: Measuring instrument ................................. 63
67(T)/20 Aus 57, Aus 327, AUSTRALIA, Western Australia: Obstruction.................................................. 63
Aus 742 ..................
73(P)/20 Aus 332 .................. AUSTRALIA, Western Australia: Depths ......................................................... 64
730(T)/20 Aus 357, Aus 487, AUSTRALIA, Victoria: Buoyage ...................................................................... 65
Aus 802 ..................
1719(T)/20 Aus 754 .................. AUSTRALIA, Western Australia: Scientific instruments.................................. 64
1726(T)/20 Aus 140, Aus 349... AUSTRALIA, Victoria: Scientific instruments ................................................. 65
1733(T)/20 4723, Aus 328 ....... AUSTRALIA, Western Australia: Works .......................................................... 63
1987(T)/20 Aus 200 .................. AUSTRALIA, New South Wales: Light-beacon; Obstructions......................... 65
1988(T)/20 Aus 839 .................. AUSTRALIA, Queensland: Scientific instruments ........................................... 66
2224(P)/20 PNG 554, PNG 680 PAPUA NEW GUINEA: Depths ....................................................................... 67
2227(P)/20 PNG 512 ................ PAPUA NEW GUINEA: Depths ....................................................................... 67
2288(P)/20 Aus 130, Aus 781... AUSTRALIA, South Australia: Works; Light-beacons; Automatic 65
Identification Systems; Virtual aids to navigation .............................................
2504(T)/20 Aus 238 .................. AUSTRALIA, Queensland: Vertical clearance; Lights ..................................... 66
2506(T)/20 Aus 237 .................. AUSTRALIA, Queensland: Works.................................................................... 66
2711(T)/20 Aus 327, Aus 328... AUSTRALIA, Western Australia: Buoy ............................................................ 63
2722(T)/20 Aus 238 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3384(T)/20 Aus 309, Aus 316, AUSTRALIA, Northern Territory: Obstruction................................................. 63
Aus 722 ..................
3387(T)/20 Aus 143, Aus 158... AUSTRALIA, Victoria: Buoy............................................................................ 65
3428(T)/20 Aus 826, Aus 827... AUSTRALIA, Queensland: Obstruction ........................................................... 66
3575(P)/20 PNG 621 ................ PAPUA NEW GUINEA: Depths ....................................................................... 66
3606(T)/20 Aus 112 .................. AUSTRALIA, Western Australia: Buoyage ...................................................... 64
3609(T)/20 4601, 4602, 4643, AUSTRALIA, New South Wales: Obstructions ................................................ 65, 66, 71
Aus 806, Aus 807,
Aus 808, Aus 809,
Aus 810 ..................
4013(T)/20 Aus 195 .................. AUSTRALIA, New South Wales: Restricted area............................................. 65
4016(T)/20 Aus 814 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
4261(T)/20 Aus 25 .................... AUSTRALIA, Northern Territory: Buoy........................................................... 63
4271(T)/20 Aus 200, Aus 808, AUSTRALIA, New South Wales: Scientific instruments.................................. 65, 66
Aus 809 ..................
4545(T)/20 Aus 798 .................. AUSTRALIA, Tasmania: Depths ...................................................................... 65
4704(T)/20 Aus 485, Aus 780, AUSTRALIA, South Australia: Tidal gauges .................................................... 65
Aus 781 ..................
4707(T)/20 Aus 163 .................. AUSTRALIA, Tasmania: Works........................................................................ 65
5474(T)/20 Aus 249 .................. AUSTRALIA, Queensland: Scientific instrument; Buoy.................................. 66
5476(T)/20 Aus 813, Aus 814... AUSTRALIA, New South Wales: Works .......................................................... 66
5545(T)/20 4620, 4621, 4622, PAPUA NEW GUINEA: Fish traps ................................................................... 66, 67
PNG 386, PNG 521,
PNG 522, PNG 523
5705(T)/20 Aus 25, Aus 26....... AUSTRALIA, Northern Territory: Works; Buoyage; Restricted area............... 63
5706(T)/20 Aus 777 .................. AUSTRALIA, South Australia: Works; Pipe; Lights ........................................ 65
5710(T)/20 Aus 754 .................. AUSTRALIA, Western Australia: Scientific instrument ................................... 64
5911(T)/20 Aus 309, Aus 722... AUSTRALIA, Northern Territory: Buoyage ..................................................... 63
5914(T)/20 Aus 357, Aus 802... AUSTRALIA, Victoria: Scientific instruments ................................................. 65
6205(T)/20 Aus 256 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
1A.35
Wk04/22
IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
6208(T)/20 Aus 796 .................. AUSTRALIA, Tasmania: Wreck ....................................................................... 65
6230(T)/20 Aus 237, Aus 238... AUSTRALIA, Queensland: Dredging area; Buoyage; Works........................... 66
6232(T)/20 Aus 806, Aus 807... AUSTRALIA, New South Wales: Scientific instruments.................................. 65
87(T)/21 Aus 57, Aus 327, AUSTRALIA, Western Australia: Scientific instrument ................................... 63
Aus 742 ..................
457(T)/21 Aus 235, Aus 236... AUSTRALIA, Queensland: Light; Buoy........................................................... 66
469(T)/21 Aus 301 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 63
475(T)/21 Aus 252, Aus 824... AUSTRALIA, Queensland: Buoy ..................................................................... 66
481(T)/21 Aus 143, Aus 155, AUSTRALIA, Victoria: Buoyage ...................................................................... 65
Aus 157, Aus 158...
710(T)/21 Aus 245 .................. AUSTRALIA, Queensland: Works.................................................................... 66
719(T)/21 Aus 200 .................. AUSTRALIA, New South Wales: Works .......................................................... 65
720(T)/21 Aus 245 .................. AUSTRALIA, Queensland: Buoyage ................................................................ 66
725(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Light; Buoy........................................................... 66
929(T)/21 Aus 781 .................. AUSTRALIA, South Australia: Fish haven; Buoy ............................................ 65
1106(T)/21 Aus 252, Aus 824... AUSTRALIA, Queensland: Buoy ..................................................................... 66
1341(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
1508(T)/21 Aus 256 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
1509(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Wreck.................................................................... 66
1510(T)/21 Aus 799 .................. AUSTRALIA, Tasmania: Buoy ......................................................................... 65
1768(T)/21 Aus 754 .................. AUSTRALIA, Western Australia: Reef; Works................................................. 64
1919(P)/21 Aus 841 .................. AUSTRALIA, Queensland: Depths................................................................... 66
1942(T)/21 Aus 839, Aus 841... AUSTRALIA, Queensland: Wreck.................................................................... 66
1943(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Wreck; Buoy......................................................... 66
1948(T)/21 Aus 157 .................. AUSTRALIA, Victoria: Scientific instruments ................................................. 65
2134(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Obstruction ........................................................... 66
2136(T)/21 Aus 256 .................. AUSTRALIA, Queensland: Works; Light-beacons; Virtual aids to navigation; 66
Light ...................................................................................................................
2138(T)/21 Aus 140 .................. AUSTRALIA, Victoria: Depth .......................................................................... 65
2348(T)/21 Aus 813, Aus 814... AUSTRALIA, Queensland: Scientific instrument............................................. 66
2350(T)/21 Aus 143, Aus 144, AUSTRALIA, Victoria: Depths; Virtual aids to navigation .............................. 65
Aus 158, Aus 788...
2528(T)/21 Aus 799 .................. AUSTRALIA, Tasmania: Scientific instrument; Buoy...................................... 65
2530(P)/21 Aus 341, Aus 342, AUSTRALIA, South Australia: Islets................................................................ 65
Aus 343 ..................
2532(T)/21 Aus 143 .................. AUSTRALIA, Victoria: Depth; Virtual aid to navigation ................................. 65
2534(T)/21 Aus 242 .................. AUSTRALIA, Queensland: Harbour developments.......................................... 66
2704(T)/21 Aus 64, Aus 743..... AUSTRALIA, Western Australia: Buoy ............................................................ 63
2705(T)/21 Aus 200 .................. AUSTRALIA, New South Wales: Buoyage ...................................................... 65
2706(T)/21 Aus 238 .................. AUSTRALIA, Queensland: Works; Buoyage; Lights; Piles ............................. 66
2743(T)/21 Aus 144 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
2862(T)/21 Aus 112, Aus 754... AUSTRALIA, Western Australia: Works .......................................................... 64
3123(T)/21 Aus 151 .................. AUSTRALIA, Victoria: Restricted area; Buoyage ............................................ 65
3124(T)/21 Aus 235, Aus 236, AUSTRALIA, Queensland: Obstruction ........................................................... 66
Aus 814, Aus 815...
3125(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Restricted area ...................................................... 66
3133(T)/21 Aus 143, Aus 144... AUSTRALIA, Victoria: Works .......................................................................... 65
3137(T)/21 Aus 195 .................. AUSTRALIA, New South Wales: Works; Buoyage .......................................... 65
3142(T)/21 Aus 120, Aus 341... AUSTRALIA, South Australia: Works .............................................................. 65
3147(T)/21 Aus 814 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
3306(T)/21 4644, Aus 766 ....... AUSTRALIA, Tasmania: Scientific instruments............................................... 65
3310(T)/21 Aus 64, Aus 328, AUSTRALIA, Western Australia: Scientific instrument ................................... 63
Aus 743 ..................
3314(T)/21 Aus 236 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
3437(T)/21 Aus 167 .................. AUSTRALIA, Tasmania: Works........................................................................ 65
3438(T)/21 Aus 256, Aus 827... AUSTRALIA, Queensland: Works; Buoyage.................................................... 66
3445(T)/21 Aus 755 .................. AUSTRALIA, Western Australia: Scientific instruments.................................. 64
1A.36
Wk04/22
IA
18. AUSTRALIA AND PAPUA NEW GUINEA - continued
3447(T)/21 Aus 200 .................. AUSTRALIA, New South Wales: Works .......................................................... 65
3642(T)/21 Aus 816 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3645(T)/21 Aus 814 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
3646(T)/21 Aus 256, Aus 827... AUSTRALIA, Queensland: Buoyage ................................................................ 66
3647(T)/21 Aus 15, Aus 715..... AUSTRALIA, Northern Territory: Buoy........................................................... 63, 66
3648(T)/21 Aus 130, Aus 780, AUSTRALIA, South Australia: Buoyage .......................................................... 65
Aus 781 ..................
3830(P)/21 Aus 255 .................. AUSTRALIA, Queensland: Virtual aids to navigation; Light........................... 66
3832(T)/21 Aus 81 .................... AUSTRALIA, Western Australia: Buoy; Depths............................................... 64
3833(T)/21 Aus 377, Aus 840, PAPUA NEW GUINEA: Scientific instruments................................................ 66
Aus 841 ..................
4335(T)/21 Aus 245 .................. AUSTRALIA, Queensland: Scientific instruments; Buoyage........................... 66
4619(T)/21 Aus 813 .................. AUSTRALIA, New South Wales: Buoy............................................................ 66
4916(T)/21 Aus 830 .................. AUSTRALIA, Queensland: Buoy ..................................................................... 66
4919(T)/21 Aus 143, Aus 144... AUSTRALIA, Victoria: Depths; Virtual aids to navigation .............................. 65
5113(T)/21 Aus 53, Aus 326..... AUSTRALIA, Western Australia: Obstruction.................................................. 63
5114(T)/21 Aus 840, Aus 841... PAPUA NEW GUINEA: Depths ....................................................................... 66
5117(P)/21 Aus 349, Aus 487... AUSTRALIA, Victoria: Depths......................................................................... 65
5120(T)/21 Aus 249, Aus 250, AUSTRALIA, Queensland: Restricted area ...................................................... 66
Aus 823 ..................
5124(T)/21 4601, 4644, AUSTRALIA, Victoria: Scientific instruments ................................................. 65, 71
Aus 357, Aus 487,
Aus 802 ..................
5126(P)/21 Aus 320 .................. AUSTRALIA, Western Australia: Depths ......................................................... 63
5128(T)/21 Aus 155 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
5130(T)/21 4723, Aus 328 ....... AUSTRALIA, Western Australia: Scientific instruments.................................. 63
5373(T)/21 Aus 167 .................. AUSTRALIA, Tasmania: Works; Buoyage ....................................................... 65
5378(T)/21 Aus 839 .................. AUSTRALIA, Queensland: Scientific instrument............................................. 66
122(T)/22 Aus 807 .................. AUSTRALIA, New South Wales: Works .......................................................... 65
129(T)/22 Aus 251, Aus 824... AUSTRALIA, Queensland: Buoy ..................................................................... 66
132(P)/22 Aus 320, Aus 323... AUSTRALIA, Western Australia: Depths ......................................................... 63
133(T)/22 Aus 801 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
134(T)/22 Aus 143, Aus 157... AUSTRALIA, Victoria: Area to be avoided; Buoyage...................................... 65
135(T)/22 Aus 64, Aus 743..... AUSTRALIA, Western Australia: Scientific instrument ................................... 63
136(T)/22 Aus 144 .................. AUSTRALIA, Victoria: Buoy............................................................................ 65
19. NEW ZEALAND
1295(P)/21 NZ 5612 ................. NEW ZEALAND, North Island: Works; Barge; Depth; Light-beacon ............. 71
3236(P)/21 NZ 4432 ................. NEW ZEALAND, North Island: Rocks............................................................. 71
4281(T)/21 NZ 661 ................... NEW ZEALAND, South Island: Scientific instruments; Buoyage ................... 72
5332(T)/21 NZ 5215 ................. NEW ZEALAND, North Island: Buoy .............................................................. 71
20. PACIFIC OCEAN
3021(T)/12 4621, 4623, 4634 SOUTH PACIFIC OCEAN: Fish havens........................................................... 66, 68
679(T)/14 1494, 1570, 1576 SOUTH PACIFIC OCEAN, Vanuatu: Buoyage ................................................ 68
681(T)/14 2462, 2463 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Scientific instruments ........ 68
249(T)/17 1436 ...................... SOUTH PACIFIC OCEAN, Polynésie Française: Marine farms; Buoyage...... 73
4785(T)/17 1494 ...................... SOUTH PACIFIC OCEAN, Vanuatu: Buoy...................................................... 68
935(P)/18 SLB 301, SLB 302. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
2427(T)/18 2462, 2463 ........... SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Wreck................................. 68
4792(T)/18 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Beacons ............................................ 70
5448(T)/18 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Wreck ................................. 73
1735(P)/19 1494 ...................... SOUTH PACIFIC OCEAN, Vanuatu: Works; Buoyage .................................... 68
5029(P)/19 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Outfall; Restricted areas..... 73
1A.37
Wk04/22
IA
20. PACIFIC OCEAN - continued
6384(T)/19 761, 4051, 4052, NORTH PACIFIC OCEAN: Data buoys ........................................................... 57, 63, 68,
4060, 4061, 4062, 70, 73, 74,
4506, 4604, 4605, 88, 89
4606, 4607, 4615,
4617, 4618, 4619,
4623, 4624, 4625,
4626, 4629, 4632,
4653, 4802, 4808,
4811.......................
1534(P)/20 SLB 102 ................. SOUTH PACIFIC OCEAN, Solomon Islands: Depths ..................................... 68
1730(P)/20 4622, 4623, 4634, SOUTH PACIFIC OCEAN: Submarine cable................................................... 65, 66, 67,
4635, 4643, 68
Aus 235, Aus 809,
Aus 815, SLB 305..
2089(T)/20 3664 ...................... SOUTH PACIFIC OCEAN, Archipel des Tuamotu: Obstructions.................... 73
2356(T)/20 763, 4506, 4507, NORTH PACIFIC OCEAN: Buoyage ............................................................... 57, 59, 67,
4604, 4622 ........... 68
3066(T)/20 729 ........................ SOUTH PACIFIC OCEAN, Kiribati: Buoy ...................................................... 70
5433(P)/20 2983 ...................... SOUTH PACIFIC OCEAN, Tuvalu: Depths; Drying heights ........................... 70
5982(T)/20 1660, 1670 ........... SOUTH PACIFIC OCEAN, Fiji Islands: Floating dock.................................... 70
156(T)/21 1107....................... SOUTH PACIFIC OCEAN, Polynésie Française: Light-beacon ...................... 73
1040(T)/21 1244 ...................... SOUTH PACIFIC OCEAN, Fiji Islands: Buoy ................................................. 70
2221(T)/21 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Wreck ............................................... 70
2347(T)/21 4601 ...................... SOUTH PACIFIC OCEAN: Buoy..................................................................... 71
2501(P)/21 378 ........................ SOUTH PACIFIC OCEAN, Fiji Islands: Coastline; Marina; Quarantine 70
anchorage ...........................................................................................................
3226(P)/21 2462, 2463, 2464, SOUTH PACIFIC OCEAN, Nouvelle-Calédonie: Submarine power cables .... 68
2465 ......................
3588(P)/21 4634, 4635 ........... SOUTH PACIFIC OCEAN: Marine Reserve; Depths; Wreck .......................... 66, 68
4090(P)/21 1660 ...................... SOUTH PACIFIC OCEAN, Fiji Islands: Works; Jetty; Buoyage ..................... 70
4695(T)/21 3551, 3552, 4509, NORTH PACIFIC OCEAN: Volcanic activity................................................... 53, 57
4510 ......................
4914(T)/21 4604, 4634 ........... CORAL SEA: Buoy ........................................................................................... 68
220(P)/22 4655 ...................... SOUTH PACIFIC OCEAN: Restricted area...................................................... 73
21. ALEUTIAN ISLANDS, ALASKA AND WEST COAST OF NORTH AMERICA INCLUDING MEXICO
706(T)/21 588, 591 ............... UNITED STATES OF AMERICA, West Coast: Disused submarine cable; Foul 89
1375(P)/21 1029, 1049, 2530, UNITED STATES OF AMERICA, West Coast: Works; Submarine cables...... 89
4912 ......................
5181(T)/21 3754, 4801, 4810, CANADA, British Columbia: Restricted area ................................................... 89, 90, 91,
4920, 4975 ........... 92
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA
3467(T)/15 3084 ...................... PERU: Precautionary area.................................................................................. 98
6453(T)/15 656 ........................ MEXICO, Pacific Ocean Coast: Light; Buoy .................................................... 89
720(P)/17 1938 ...................... MEXICO, Pacific Ocean Coast: Works ............................................................. 89
2263(T)/18 1938 ...................... MEXICO, Pacific Ocean Coast: Buoy; Radar beacon....................................... 89
2630(P)/19 1938 ...................... MEXICO, Pacific Ocean Coast: Wreck ............................................................. 89
4504(T)/19 3089 ...................... PERU: Buoyage ................................................................................................. 98
1303(T)/20 3087 ...................... PERU: Buoy....................................................................................................... 98
1792(T)/20 3090 ...................... PERU: Buoy....................................................................................................... 98
5391(P)/20 1946 ...................... EL SALVADOR: Depths; Obstructions; Pilot boarding place; Anchorage area; 89
Buoyage; Lights .................................................................................................
6272(T)/20 2319 ...................... COLOMBIA, Pacific Ocean Coast: Wreck ....................................................... 98
2104(P)/21 1020, 1929, 2496, PANAMA, Pacific Ocean Coast: Submarine cable............................................ 88, 89
4811, CP 5.............
3404(T)/21 4237 ...................... CHILE, Northern Coasts: Wreck ....................................................................... 98
4210(T)/21 1853 ...................... PERU: Buoy....................................................................................................... 98
1A.38
Wk04/22
IA
22. WEST COASTS OF CENTRAL AND SOUTH AMERICA - continued
4593(P)/21 3090, 4217, 4218, CHILE, Northern Coasts: Submarine cable ....................................................... 98
4220 ......................
184(P)/22 3087 ...................... PERU: Anchorage areas ..................................................................................... 98
364(P)/22 8007, CP 5............. PANAMA, Pacific Ocean Coast: Buoyage ........................................................ 88
23. ANTARCTICA
4399(P)/14 1776 ...................... ANTARCTICA: Coastline; Rocks; Depths........................................................ 97
239(P)/22 1775, 1779 ........... ANTARCTICA: Depths ..................................................................................... 97
24. EAST COAST OF SOUTH AMERICA AND THE FALKLAND ISLANDS
1309(T)/13 529, 3971 ............. BRAZIL, South Coast: Mooring buoys ............................................................. 95
469(T)/16 587 ........................ BRAZIL, South Coast: Alongside depths .......................................................... 95
884(T)/16 2506 ...................... SOUTH ATLANTIC OCEAN, Falkland Islands: Light-beacon; Leading line . 96
1015(T)/17 545 ........................ BRAZIL, East Coast: Works; Buoyage.............................................................. 95
606(P)/18 3703 ...................... URUGUAY: Restricted areas ............................................................................. 95
1244(T)/18 579, 589 ............... BRAZIL, South Coast: Buoyage........................................................................ 95
1268(T)/18 3561 ...................... URUGUAY: Depths ........................................................................................... 95
2509(T)/18 566 ........................ BRAZIL, South Coast: Obstruction................................................................... 95
3315(T)/18 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
3655(P)/18 329, 330, 331, 520, BRAZIL, North Coast: Lights; Radar beacon; Automatic Identification 95
2204, 3959 ........... Systems; Buoyage; Virtual aids to navigation....................................................
3679(P)/18 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
4956(P)/18 566 ........................ BRAZIL, South Coast: Obstructions ................................................................. 95
393(T)/19 2001 ...................... URUGUAY: Works; Buoyage; Restricted area.................................................. 95
961(T)/19 545 ........................ BRAZIL, East Coast: Buoy................................................................................ 95
1144(P)/19 29 .......................... BRAZIL, South Coast: Obstructions ................................................................. 95
2025(T)/19 2189 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
2578(P)/19 566 ........................ BRAZIL, South Coast: Wreck ........................................................................... 95
2582(P)/19 495 ........................ BRAZIL, East Coast: Obstructions.................................................................... 95
4952(T)/19 2012, 3984 ........... BRAZIL, South Coast: Buoy ............................................................................. 95
72(P)/20 2189 ...................... BRAZIL, East Coast: Depths ............................................................................. 95
1232(P)/20 540, 545 ............... BRAZIL, East Coast: Virtual aids to navigation................................................ 95
3079(T)/20 540, 545 ............... BRAZIL, East Coast: Buoy................................................................................ 95
3246(P)/20 1328 ...................... ARGENTINA: Channel limit ............................................................................ 95
4053(P)/20 29 .......................... BRAZIL, South Coast: Obstruction................................................................... 95
5654(P)/20 29, 191, 3980 ...... BRAZIL, South Coast: Anchorage areas; Spoil ground .................................... 95
214(P)/21 579 ........................ BRAZIL, South Coast: Buoyage........................................................................ 95
360(P)/21 541 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
1914(P)/21 29 .......................... BRAZIL, South Coast: Alongside depths .......................................................... 95
1995(P)/21 2189 ...................... BRAZIL, East Coast: Drying heights; Depths................................................... 95
3186(P)/21 331 ........................ BRAZIL, North Coast: Wreck ........................................................................... 95
3235(T)/21 2001 ...................... URUGUAY: Mooring buoys.............................................................................. 95
3563(P)/21 3982 ...................... BRAZIL, South Coast: Spoil ground ................................................................. 95
4308(P)/21 566 ........................ BRAZIL, South Coast: Depth ............................................................................ 95
4668(P)/21 331 ........................ BRAZIL, North Coast: Depths .......................................................................... 95
4697(P)/21 579, 589 ............... BRAZIL, South Coast: Depth ............................................................................ 95
4821(T)/21 534 ........................ ARGENTINA: Buoy.......................................................................................... 96
4823(T)/21 555 ........................ BRAZIL, South Coast: Depths .......................................................................... 95
4847(T)/21 3974 ...................... BRAZIL, East Coast: Wreck.............................................................................. 95
4856(T)/21 331 ........................ BRAZIL, North Coast: Works............................................................................ 95
235(P)/22 520, 2189, 3959, BRAZIL, North Coast: Depths .......................................................................... 95
3962 ......................
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO
1527(T)/15 1278, 2262 ........... COLOMBIA, Caribbean Sea Coast: Obstruction .............................................. 88
2586(T)/16 376, 1307 ............. MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
2769(T)/16 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoyage................................................... 88
4258(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
1A.39
Wk04/22
IA
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
4292(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4293(P)/16 467 ........................ DOMINICAN REPUBLIC: Buoyage................................................................ 86
4666(T)/16 2866, 3910 ........... WEST INDIES, Bahamas: Lights...................................................................... 83
6211(P)/16 465, 466, 3907, HAITI: Depths; Coastline; Lights; Wrecks; Obstructions ................................. 86
3935 ......................
1497(T)/17 1629 ...................... CARIBBEAN SEA: Buoy ................................................................................. 87
3276(T)/17 2766 ...................... SURINAME: Obstruction; Light ....................................................................... 87
1763(T)/18 794 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
2080(T)/18 2006, 2019, 2020 WEST INDIES, Virgin Islands: Buoyage; Wrecks; Obstructions ..................... 86
4628(T)/18 3768 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
4917(T)/18 474 ........................ WEST INDIES, Trinidad and Tobago: Wreck ................................................... 87
5341(P)/18 3768 ...................... MEXICO, Gulf of Mexico: Wreck; Restricted area........................................... 83
5983(T)/18 1307, 2626 ........... MEXICO, Gulf of Campeche: Platform ............................................................ 83
659(P)/19 230, 2191 ............. VENEZUELA: Superbuoy; Submarine pipeline ............................................... 87
949(T)/19 501, 517, 1044, WEST INDIES, Trinidad and Tobago: Platform; Light..................................... 87
1045 ......................
972(T)/19 475 ........................ WEST INDIES, Trinidad and Tobago: Platforms .............................................. 87
1399(T)/19 257, 258, 454, 458, WEST INDIES, Jamaica: Anchorage areas; Anchor berths; Berths; Moorings; 86
459, 464 ............... Piers; Reported anchorages ................................................................................
1895(T)/19 1044, 1045 ........... WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
2745(T)/19 364, 365, 376, 3768 MEXICO, Gulf of Mexico: Obstructions........................................................... 83
3392(T)/19 2753 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
3634(P)/19 2019, 2020 ........... WEST INDIES, Virgin Islands: Depths ............................................................. 86
3977(T)/19 662 ........................ MEXICO, Caribbean Sea Coast: Fish havens.................................................... 85
4086(T)/19 1629 ...................... VENEZUELA: Buoy ......................................................................................... 87
4250(T)/19 3190 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Vertical clearance; Works 83
4909(T)/19 1966, 2191 ........... VENEZUELA: Buoy ......................................................................................... 87
5358(T)/19 2434 ...................... COLOMBIA, Caribbean Sea Coast: Buoy ........................................................ 88
5444(P)/19 359, 1307, 2626 .. MEXICO, Gulf of Campeche: Works; Depths................................................... 83
5925(P)/19 517, 519, 527, 537, GUYANA: Submarine cable .............................................................................. 87
572, 2687 .............
6185(P)/19 1400 ...................... PANAMA, Caribbean Sea Coast: Pier; Buoyage; Dolphin ............................... 88
6350(T)/19 2626 ...................... MEXICO, Gulf of Campeche: Buoyage; Wreck................................................ 83
156(P)/20 1450 ...................... WEST INDIES, Turks and Caicos Islands: Depths; Drying heights; Coral ...... 86
203(T)/20 359 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
207(T)/20 2751 ...................... MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
208(T)/20 375 ........................ MEXICO, Gulf of Mexico: Buoyage................................................................. 83
411(T)/20 474 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
630(P)/20 487, 489, 583, WEST INDIES, Leeward Islands: Lights .......................................................... 86
1025, 2016 ...........
969(P)/20 2005, 2006, 2016, WEST INDIES, Virgin Islands: Depths ............................................................. 86
2019, 2020 ...........
1055(T)/20 2988 ...................... HONDURAS: Buoy........................................................................................... 85
1079(P)/20 2005, 2019 ........... WEST INDIES, Virgin Islands: Wrecks; Marine Reserves ............................... 86
1111(T)/20 2079 ...................... WEST INDIES, Leeward Islands: Works .......................................................... 86
1178(T)/20 2751 ...................... MEXICO, Gulf of Mexico: Platform ................................................................. 83
1186(T)/20 474 ........................ WEST INDIES, Trinidad and Tobago: Buoyage ............................................... 87
1666(T)/20 2765 ...................... SURINAME: Anchorage area............................................................................ 87
1818(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Buoy.................................................................. 83
2058(P)/20 487, 489, 583 ...... WEST INDIES, Leeward Islands: Marine Reserves; Restricted area ............... 86
2211(T)/20 502 ........................ WEST INDIES, Windward Islands: Buoy ......................................................... 87
2849(T)/20 8006, CP 1............. PANAMA, Panama Canal: Buoyage ................................................................. 88
3019(T)/20 2765 ...................... SURINAME: Buoy ............................................................................................ 87
3074(T)/20 2190 ...................... VENEZUELA: Buoy ......................................................................................... 87
3238(T)/20 1628 ...................... VENEZUELA: Buoy ......................................................................................... 87
3403(P)/20 365 ........................ MEXICO, Gulf of Mexico: Works..................................................................... 83
4197(T)/20 618, 804 ............... WEST INDIES, Leeward Islands: Wreck .......................................................... 87
1A.40
Wk04/22
IA
25. CARIBBEAN SEA, WEST INDIES AND THE GULF OF MEXICO - continued
4268(P)/20 583, 1025, 2016, WEST INDIES, Leeward Islands: Depth........................................................... 86
2600 ......................
4952(T)/20 618 ........................ WEST INDIES, Leeward Islands: Buoyage; Dredging area ............................. 87
4958(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Buoy.................................................................. 83
5429(P)/20 8007 ...................... PANAMA, Panama Canal: Maritime limit; Works............................................ 88
5440(P)/20 517, 572 ............... GUYANA: Submarine pipeline.......................................................................... 87
5770(T)/20 481 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
6275(T)/20 2626 ...................... MEXICO, Gulf of Campeche: Wreck................................................................ 83
172(T)/21 2267 ...................... COLOMBIA, Caribbean Sea Coast: Leading lights .......................................... 88
219(T)/21 2751 ...................... MEXICO, Gulf of Mexico: Obstruction ............................................................ 83
234(P)/21 477 ........................ WEST INDIES, Trinidad and Tobago: Works; Submarine pipeline .................. 87
612(T)/21 2434 ...................... COLOMBIA, Caribbean Sea Coast: Anchorage area; Depths........................... 88
794(P)/21 8006 ...................... PANAMA, Panama Canal: Light; Leading lights; Leading line........................ 88
1077(T)/21 474 ........................ WEST INDIES, Trinidad and Tobago: Works; Wrecks ..................................... 87
1087(T)/21 475 ........................ WEST INDIES, Trinidad and Tobago: Buoy..................................................... 87
1222(T)/21 368 ........................ WEST INDIES, Windward Islands: Wreck ....................................................... 87
1390(P)/21 396, 1798 ............. CARIBBEAN SEA: Submarine cables.............................................................. 85, 88
1474(T)/21 375 ........................ MEXICO, Gulf of Mexico: Buoy ...................................................................... 83
1493(T)/21 2765 ...................... SURINAME: Wreck; Buoy................................................................................ 87
1646(P)/21 467 ........................ DOMINICAN REPUBLIC: Port development; Depths .................................... 86
1783(T)/21 596, 597, 791 ...... WEST INDIES, Windward Islands: Restricted area.......................................... 87
1873(P)/21 376, 1307 ............. MEXICO, Caribbean Sea Coast: Buoyage ........................................................ 83
2105(T)/21 368, 494 ............... WEST INDIES, Windward Islands: Wreck ....................................................... 87
2387(T)/21 1798 ...................... COSTA RICA, Caribbean Sea Coast: Wreck; Buoy .......................................... 85
3250(T)/21 517, 2764 ............. SURINAME: Scientific instruments; Buoy ....................................................... 87
3430(P)/21 2079 ...................... WEST INDIES, Leeward Islands: Wrecks; Obstructions; Depths .................... 86
3562(T)/21 2988 ...................... HONDURAS: Buoy........................................................................................... 85
3579(T)/21 583, 1025, 2016, WEST INDIES, Leeward Islands: Wreck .......................................................... 86
2600 ......................
3582(P)/21 2782 ...................... GUYANA: Submarine cables; Works ................................................................ 87
3926(T)/21 461 ........................ WEST INDIES, Bahamas: Light-beacon........................................................... 83
3976(P)/21 697 ........................ WEST INDIES, Windward Islands: Depths ...................................................... 87
4037(T)/21 527, 572 ............... GUYANA: Buoyage........................................................................................... 87
4062(P)/21 500, 1044 ............. WEST INDIES, Trinidad and Tobago: Submarine cable................................... 87
4145(P)/21 517, 572 ............... GUYANA: Submarine cable; Works.................................................................. 87
4253(T)/21 376, 2753 ............. MEXICO, Gulf of Mexico: Buoy; Radar beacon .............................................. 83
4701(P)/21 517, 572 ............... GUYANA: Works............................................................................................... 87
4897(T)/21 2626 ...................... MEXICO, Gulf of Campeche: Buoyage ............................................................ 83
4899(T)/21 2753 ...................... MEXICO, Gulf of Mexico: Buoyage................................................................. 83
4985(P)/21 3384 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Depths; Wrecks; 83
Obstructions; Dredged area; Anchorage area; Lights ........................................
5025(P)/21 CP 2........................ PANAMA, Panama Canal: Depth; Anchorage areas; Buoyage; Wrecks........... 88
5164(T)/21 1307, 2626 ........... MEXICO, Gulf of Campeche: Anchorage area ................................................. 83
5468(P)/21 368 ........................ WEST INDIES, Windward Islands: Buoyage; Lights; Barge; Dolphin; Works 87
286(P)/22 2261 ...................... COLOMBIA, Caribbean Sea Coast: Depths; Buoy........................................... 88
292(P)/22 3384 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Depths; Obstructions; 83
Channels; Channel depth....................................................................................
309(P)/22 3854 ...................... UNITED STATES OF AMERICA, Gulf of Mexico: Maintained channel ........ 83
26. EAST COAST OF NORTH AMERICA AND GREENLAND
2681(P)/16 2490, 4746 ........... UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 80, 81
2682(P)/16 2865, 3691 ........... UNITED STATES OF AMERICA, East Coast: Maritime limit ........................ 81
1397(T)/17 2483 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
1417(T)/17 2732 ...................... UNITED STATES OF AMERICA, East Coast: Buoyage ................................. 81
444(P)/20 2755, 2860 ........... UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
3883(P)/20 2919 ...................... UNITED STATES OF AMERICA, East Coast: Submarine cable..................... 81
2206(T)/21 4777 ...................... CANADA, Saint Lawrence River: Scientific instruments................................. 79
1A.41
Wk04/22
IA
26. EAST COAST OF NORTH AMERICA AND GREENLAND - continued
4017(T)/21 4792 ...................... CANADA, Saint Lawrence River: Works; Mooring ......................................... 79
4162(T)/21 4786 ...................... CANADA, Saint Lawrence River: Quay; Works............................................... 79
5312(P)/21 4754 ...................... CANADA, Nova Scotia: Obstruction; Pier; Mole; Lights................................. 80
5319(P)/21 4769 ...................... CANADA, Gulf of Saint Lawrence: Buoyage................................................... 79
Source: UKHO
1A.42
Wk04/22
II
GEOGRAPHICAL INDEX
2.1
Wk04/22
II
Notice No. Page Admiralty Chart Folio Notice No. Page Admiralty Chart Folio
253 2.33 95 310(T)/22 2.39 6, 7, 13
254 2.34 83 311 2.27 47
255 2.25 47 312(T)/22 2.37 2, 5
256 2.31 59, 60 313* 2.9 2
257 2.35 81 314* 2.10 6
258 2.34 88 315 2.36 81
259 2.14 10 316* 2.16 2, 6, 7
260* 2.6 1, 2 317* 2.21 32
261 2.25 50 318 2.33 90
262* 2.16 9 319* 2.10 2, 6, 7
263 2.19 24 320 2.18 1, 16
264 2.34 83 321(T)/22 2.39 18
265 2.26 52 322 2.15 11
266(P)/22 2.42 52 323 2.28 47
267 2.32 66 324(P)/22 2.40 1, 16
268 2.29 56 325 2.36 81
269* 2.7 2 326 2.20 31
270 2.34 83 327 2.18 18
271(P)/22 2.40 40 328 2.35 87
272(P)/22 2.40 40 329 2.32 73
273 2.30 52 330 2.30 52
274 2.12 13 331* 2.10 8
275 2.35 81 332 2.20 30
276 2.36 81 333* 2.23 40
277 2.26 52 334 2.28 50
278* 2.21 40 335 2.28 55
279 2.26 50 336 2.29 55
280 2.36 81 337 2.29 55
281 2.34 83 338 2.29 53
282 2.26 52 339(T)/22 2.44 55
283* 2.21 40 340(T)/22 2.45 55
284* 2.25 45 341(T)/22 2.45 53
285 2.14 10 342(T)/22 2.45 53
286(P)/22 2.47 88 343(T)/22 2.46 53
287 2.8 5, 6 344(T)/22 2.46 54
288(P)/22 2.43 47 345(T)/22 2.38 10
289* 2.19 30 346 2.12 13, 15
290* 2.8 8 347* 2.11 2
291 2.30 56 348* 2.11 6
292(P)/22 2.47 83 349* 2.11 2
293 2.18 17 350 2.21 34
294* 2.8 2 351 2.33 90
295* 2.8 7 352 2.12 1, 2
296 2.14 10 353 2.15 10
297 2.35 83 354* 2.24 40
298(P)/22 2.38 10 355(P)/22 2.43 50
299 2.33 95 356(P)/22 2.44 50
300 2.27 47 357(P)/22 2.44 50
301 2.27 50 358(P)/22 2.38 10
302* 2.9 2 359 2.15 10
303 2.6 17 360(T)/22 2.39 10
304 2.27 47 361(P)/22 2.39 9
305 2.23 40 362(P)/22 2.41 32, 40, 41
306 2.32 90 363 2.16 10
307 2.35 83 364(P)/22 2.46 88
308 2.14 11 365(P)/22 2.37 2
309(P)/22 2.48 83 366 2.24 40
2.2
Wk04/22
II
2.3
Wk04/22
II
2.4
Wk04/22
II
International
Admiralty Chart No. Notices International
Admiralty Chart No. Notices
Notices
Chart No. Chart No.
INT 1191 322 INT 7265 362P
INT 1198 308 INT 7275 362P
INT 1201 345T INT 7278 305, 362P
INT 1216 353 INT 7292 362P
INT 1217 259 INT 7314 362P
INT 1237 358P INT 11881 308
INT 1239 359
INT 1277 259
INT 1332 345T
INT 1353 363
INT 1368 296
INT 1400 310T
INT 1452 262
INT 1479 361P
INT 1506 316
INT 1547 319
INT 1625 287
INT 1630 287
INT 1704 320
INT 1707 324P
INT 1722 260
INT 1771 298P, 359
INT 1772 298P, 360T
INT 1773 298P
INT 1805 303
INT 1875 321T
INT 1876 321T
INT 3681 332
INT 5355 273
INT 7008 362P
INT 7010 362P
INT 7017 271P
INT 7018 305
INT 7019 362P
INT 7132 362P
INT 7142 362P
INT 7143 362P
INT 7145 362P
INT 7148 362P
INT 7149 362P
INT 7150 362P
INT 7199 271P, 362P
INT 7200 362P
INT 7209 362P
INT 7211 271P, 362P
INT 7212 271P, 362P
INT 7216 271P, 362P
INT 7222 283, 354
INT 7223 283
INT 7224 283
INT 7226 354
INT 7227 333
INT 7229 278, 333
INT 7232 271P, 362P
INT 7233 362P
INT 7238 362P
INT 7239 333, 362P
INT 7241 278
INT 7243 362P
INT 7244 362P
INT 7250 362P
INT 7252 362P
INT 7254 362P
INT 7255 362P, 366
INT 7258 362P
INT 7260 362P
INT 7261 362P, 366
INT 7264 362P
2.5
Wk04/22
II
303 MISCELLANEOUS UPDATES TO CHARTS
Source: UKHO
2.6
Wk04/22
II
260* ENGLAND - South Coast - Rocks. Depths. Obstruction. (continued)
Chart 5621_10 (Panel A, Dublin Bay Northern Part) [ previous update 5162/21 ] ETRS89 DATUM
Insert
JfQ; (5)20s (a) 53° 21´·32N., 6° 05´·37W.
Automatic Identification System, AIS, at light-buoy (a) above
2.7
Wk04/22
II
Chart 1186 (Panel B, Coalhouse Point to Tilbury) [ previous update 4798/21 ] ETRS89 DATUM
Insert
R 51° 26´·753N., 0° 22´·124E.
Move
R, from: 51° 26´·749N., 0° 22´·047E.
to: 51° 26´·756N., 0° 22´·075E.
Delete limit of foul ground area, pecked line, centred on: 51° 26´·734N., 0° 22´·092E.
ùÜOUTFALL
l 51° 51´·073N., 8° 19´·586W.
51° 51´·219N., 8° 19´·645W.
2.8
Wk04/22
II
Chart 5614_1 (Panel A, Orford Ness to Benacre Ness) [ previous update 225/22 ] ETRS89 DATUM
Replace depth, 61, with depth, 5, and extend 5m contour S to enclose (a) 52° 26’ ·66N. , 1° 47’ ·26E.
Delete depth, 5, close N of: (a) above
Chart 5614_4 (Panel A, Approaches to Great Yarmouth) [ previous update 4988/21 ] ETRS89 DATUM
Move
GqQ(6)+LFl.15s
V S Corton Bell, from:
52° 33’ ·37N. , 1° 48’ ·14E.
to: 52° 33’ ·37N. , 1° 48’ ·41E.
2.9
Wk04/22
II
Chart 741 (Panel B, Kincardine to Alloa) [ previous update 2573/21 ] ETRS89 DATUM
Delete
ÍCHIMNEY (185) 56° 02´·91N., 3° 40´·96W.
Chart 5615_17 (Panel A, Grangemouth Roads) [ previous update New Chart 18/11/2021 ] ETRS89 DATUM
Delete
ÍCHIMNEY (185) 56° 02´·91N., 3° 40´·96W.
Chart 1186 (Panel B, Coalhouse Point to Tilbury) [ previous update 290/22 ] ETRS89 DATUM
Insert depth, 102 (a) 51° 27´·703N., 0° 19´·524E.
Delete depth, 115, close SE of: (a) above
2.10
Wk04/22
II
Chart 5609_9 (Panel A, Carreg Ginnog to Bangor) [ previous update New Chart 04/11/2021 ] ETRS89 DATUM
Delete
¶Fl.R.3s 53° 14´·44N., 4° 07´·57W.
Chart 5609_9 (Panel B, Eastern Entrance to Menai Strait) [ previous update New Chart 04/11/2021 ] ETRS89 DATUM
Delete
¶Fl.R.3s 53° 14´·44N., 4° 07´·57W.
Chart 1462 (Panel A, Wick and Approaches) [ previous update 115/22 ] ETRS89 DATUM
Insert depth, 158 (a) 58° 26´·679N., 3° 03´·119W.
Delete depth, 18, close N of: (a) above
Insert depth, 124 (b) 58° 26´·690N., 3° 03´·305W.
Delete depth, 137, close E of: (b) above
Insert depth, 142, and extend 15m contour S to enclose 58° 26´·710N., 3° 03´·085W.
depth, 67, enclosed by 10m contour (c) 58° 26´·733N., 3° 03´·105W.
Delete depth, 116, close W of: (c) above
Insert depth, 46, enclosed by 5m contour (d) 58° 26´·750N., 3° 03´·058W.
Delete depth, 76, close NW of: (d) above
Chart 5614_18 (Panel A, Immingham to Saltend) [ previous update 5194/21 ] ETRS89 DATUM
Insert depth, 79 (a) 53° 43´·99N., 0° 16´·21W.
Delete depth, 84 , close S of: (a) above
Insert depth, 83 (b) 53° 43´·63N., 0° 15´·69W.
Delete depth, 96 , close NE of: (b) above
Chart 5614_19 (Panel A, Kingston Upon Hull to Humber Bridge) [ previous update 36/22 ] ETRS89 DATUM
Insert depth,77 (a) 53° 44´·38N., 0° 17´·88W.
Delete depth, 91 , close N of: (a) above
Insert depth, 81 (b) 53° 44´·19N., 0° 16´·41W.
Delete depth, 9 , close S of: (b) above
Insert depth, 79 (c) 53° 43´·99N., 0° 16´·21W.
Delete depth, 84 , close S of: (c) above
Insert depth, 83 (d) 53° 43´·63N., 0° 15´·69W.
Delete depth, 96 , close NE of: (d) above
2.11
Wk04/22
II
2.12
Wk04/22
II
346 FØROYAR - Submarine cables. (continued)
2.13
Wk04/22
II
Chart 2185 (INT 11881) (Panel A, Lövskär) [ previous update 244/22 ] WGS84 DATUM
Insert depth, 26, enclosed by 3m and 6m contours and extend 10m
contour W to enclose (a) 60° 14´·76N., 21° 50´·65E.
Delete depth, 67, close SE of: (a) above
2.14
Wk04/22
II
308 FINLAND - Saaristomeri - Depths. (continued)
2.15
Wk04/22
II
Chart DE 44 (INT 1452) (Panel, Cuxhaven) [ previous update 5429/21 ] WGS84 DATUM
Replace depth, 144, with depth, 131 53° 52´·792N., 8° 43´·149E.
2.16
Wk04/22
II
316* NORTH SEA - Submarine power cable. Legend. (continued)
2.17
Wk04/22
II
316* NORTH SEA - Submarine power cable. Legend. (continued)
Chart 2978 (Panel B, Enfilación Atravesada Canal Nuevo to Caño de la Candelera) [ previous update 4401/20 ] WGS84
DATUM
Insert the accompanying block, centred on: 37° 01´·6N., 6° 09´·2W.
2.18
Wk04/22
II
289* CYPRUS - Pilot boarding places. Anchorage area. Maritime limit. Legends.
Source: Cyprus Department of Land and Surveys
2.19
Wk04/22
II
332 ISRAEL - Mediterranean Sea Coast - Precautionary area. Routeing measures. Light.
Source: ENCs I1400372, I1400373 and I1400323.
Chart 1591 (INT 3681) (Panel C, Ashdod) [ previous update 4542/21 ] WGS84 DATUM
Insert limit of routeing measure, pecked line, joining: 31° 51´·79N., 34° 36´·29E.
31° 49´·14N., 34° 34´·88E.
Delete light, Fl.R.3s 31° 50´·34N., 34° 38´·79E.
Chart 1591 (INT 3681) (Panel E, Tel Aviv to Ashqelon) [ previous update 4542/21 ] WGS84 DATUM
Insert limit of precautionary area, pecked line, joining: 31° 55´·24N., 34° 27´·39E.
31° 53´·57N., 34° 31´·48E.
31° 50´·80N., 34° 30´·24E.
31° 51´·44N., 34° 26´·03E.
limit of routeing measure, pecked line, joining: 31° 51´·79N., 34° 36´·28E.
31° 49´·14N., 34° 34´·88E.
31° 50´·80N., 34° 30´·24E.
31° 49´·73N., 34° 29´·96E.
Delete limit of routeing measure, pecked line, joining: 31° 49´·73N., 34° 29´·96E.
31° 47´·09N., 34° 37´·42E.
2.20
Wk04/22
II
Chart 1322 (Panel B, Bata Anchorage) [ previous update 5947/19 ] WGS84 DATUM
Insert
23,Wk 1° 50´·93N., 9° 42´·45E.
2.21
Wk04/22
II
283* UNITED ARAB EMIRATES - Harbour limits. Legends. (continued)
Chart 3713 (INT 7223) (Panel, The Free Port) [ previous update 31/22 ] WGS84 DATUM
Insert harbour limit, pecked line, joining: 24° 30´·557N., 54° 22´·200E.
24° 30´·500N., 54° 22´·250E.
(a) 24° 30´·390N., 54° 22´·070E.
(b) 24° 30´·730N., 54° 21´·470E.
24° 30´·950N., 54° 21´·430E.
24° 31´·200N., 54° 21´·490E.
and
(c) 24° 31´·810N., 54° 20´·990E.
(d) 24° 32´·026N., 54° 20´·700E.
legend, Mīnā’ Zāyid Port Limit, along NE side of: (a)-(b) above
(c)-(d) above
Delete former harbour limit, pecked line, and associated legend,
Mīnā’ Zāyid Port Limit, joining: 24° 31´·467N., 54° 20´·700E.
(c) above
2.22
Wk04/22
II
283* UNITED ARAB EMIRATES - Harbour limits. Legends. (continued)
Chart 3413 (INT 7227) (Panel C, Approaches to Jazīrat Dās) [ previous update 4804/21 ] WGS84 DATUM
Insert circular limit of restricted area, radius 500m (0·27M), Ç,
centred on: (a) 25° 08´·45N., 52° 48´·48E.
legend, Restricted Area (see Note), close SE of: (a) above
2.23
Wk04/22
II
366 BAHRAIN - Submarine pipeline. Legends. Quay. Alongside depth. Depth. Buoyage. Light-beacon.
Source: Bahraini Chart 1501
2.24
Wk04/22
II
2.25
Wk04/22
II
2.26
Wk04/22
II
2.27
Wk04/22
II
2.28
Wk04/22
II
2.29
Wk04/22
II
Chart 898 (Panel A, Ulsan and Mipo) [ previous update 50/22 ] WGS84 DATUM
Replace symbol, WBuW, Can buoy Q(4)6s8M Horn(1)20s B with
Bf Q(4)6s Horn(1)20s A
35° 26´·32N., 129° 23´·61E.
symbol, WBuW, Superbuoy, Sphere topmark Q(3)5s9M
Horn(1)15s C with BZf
Q(3)5s Horn(1)15s B
35° 25´·77N., 129° 23´·59E.
2.30
Wk04/22
II
2.31
Wk04/22
II
256 INDONESIA - Java Sea - Platform. Submarine pipeline. Depths. (continued)
Chart 1436 (Panel C, Port Phaeton and Bassin de Tapuaeraha) [ previous update New Edition 03/06/2021 ] IGN 1951-
1954 DATUM
Insert
30%,Wk 17° 47´·57S., 149° 18´·43W.
Replace depth, 46, with depth, 44 17° 47´·02S., 149° 18´·60W.
2.32
Wk04/22
II
Chart 1717 (Panel, Neah Bay) [ previous update 212/22 ] NAD83 DATUM
Insert depth, 7, and extend 10m contour E to enclose (a) 48° 23´·698N., 124° 38´·903W.
Delete depth, 125, close SE of: (a) above
Insert depth, 14 (b) 48° 23´·750N., 124° 38´·852W.
Delete depth, 174, close SW of: (b) above
Insert depth, 24 (c) 48° 23´·817N., 124° 38´·844W.
Delete depth, 30, close SE of: (c) above
Chart 541 (Panel, Continuation to Terminal da Alumar) [ previous update New Edition 22/11/2018 ] WGS84 DATUM
Delete
· F.Y 2° 40´·678S., 44° 21´·765W.
2° 40´·680S., 44° 21´·500W.
Chart 3977 (Panel, Sergipe Terminal) [ previous update 5464/21 ] WGS84 DATUM
Insert sounding out of position, 94, enclosed by 10m contour 10° 51´·53S., 36° 52´·89W.
2.33
Wk04/22
II
Chart 2267 (Panel C, Approaches to Puerto Bolivar) [ previous update 5936/20 ] WGS84 DATUM
Insert the accompanying block, centred on: 12° 17´·9N., 71° 51´·3W.
limit of marine reserve, ÇMR Ç, joining: (a) 12° 12´·00N., 72° 11´·83W.
(b) 12° 12´·51N., 72° 11´·64W.
(c) 12° 12´·55N., 72° 10´·82W.
legend, Marine Reserve (see Note), within: (a)-(c) above
2.34
Wk04/22
II
Chart 1628 (Panel, Puerto Cabello) [ previous update 5368/21 ] WGS84 DATUM
Insert
GdFl.R.4s 10° 28´·85N., 68° 00´·80W.
2.35
Wk04/22
II
2.36
Wk04/22
II
365(P)/22 ENGLAND - Bristol Channel - Buoyage. Intake. Outfalls. Works. Radio reporting point.
Source: Hinkley Point C Harbour Authority, Port of Bridgwater Notice 11/21, CEFAS and UKHO
1. Works are in progress to install new intake and outfall pipes at the site of Hinkley Point C Power station. The works area is
bounded by cardinal buoys in the following positions:
2.37
Wk04/22
II
Charts affected - 800 (INT 1773) - 802 (INT 1772) - 803 - 810 (INT 1771)
2.38
Wk04/22
II
Charts affected - 272 - 274 - 1405 (INT 1400) - 2182B (INT 1042) - 2182C (INT 1041)
Depth Position
20·1m 38° 40´·377N., 9° 18´·106W.
19·8m 38° 40´·467N., 9° 17´·950W.
19·7m 38° 40´·627N., 9° 17´·603W.
1·6m 38° 40´·508N., 9° 17´·529W.
10·1m 38° 40´·551N., 9° 17´·517W.
*14·7m 38° 40´·520N., 9° 17´·782W.
*9·8m 38° 40´·497N., 9° 17´·703W.
3. Former Notice 3974(T)/19 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)
2.39
Wk04/22
II
Feature Position
Obstruction with a safe clearance of 36m 48° 56´·15N., 2° 42´·58W.
Obstruction with a safe clearance of 12·5m 48° 50´·12N., 2° 49´·78W.
Obstruction with a safe clearance of 38m 49° 00´·57N., 2° 33´·32W.
Obstruction with a safe clearance of 22m 48° 49´·87N., 2° 10´·88W.
Wreck with a safe clearance of 33m 48° 59´·06N., 2° 45´·07W.
2. The obstruction, depth 23·5m in position 48° 49´·99N., 2° 10´·91W. has been removed.
3. The yellow conical ODAS light-buoy, Fl(5)Y.20s in position 48° 53´·33N., 2° 33´·64W. has been removed.
4. Mariners are advised to navigate with caution in the area and consult the local port authorities for the latest information.
5. These and other changes will be included in the next New Editions of charts 2029, 2648, 2669, 2675 and 3659, to be
published early 2022.
(WGS84 DATUM)
Charts affected - 2029 - 2648 (INT 1707) - 2669 - 2675 (INT 1070) - 3659
Charts affected - 2442 - 2837 (INT 7017) - 2858 (INT 750) - 2887 (INT 7232) - 2888 (INT 7199) - 2889 (INT 7211) -
3175 (INT 7212) - 3176 (INT 7216)
2.40
Wk04/22
II
2.41
Wk04/22
II
362(P)/22 ARABIAN SEA - Submarine cables. Works. (continued)
Charts affected - 12 (INT 7142) - 38 (INT 7019) - 58 (INT 7314) - 158 (INT 7008) - 159 (INT 7010) - 327 (INT 7145)
- 801 (INT 7143) - 1268 - 2375 (INT 7132) - 2441 (INT 7233) - 2442 - 2443 (INT 7238) - 2444 (INT 7239) - 2523 (INT
7250) - 2599 (INT 7150) - 2658 (INT 7149) - 2659 (INT 7148) - 2851 - 2882 (INT 7264) - 2883 (INT 7260) - 2884 (INT
7278) - 2886 (INT 7243) - 2887 (INT 7232) - 2888 (INT 7199) - 2889 (INT 7211) - 2895 - 3171 - 3172 - 3174 (INT
7209) - 3175 (INT 7212) - 3176 (INT 7216) - 3520 (INT 7200) - 3723 - 3734 (INT 7261) - 3736 (INT 7258) - 3737 (INT
7255) - 3738 (INT 7254) - 3759 - 3760 - 3761 - 3774 (INT 7275) - 3775 - 3786 - 3788 (INT 7265) - 3790 (INT 7252) -
3842 (INT 7292) - 3950 (INT 7244)
Characteristic Position
Iso.3s15m4M 39° 01´·133N., 117° 46´·197E.
Iso.G.4s15m4M 39° 01´·490N., 117° 45´·435E.
2. The following light-buoys have been established:
Designation Position
D15 39° 00´·588N., 117° 46´·725E.
D31 39° 01´·513N., 117° 45´·878E.
4. The red lateral pillar buoy, Fl.R.4s D18, has been moved from position 39° 01´·454N., 117° 46´·294E. to
39° 01´·563N., 117° 46´·277E.
2.42
Wk04/22
II
266(P)/22 CHINA - Bo Hai - Lights. Buoyage. Light-beacons. (continued)
5. The following light-beacons have been removed:
Designation Position
D16 39° 00´·971N., 117° 46´·432E.
D17 39° 01´·005N., 117° 46´·624E.
D29 39° 01´·553N., 117° 46´·015E.
6. Mariners are advised to navigate with caution in the area.
7. These changes will be included in a New Edition of Chart 2665 to be published early 2022.
(CGCS 2000 DATUM)
2.43
Wk04/22
II
355(P)/22 CHINA - East Coast - Buoyage. Virtual aid to navigation. (continued)
2. These and other changes will be included in the next New Edition of Chart 1720 to be published early 2022.
3. Charts 1719 and 1760 will be updated by Notice to Mariners
(CGCS 2000 DATUM)
Designation Position
No 1 26° 14´·70N., 119° 50´·48E.
No 2 26° 20´·00N., 120° 03´·00E.
2. These changes will be included in a New Edition of Chart 2400 to be published early 2022.
3. Chart 2419 will be updated by Notice to Mariners.
(CGCS 2000 DATUM)
2.44
Wk04/22
II
Depth Position
15m 35° 34´ 44·9"N., 140° 02´ 50·7"E.
14·5m 35° 34´ 21·9"N., 140° 02´ 05·6"E.
(WGS84 DATUM)
Depth Position
4m 35° 18´ 06·2"N., 139° 38´ 24·2"E.
5·5m 35° 17´ 45·7"N., 139° 38´ 14·5"E.
2. Underwater obstructions exist in the following positions:
Depth Position
7·5m 35° 18´ 02·1"N., 139° 38´ 19·1"E.
6·5m 35° 17´ 45·6"N., 139° 38´ 25·4"E.
5·5m 35° 17´ 44·6"N., 139° 38´ 18·5"E.
(WGS84 DATUM)
2.45
Wk04/22
II
Depth Position
9·4m 34° 28´ 37·7"N., 133° 41´ 40·1"E.
9·3m 34° 28´ 39·7"N., 133° 41´ 38·8"E.
(WGS84 DATUM)
2.46
Wk04/22
II
Depth Position
1·6m 10° 57´·73N., 74° 45´·31W.
10·2m 10° 57´·99N., 74° 45´·41W.
11·6m 10° 58´·65N., 74° 45´·47W.
9·7m 10° 58´·69N., 74° 45´·52W.
10·9m 10° 58´·91N., 74° 45´·54W.
13·9m 10° 59´·12N., 74° 45´·47W.
12·4m 10° 59´·29N., 74° 45´·60W.
8·6m 10° 59´·49N., 74° 45´·72W.
8·6m 10° 59´·82N., 74° 45´·85W.
13·7m 10° 59´·92N., 74° 45´·84W.
11·4m 11° 01´·60N., 74° 47´·57W.
13·6m 11° 02´·12N., 74° 48´·45W.
13·4m 11° 05´·63N., 74° 50´·99W.
12·4m 11° 06´·23N., 74° 51´·11W.
11·4m 11° 06´·43N., 74° 51´·18W.
13·2m 11° 06´·55N., 74° 51´·21W.
5·1m 11° 06´·94N., 74° 51´·51W.
8·2m 11° 07´·01N., 74° 51´·52W.
2. *A depth of 4m has been reported in position 11° 06´·72N., 74° 51´·18W.
3. The north cardinal light-buoy, Q, in position 10° 57´·54N., 74° 45´·23W. has been removed.
4. These and other changes will be included in the New Edition of Chart 2261 to be published early 2022.
5. Former Notice 4991(P)/21 is cancelled.
*Indicates new or revised entry.
(WGS84 DATUM)
Depth Position
27ft 30° 04´·26N., 90° 53´·88W.
61ft 30° 02´·36N., 90° 42´·54W.
24ft 30° 01´·99N., 90° 41´·88W.
54ft 30° 01´·88N., 90° 41´·69W.
53ft 30° 02´·16N., 90° 41´·21W.
48ft 30° 02´·40N., 90° 40´·90W.
38ft 30° 02´·58N., 90° 40´·56W.
38ft 30° 02´·84N., 90° 40´·01W.
37ft 30° 02´·94N., 90° 39´·59W.
57ft 30° 02´·88N., 90° 35´·29W.
62ft 30° 03´·07N., 90° 30´·04W.
56ft 30° 03´·05N., 90° 29´·67W.
65ft 30° 03´·13N., 90° 29´·30W.
82ft 30° 00´·59N., 90° 28´·39W.
72ft 30° 00´·30N., 90° 28´·26W.
57ft 30° 02´·96N., 90° 33´·11W.
2. An obstruction exists in position 30° 03´·81N., 90° 51´·23W.
2.47
Wk04/22
II
292(P)/22 UNITED STATES OF AMERICA - Gulf of Mexico - Depths. Obstructions. Channels.
Channel depth. (continued)
3. An obstruction with a drying height of 4ft exists in position 30° 03´·25N., 90° 30´·32W.
4. Obstructions have been removed from the following positions:
2.48
Wk04/22
To accompany Notice to Mariners 350/22
On Chart 1322
OBSTRUCTIONS
Obstructions with a least depth of 8·9m may
exist within this area. Mariners are advised to
navigate with caution.
Wk04/22
To accompany Notice to Mariners 291/22
On Chart 3039
SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.
On Chart 3045
SUBMARINE CABLES
Mariners are advised not to anchor or trawl in
the vicinity of submarine cables.
Wk04/22
To accompany Notice to Mariners 258/22. Image Size (mm) 48.4 by 72.8
Wk04/22
To accompany Notice to Mariners 258/22. Image Size (mm) 49.2 by 75.2
Wk04/22
To accompany Notice to Mariners 293/22. Image Size (mm) 108.8 by 156.9
Wk04/22
To accompany Notice to Mariners 296/22. Image Size (mm) 77 by 63
Wk04/22
To accompany Notice to Mariners 317/22. Image Size (mm) 149.3 by 115
Wk04/22
To accompany Notice to Mariners 320/22. Image Size (mm) 96.6 by 148.8
Wk04/22
To accompany Notice to Mariners 322/22. Image Size (mm) 115.6 by 56.5
Wk04/22
To accompany Notice to Mariners 325/22. Image Size (mm) 83.7 by 77.5
Wk04/22
To accompany Notice to Mariners 327/22. Image Size (mm) 45.6 by 127.2
Wk04/22
To accompany Notice to Mariners 350/22. Image Size (mm) 83.8 by 74.8
Wk04/22
III
NAVIGATIONAL WARNINGS
See The Mariner’s Handbook (2020 Edition). Only the most convenient ADMIRALTY Chart is quoted. All warnings issued
within the previous 42 days are broadcast via Enhanced Group Call (EGC) and/or NAVTEX.
The complete texts of all in-force NAVAREA I warnings, including those which are no longer being broadcast, are
available from [Link]/RNW. Additionally, a quarterly cumulative list of the complete text of all in-force
NAVAREA I Warnings is included in Section III of the Weekly NM Bulletin in Weeks 1, 13, 26 and 39 each year.
Alternatively, these may be requested by e-mail from NAVAREA I Co-ordinator at: navwarnings@[Link]
The RNW web page also contains a link to the IHO website which allows direct access to all the other NAVAREA Co-
ordinators around the world who have made their NAVAREA warnings available on the web.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Weekly Edition 04 published on the UKHO website 17 Jan 22.
----------------------------------------------------------------------------------------------------------------------------------------------------------
Navarea I (NE Atlantic) Weekly Edition 04
The following NAVAREA I warnings were in force at 170500 UTC Jan 22.
003 1. Navarea I warnings in force at 141000 UTC Jan 22. 2. Cancel 001/22.
Wk04/22
3.1
III
NOTES:
A. Rigs are protected by a 500 metre safety zone.
B. ACP - Adjacent to Charted Platform.
C. For Rigs located North of 65N, East of 5W, refer to Navarea XIX Warnings or visit [Link]
2. Cancel 002/22.
3.2 Wk04/22
IV
[04/22]
UPDATES TO ADMIRALTY SAILING DIRECTIONS
Paragraph 11.59 3 lines 2--7 Replace by: ...(463350N 320850E); a further obstruction with a
depth of 77 m lies in the canal about 7¾ miles W of Mys
ESE of a rocky shoal area (763960N 171324E), Stanislav.
with a least depth of about 8 m, fronting
Bettybukta, a slight indentation with low land at its Ukrainian Notice 38/571/21 [NP24--No 68--Wk 04/22]
head. Dumskolten, on the N side of Bettybukta, is
a mountain 624 m high, consisting of black schist
and entirely without vegetation. Thence: NP30 China Sea Pilot Volume 1 (2021 Edition)
Norwegian Notice 19/65707/21
[NP11--No 21--Wk 04/22] China -- Fangcheng Gang — Anchorage
Wk04/22 4.1
IV
NP40 Irish Coast Pilot (2019 Edition) NP58A Norway Pilot Volume 3A (2020 Edition)
Sør--Helgeland -- Vega --
Ireland -- East coast -- Port of Dublin — Depths Skarvskjæret to Durmålskjær — Directions; light
157 129
Paragraph 5.186 1 lines 1--2 Replace by: Paragraph 4.47 1 line 3 For (281--288.7) Read
(282--288.5)
1 Maintained depths in the entrance channel and
fairway are as follows: Paragraph 4.47 3 line 2 For (107.7--110.6) Read
From No 1 Light Buoy (starboard hand) (5.204) to (108.5--111.5)
Eastern Breakwater (532069N 61219W)
95 m;
From Eastern Breakwater to Alexandra Basin West Norwegian Notice 19/65741/21
(5.205) 78 m; [NP58A--No 59--Wk 04/22]
From Alexandra Basin West to No 20 Light Buoy
(port hand) 73 m;
Sør--Helgeland -- Haugsfjorden —
From No 20 Light Buoy (port hand) to Thomas Anchorage; light
Clarke Bridge 60 m.
147
DPC Notice 12.3/21 [NP40--No 28--Wk 04/22]
Paragraph 4.179 1 line 4 For white Read green
Paragraph 5.197 2 lines 9--10 Replace by: NP62 Pacific Islands Pilot Volume 3
(2020 Edition)
3 Anchor berths are situated within an anchorage
area, SE of the entrance to Flatsetsundet, in the
following positions: French Polynesia -- Huahine -- Port de Fare —
Alpha (630105N 74803E). Directions; fairway
Bravo (630093N 74891E).
Charlie (630130N 74968E). 182
Delta (Deep Water) (630061N 74957E).
4 Anchor Berth Echo (630062N 74673E) is Paragraph 7.16 1 lines 4--8 Replace by:
situated 3 cables SW of Revsholmen (5.196). Approach and entry. Fare can be entered directly
Caution. Numerous obstructions lie within these from the sea via Passe Avamoa (164260S
anchorages. 1510272W). The fairway through the pass is only
Berth. A quay directly E of the bridge; length 30 m, 85 m wide at the entrance. It is not difficult to enter in
depths from 39 to 49 m. clear weather when it is easy to distinguish between
breakers on both sides.
Norwegian Notice 19/65732/21
[NP57B--No 116--Wk 04/22] French Chart 6434/21 [NP62--No 10--Wk 04/22]
4.2 Wk04/22
IV
ENC IR6TZE01 (1.000); ENC IR586021 (1.000) Cayman Islands – Grand Cayman – George Town
— Directions; leading lights
[NP63--No 38--Wk 04/22]
263
Iran – Kalat to Bushehr — Directions; wrecks Paragraph 10.243 1 lines 1--7 Delete
133
Corr. Port Authority of the Cayman Islands
Paragraph 6.67 4 lines 1--7 Replace by: [NP70--No 7--Wk 04/22]
Wk04/22 4.3
V
NP74, Vol A Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
KETCH GASFIELD
A7674·5 - Dogger Bank. Outer Silver 54 02·96 N Mo(U)W 15s .. 15 Platform ..
Pit. 44/28b-KA 2 29·30 E
(GB)
- - - - Reserve light .. Mo(U)W 15s .. 10 . . ..
- - - - Subsidiary light .. Mo(U)R 15s .. 2 .. 1 on each corner of Platform if not
marked by a W light, the subsidiary
lights are synchronized
---- .. Horn Mo(U) .. .. .. (bl 0·7, si 1) x 2, bl 2·5, si 24·1
30s
*
NP75, Vol B Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 1, dated 06 January 2022.
5.1 Wk04/22
V
NP76, Vol C Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 2, dated 13 January 2022.
HÄRNÖN
C6007·5 - Härnösands Hamn. Jetty 62 38·23 N Iso G 2s .. . . Post ..
(SE) 17 56·46 E
*
5.2 Wk04/22
V
NP77, Vol D Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
D6370·2 - Struis Bay Harbour. Dir Lt 34 47·91 S Dir WRG 7 3 Red post F G254°-266°(12°).
ZA, , Z5986 268° 20 03·42 E F W266°-270°(4°).
F R270°-282°(12°).
TE 2021
*
NP78, Vol E Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
E2109 Siderno Marina. Pier Head 38 16·46 N 2 F GR(vert) 13 3 Red post, black bands 1m apart. Private.
IT, , 3385 16 18·63 E 12 TE 2021
* * *
5.3 Wk04/22
V
E6378 - Monastir. Marina. N 35 46·60 N Fl(2)W 10s 11 7 White tower fl 0·5, ec 2, fl 0·5, ec 7
TN, , 2920 Breakwater. Head 10 50·20 E
FR, L2, 04340
* *
GULF OF HAMMAMET
E6381·5 Remove from list; deleted
NP79, Vol F Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
NP80, Vol G Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
5.4 Wk04/22
V
RÍO ESMERALDAS
G3096·25 Remove from list; deleted
G3096·26 - Ldg Lts 250°. Rear. E4 0 59·09 N Iso WRG 4s 130 12 White structure, R245·15°-249·65°(4·5°),
EC, , 1026 79 40·02 W orange daymark W249·65°-250·35°(0·7°),
9 G250·35°-254·85°(4·5°)
* * * * * * * *
NP81, Vol H Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 51, dated 23 December 2021.
GRAND BRUIT
H0254 - 47 38·53 N Fl W 4s 11 7 White U, red bands, fl 1
CA, N, 147 58 13·49 W on square framework
tower
5
* * * *
5.5 Wk04/22
V
SHEDIAC BAY
H1350 Remove from list; deleted
SHIPPAGAN GULLY
H1530 - S Entrance. E Side. Big 47 43·33 N LFl W 6s .. 13 White 8-sided tower, fl 2
CA, A, 1254 Shippegan. On Sand Bar 64 39·64 W red top
16
* * * * *
CHALEUR BAY
H1556 - Miscou Harbour. Black 47 53·06 N LFl W 6s .. 12 Red and white U on fl 2
CA, A, 1275 Point 64 37·42 W framework tower
with red upper
portion
18
* * * *
CHALEUR BAY
H1580 - Caraquet Harbour. Ldg 47 48·50 N FG 8 17 White square tower, Seasonal. Operates 24 hours
CA, A, 1310 Lts 226°47′. Front. NE of 64 50·46 W red stripe
Stoke Point 7
* * *
5.6 Wk04/22
V
NP82, Vol J Edition 2022. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
J2280 - Curtis Bay. Dir Lt 267·9° 39 13·27 N Fl G 2·5s 6 . . Multi-pile structure Intens 1·5° each side of rangeline.
US, II, 20870 76 34·58 W Shown 24 hours
--- .. By day Fl G 25s .. .. .. Vis 1·5° each side of rangeline
* * * * * * * *
J3142 - Egmont Channel. Ldg Lts 27 36·82 N Fl W 2·5s .. . . Tower Vis 0·5° each side of rangeline.
US, III, 1375 083°. Front 82 45·89 W Shown 24 hours
US, III, 22280 ---- .. By day Fl W .. .. .. Vis 1° each side of rangeline
US, III, 1375·1 2·5s
- - - - Passing lights .. 2 Fl W 2·5s .. .. .. Synchronized. Located on NW and SE
Corners of Platform
* * * * * * * *
J3142·1 - Egmont Channel. Ldg Lts 27 36·97 N Iso W 6s .. . . Tower Vis 0·5° each side of rangeline.
US, III, 1380 083°. Rear. 1·354M from 82 44·37 W Shown 24 hours
US, III, 22285 front
US, III, 1380·1 ----- .. By day Iso W .. .. .. Vis 1° each side of rangeline
6s
- - - - - Passing lights .. 2 Fl W 2·5s .. .. .. Synchronized. Located on NW and SE
Corners of Platform
* * * * * * * *
ARANSAS
J4213·2 Remove from list; deleted
J6858·1 - Ldg Lts 216°. Rear. 0·8M 6 20·09 N Fl W 4s 18 20 , on white metal TE 2021
GY, , D7 from front 57 31·89 W tower on black 4-pile
platform
*
5.7 Wk04/22
V
NP83, Vol K Edition 2022. NEW EDITION Weekly Edition No. 4, Dated 27 January 2022.
NOTE: These are the first updates issued for the New Edition.
Cut out the above and paste it in the NEW EDITION First Updates box immediately below the
RECORD OF UPDATES title on page ii of NP83, Vol K Edition 2022 New Edition.
K2784 Crowdy Head 31 50·61 S Fl(2)WR 10s 58 W16 White masonry tower fl 0·1, ec 3·2, fl 0·1, ec 6·6.
152 45·22 E R13 and lantern W143·2°-199·9°(56·7°),
7 R199·9°-224·1°(24·2°),
W224·1°-054·7°(190·6°)
* *
5.8 Wk04/22
V
COLLINGWOOD BAY
K3429 - Veale Reef 9 11·93 S Fl W 2·5s 9 10 White column fl 0·5
149 28·71 E 12
*
K3429·4 - Greaves Reef 9 10·84 S Fl(3)W 12s 11 10 White column (fl 0·5, ec 1·5) x 2, fl 0·5, ec 7·5
149 27·08 E 12
*
K3494 - Tavui Point (Cape Tavui) 4 08·16 S Fl W 8s 47 18 White GRP hut fl 0·3.
152 10·20 E 2 W050°-300°(250°).
TE 2021
*
K4704 - Navula Passage. Momi 17 54·86 S Iso R 2s 13 15 Orange 0 with white Arc of Vis obscured by Mangroves on
FJ, F201, 4704 Bay Ldg Lts 077°17′. Front 177 16·45 E stripe daymark on N and S Side of Bay
concrete tripod
*
ATOLL DE MANIHI
K4998·6401 - Chenal du Nord 14 23·55 S Oc(2)G 6s 4 3 Green % on green ..
FR, L2, 53820 145 59·28 W beacon
5
*
5.9 Wk04/22
V
5.10 Wk04/22
V
K4998·8 - Passe Tairapa 14 27·51 S Fl R 2·5s 5 5 Red & on red beacon fl 0·5
FR, L2, 53120 146 03·69 W 6
* *
ATOLL DE TAENGA
K5004·63 - Passe Tiritepakau. Ldg Lts 16 21·90 S Iso R 4s 7 6 Red and white metal TE 2021
FR, L2, 56440 052°. Front 143 11·20 W column
(FR) 8
*
K5004·631 - Passe Tiritepakau. Ldg Lts 16 21·80 S Iso R 4s 9 6 Red and white metal Sync with front.
FR, L2, 56441 052°. Rear 143 11·10 W column TE 2021
(FR) 10
*
5.11 Wk04/22
V
NP84, Vol L Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
ULVESUND
L0486·55 Remove from list; deleted
L1472 - Kya. Centre 63 46·40 N Iso WRG 6s 167 W5·8 Tripod G071·7°-086·1°(14·4°),
NO, , 460200 8 18·73 E R4·6 11 W086·1°-105·1°(19°),
G4·6 R105·1°-113·9°(8·8°),
G113·9°-116·7°(2·8°),
W116·7°-134·4°(17·7°),
R134·4°-155°(20·6°),
G155°-167·7°(12·7°),
W167·7°-173·8°(6·1°),
R173·8°-199°(25·2°),
G199°-233·9°(34·9°),
R233·9°-283°(49·1°),
G283°-296·9°(13·9°),
W296·9°-302·4°(5·5°),
R302·4°-350·5°(48·1°)
* * * *
LINESFJORDEN
L1636 - Synstskjæret 63 58·60 N Oc(2)WRG 8s 6 W7·8 Post R243·6°-255·4°(11·8°),
NO, , 481500 9 49·97 E R6·3 8 G255·4°-268·1°(12·7°),
G6·3 W268·1°-299·1°(31°),
R299·1°-311°(11·9°),
G311°-020°(69°),
W020°-025·1°(5·1°),
R025·1°-067·7°(42·6°),
G067·7°-084·1°(16·4°),
R084·1°-093°(8·9°),
G093°-120°(27°),
W120°-131·6°(11·6°),
R131·6°-156·3°(24·7°)
* *
5.12 Wk04/22
V
L2031 - Arnlangøya. S Point 65 28·50 N Oc(3)WRG 12s 8 W6·3 Concrete post G241·5°-249·6°(8·1°),
NO, , 580000 12 03·22 E R 5 5 R249·6°-029·8°(140·2°),
G 5 G029·8°-062°(32·2°),
W062°-141·8°(79·8°),
R141·8°-182·9°(41·1°)
* *
TJØTTAFJORDEN TO VEFSNJORDEN
L2150 - Storskjær (Tangsundet) 65 50·78 N Iso WRG 6s 3 W6·8 Pile G224°-233·9°(9·9°),
NO, , 611000 12 35·51 E R5·4 4 W233·9°-243°(9·1°),
G5·4 R243°-354·9°(111·9°),
G354·9°-356·9°(2°),
W356·9°-005·9°(9°),
R005·9°-060·8°(54·9°),
G060·8°-062·8°(2°),
W062·8°-142·7°(79·9°),
R142·7°-163·1°(20·4°)
* *
5.13 Wk04/22
V
ULVANGEN
L2214 - Angarsnes 66 03·95 N Oc(3)WRG 10s 8 W8·8 Concrete column R347·9°-029·5°(41·6°),
NO, , 618300 12 40·35 E R7·3 3 G029·5°-041·7°(12·2°),
G7·3 W041·7°-050·5°(8·8°),
R050·5°-055°(4·5°),
G055°-078·6°(23·6°),
W078·6°-079·7°(1·1°),
R079·7°-125·6°(45·9°),
G125·6°-180°(54·4°),
W180°-184·4°(4·4°),
R184·4°-189·1°(4·7°),
G189·1°-190·7°(1·6°),
W190·7°-198·9°(8·2°),
R198·9°-200·7°(1·8°)
* *
BLOMSØY
L2273 - Langneset 65 52·56 N Iso RG 6s 5 R4·5 Post G009·8°-031°(21·2°),
NO, , 642000 12 15·01 E G4·5 3 R031°-200·5°(169·5°),
G200·5°-205·6°(5·1°),
R205·6°-212·9°(7·3°)
* * *
5.14 Wk04/22
V
ALTERFJORD
L2274 - Buøy 65 55·81 N Iso WRG 6s 10 W6·6 Cairn R063·3°-069°(5·7°),
NO, , 642500 12 18·28 E R5·2 6 G069°-185·8°(116·8°),
G5·2 W185·8°-191·5°(5·7°),
R191·5°-214·2°(22·7°),
G214·2°-223·4°(9·2°),
W223·4°-227·4°(4°),
R227·4°-013·4°(146°),
G013·4°-024°(10·6°)
* * *
GÅSVÆRFJORDEN
L2310 - Ytre Flesan. On Islet N of 65 57·62 N Fl WRG 5s 5 W6·4 Tripod G347·4°-352·4°(5°),
NO, , 653000 Sandeskjær 11 53·23 E R5·1 6 W352·4°-353·3°(0·9°),
G5·1 R353·3°-005·2°(11·9°),
G005·2°-006·9°(1·7°),
W006·9°-008·3°(1·4°),
R008·3°-027·7°(19·4°),
G027·7°-189·7°(162°),
W189·7°-195·8°(6·1°),
R195·8°-210·2°(14·4°)
* *
L2314 - Indreholmen. E Point 66 01·86 N Iso WRG 6s 12 W6·8 Framework tower G240·3°-323·2°(82·9°),
NO, , 654000 11 47·72 E R5·4 6 W323·2°-325·3°(2·1°),
G5·4 R325·3°-329°(3·7°),
G329°-331·4°(2·4°),
W331·4°-340·8°(9·4°),
R340·8°-018·5°(37·7°),
G108°-124·2°(16·2°),
R124·2°-134·3°(10·1°)
* *
NP85, Vol M Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
5.15 Wk04/22
V
NP86, Vol N Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 1, dated 06 January 2022.
N5762·1 - Ldg Lts 129°. Middle. Inner 42 09·47 N Fl G 3s 7 1 White U, red stripe, ..
RU, 2217, 2418 S Mole. Head 41 39·09 E on 4-sided metal
framework tower
* *
N5762·3 - Ldg Lts 129°. Rear. Inner S 42 09·47 N Fl R 6s 24 5 White U, red stripe, ..
Mole. Head 41 39·09 E on 4-sided metal
framework tower
* *
NP87, Vol P Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 3, dated 20 January 2022.
NP88, Vol Q Edition 2021. Weekly Edition No. 4, Dated 27 January 2022.
Last Updates: Weekly Edition No. 2, dated 13 January 2022.
5.16 Wk04/22
VI
Wk04/22
6.1
VI
ENQLDQTOC@SD
"QN@SH@M-NSHBD12#1
/NQSCD+K@M¡-NQSG!QD@JV@SDQ+S
mț̦-mț̦$ 1D@K
!M
/NQSCD+K@M¡2NTSG!QD@JV@SDQ+S
mț̦-mț̦$ 1D@K
!M
2O@MHRG!TKKDSHM12#1
/TDQSNCD!K@MDR(MMDQ!QD@JV@SDQ
mț̦-mț̦$ 1D@K
+S!M
/TDQSNCD!K@MDR.TSDQ!QD@JV@SDQ
mț̦-mț̦$ 1D@K
+S!M
ENQLDQTOC@SD
2O@MHRG!TKKDSHM12#1
/TDQSNCDK@2DKU@,TDKKDCD/TMS@
mț̦-mț̦$ 1D@K
3QDMBG+S!M
ENQLDQTOC@SD
2O@MHRG!TKKDSHM12#1
/TDQSNCD/@K@LR(MMDQ
mț̦-mț̦$ 1D@K
!QD@JV@SDQ+S!M
/TDQSNCD/@K@LR.TSDQ
mț̦-mț̦$ 1D@K
!QD@JV@SDQ+S!M
ENQLDQTOC@SD
2O@MHRG!TKKDSHM12#1
Wk04/22
6.2
VI
/TDQSNCD1NRDR-NQSG!QD@JV@SDQ
mț̦-mț̦$ 1D@K
+S!M
/TDQSNCD1NRDR2NTSG!QD@JV@SDQ
mț̦-mț̦$ 1D@K
+S!M
2O@MHRG!TKKDSHM12#1
/TDQSNCD2@M%DKH´CD&T§WNKR
mț̦-mț̦$ 1D@K
!QD@JV@SDQ+S!M
2O@MHRG!TKKDSHM12#1
/TDQSN#DONQSHUNCD+$RS@QSHS$@RS
mț̦-mț̦$ 1D@K
!QD@JV@SDQ+S!M
/TDQSN#DONQSHUNCD+$RS@QSHS6DRS
mț̦-mț̦$ 1D@K
!QD@JV@SDQ+S!M
ENQLDQTOC@SD
2O@MHRG!TKKDSHM12#1
!HRB@X,@QHMD$MDQFX/K@SENQL+S
mț̦-mț̦6 1D@K
!TNX!
!HRB@X,@QHMD$MDQFX/K@SENQL+S
mț̦-mț̦6 1D@K
!TNX-N
!HRB@X,@QHMD$MDQFX/K@SENQL+S
mț̦-mț̦6 1D@K
!TNX-N
!HRB@X,@QHMD$MDQFX/K@SENQL+S
mț̦-mț̦6 1D@K
!TNX-N
2O@MHRG!TKKDSHM12#1
1 # 1!$ ".-2
/ &$"'(-
̤0HMYGNT&@MF$@RS"G@MMDK+S!TNX-N
#DKDSDDMSQX@MCQDOK@BDAX
"GHMDRD-NSHBD12#1
Wk04/22
6.3
VI
/ &$"'(-
̤0HMYGNT&@MF+S!TNX-N
#DKDSDDMSQX@MCQDOK@BDAX
"GHMDRD-NSHBD12#1
3DQLHM@K,@Q§SHLN,NMSDUDQCD+S!M
mț̦2mț̦6 /
-N
$BT@CNQH@M"G@QS>12#1
2GHOODF@M-NQSG"G@MMDK+S!TNX
mț̦-mț̦6 m &
$$
/QDRBNSS.FCDMRATQF!QHCFD-NQSG
mț̦-mț̦6 m 3
/HDQ+S!M
-NSD-@UHF@SHNMRD@RNMNMKX
/QDRBNSS.FCDMRATQF!QHCFD2NTSG
mț̦-mț̦6 m '
/HDQ+S!M
-NSD-@UHF@SHNMRD@RNMNMKX
Wk04/22
6.5
VI
/ &$"'(-
&T@MFYGNT&@MF$1HUDQ+S!TNX-N
#DKDSDDMSQX@MCQDOK@BDAX
&T@MFYGNT&@MF$1HUDQ+S!TNX
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 1D@K
-N
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF!
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
0HMYGNT&@MF3NMR+DES-N
mț̦-mț̦$ !QN@CB@RSRDUDQXLHMTSDR 5HQST@K
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF$@RS"G@MMDK+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF$@RS"G@MMDK+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
Wk04/22
6.6
VI
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
"GHMDRD-NSHBD12#1
Wk04/22
6.7
VI
ENQLDQTOC@SD
"GHMDRD-NSHBD12#1
/ &$"'(-
0HMYGNT&@MF+S!TNX-N
#DKDSDDMSQX@MCQDOK@BDAX
ENQLDQTOC@SD
"GHMDRD-NSHBD12#1
ENQLDQTOC@SD
"GHMDRD-NSHBD12#1
/ &$"'(-
9GNMFFT@MFGD+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
/ &$"'(-
9GNMFFT@MFGD+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
/ &$"'(-
9GNMFFT@MFGD+S!TNX-N
#DKDSDDMSQX
"GHMDRD-NSHBD12#1
Wk04/22
6.8
VI
Wk04/22
6.9
VI
#(%%$1$-3( +&/2#&/2
"GHMDRD-NSHBD12#1
#&/2#( &1 ,2
CCRXLANK@MCKDFDMC#@EDMFHMONRHSHNMmȚ̥-mȚ̥$
"GHMDRD-NSHBD12#1
Wk04/22
6.10
VI
VOLUME 6, NP286(2), Second Edition, 2021 PAGE 305, POLAND, GDYNIA, Port, CONTACT DETAILS section.
Published Wk 20/21
Delete and replace by:
––––––––––––––––––
CONTACT DETAILS:
(Last Updates: Weekly Edition No. 3 dated 20 January 2022)
Port Radio Station
PAGES 304 & 305, POLAND, GDAûSK, Port section. Call: Gdynia Port Control
Delete and replace by: VHF Channel: Ch 16; 12
Hr Mr’s O̪ce
Port VHF Channel: Ch 16; 12
Telephone: +48(0)58 6202853 (KP)
CONTACT DETAILS: +48(0)58 6210705 (Duty O̪cer)
Port Control +48(0)58 6274930 (Secretariat)
Call: GdaĀsk Port Control Fax: +48(0)58 6616051 (Hr Mr’s O̪ce)
VHF Channel: Ch 16; 14 +48(0)58 6200591 (Duty O̪cer)
E-mail: kpgdynia@[Link]
Hr Mr’s O̪ce (Nowy Port)
Telephone: +48(0)58 3473800 (Secretariat) Berthing Master
Fax: +48(0)58 3430144 VHF Channel: Ch 16; 12
Telephone: +48(0)58 6274040
Hr Mr’s O̪ce (Northern Port) Fax: +48(0)58 6215370
VHF Channel: Ch 16; 14 E-mail: dyspozytor@[Link]
Telephone: +48(0)58 3473870 (Duty O̪cer, H24)
+48(0)58 3475051 (Deputy Hr Mr) Border Guard
+48(0)58 3473860 (Hr Mr’s O̪ce) VHF Channel: Ch 12
Fax: +48(0)58 3437512 Telephone: +48(0)58 6273500
E-mail: kpgdan@[Link] Marina
Berthing Master VHF Channel: Ch 16; 12
VHF Channel: Ch 16; 14 Telephone: +48(0)58 6619366
Telephone: +48(0)58 3073901 Fax: +48(0)58 6619429
E-mail: marina@[Link]
Border Guard
VHF Channel: Ch 14 Marina Yacht Park
Telephone: +48(0)58 5242090 VHF Channel: Ch 16; 12
+48(0)58 5242091 Telephone: +48(0)785 557777 (Mobile)
Fax: +48(0)58 5242700 Port Authority
+48(0)58 5242704 Telephone: +48(0)58 6274046
Port Authority Fax: +48(0)58 6274185
Telephone: +48(0)58 7379100 Website: [Link]
Fax: +48(0)58 7379485
E-mail: info@[Link] Polish Bulletin 50/21, (RSDRA2022000354260), 4/22
Website: [Link]
––––––––––––––––––––––––––––––
Deepwater Container Terminal
VHF Channel: Ch 17 22
Telephone: +48(0)58 3436317 VOLUME 6, NP286(6), Third Edition, 2022
E-mail: postbox@[Link] Published Wk 2/22
Website: [Link]
––––––––––––––––––
HOURS: H24
(Last Updates: Weekly Edition No. 2 dated 13 January 2022)
PROCEDURE:
Inward-bound vessels should report to GdaĀsk Port Control on VHF Ch 14 on passing PAGE 354, RUSSIA (Pacįc Coast), SLAVYANKA, Pilots, PROCEDURE,
Lt buoys NP or PP. section (3).
Delete and replace by:
NOTE:
The Hr Mr’s O̪ce provides information regarding the height of the water level.
(3) Pilot boards in position 42°53ț·81N 131°28ț·17E.
Wk04/22
6.11
VI
VOLUME 6, NP286(7), Second Edition, 2021 PAGE 110, CHILE, below PATILLOS entry.
Published Wk 6/21
Insert new entry:
Brazilian Bulletin 21/21 & Port of Macaé website, (RSDRA2021000318621 & RSDRA2022000001334), 4/22 Chilean Bulletin 12/21, (RSDRA2021000351590), 4/22
Brazilian Notice 23/197/21, (RSDRA2021000354333), 4/22 PAGES 205 to 208, UNITED ARAB EMIRATES, DAS, JAZäRAT (DAS
ISLAND).
Delete entry and replace by:
PAGE 93, CHILE, below CANAL O’BRIEN entry.
Insert new entry:
DAS, JAZäRAT (DAS ISLAND) 25°09ʥN 52°53ʥE
UNCTAD LOCODE: AE DAS
CANAL OCASIÓN 54°34ʥS 71°58ʥW
Pilots
Reporting System
HOURS: H24
CONTACT DETAILS:
PROCEDURE:
VHF Channel: Ch 16; 70
(1) Pilotage is compulsory for all vessels navigating within port limits.
PROCEDURE: (2) Pilot boards in position 25°10ț·00N 52°56ț·00E (Das Zirkħ North)
(1) Vessels must send a safety alert using DSC techniques on VHF Ch 70, 1h before
commencing navigation in the Canal Ocasión. continued on next page
(2) On completion of the safety alert vessels must then broadcast the safety signal
(SÉCURITÉ) in Spanish and English on VHF Ch 16. The following information must be
transmitted:
(a) Vessel’s name
(b) Position
(c) Direction of crossing and passage through which the vessel will be navigating
(d) ETA abeam Cabo Negro (54°32ț·85S 71°59ț·17W) and the Islotes Pájaros
(54°34ț·23S 71°57ț·31W)
(3) This information must be repeated every 15 mins until the completion of the
passage.
Wk04/22
6.12
VI
Vessel Tra̪c and Information Service (8) Reporting can also be carried out on the respective VHF channel of each sector
when within range:
AREA: (a) 6h before entering the VTIS Area/Sector, (by VHF, or as soon as in range)
The Das/Zirkħ sector of Das VTIS is bounded by the following positions: (b) 2h or 20 n miles (whichever comes ̨rst), thereafter at the time of entry into
(1) 25°16ț·60N 53°03ț·00E VTIS Sectors
(2) 25°08ț·10N 53°03ț·70E (c) 2h before leaving the Terminal and entering VTIS Area through agent and/or by
(3) 25°02ț·20N 53°08ț·30E VHF directly to the VTIS
(4) 25°04ț·00N 53°18ț·70E (9) SP-1 reports are submitted using the following format:
(5) 25°11ț·24N 53°27ț·10E (a) Vessel’s name
(6) 25°07ț·70N 53°30ț·70E (b) Vessel’s call sign and IMO number.
(7) 24°48ț·90N 53°11ț·00E (c) Date, time and point of entry into VTIS area (UTC)
(8) 24°48ț·90N 53°04ț·80E (d) Request a Pilot (Y/N), Pilot Station (East Ghash½/Ghash½)
(9) 25°00ț·00N 52°53ț·30E (e) Port/terminal bound for
(10) 25°04ț·50N 52°48ț·00E (f) Reporting position (name of Reporting Point)
(11) 25°14ț·00N 52°48ț·00E (g) Any dęciencies
(12) 25°26ț·50N 53°14ț·00E (10) SP-2 reports are submitted using the following format:
(13) 25°24ț·92N 53°17ț·40E (a) Vessel’s name
SERVICES: (b) Vessel’s position
Das VTIS provides the following services: (c) Date, time and point of entry into VTIS area (UTC)
(1) Information Service (d) Any dęciencies
(2) Tra̪c Organisation Service (11) Reporting Points: Active Participant vessels in passage through the VTIS area
(3) Navigational Assistance Service should provide a Call Point Position Report via VHF, to the VTIS, at the positions
designated. Furthermore, vessels should provide this report on any change of sector.
CONTACT DETAILS: The following format should be used:
Call: Das VTIS (a) Vessel’s name
VHF Channel: Ch 16; 12 23 (b) Position
Telephone: +971(0)2 6021727 (12) Inward-bound vessels using the Das Deep Water Approach Channel report at the
+971(0)2 6021728 following positions:
Fax: +971(0)2 6021600
Name Position Description
E-mail: vtisdas@[Link]
Website: [Link] 25°27ț·00N
RP 1 Das Approach Channel Lt buoy
[Link] 53°20ț·00E
25°25ț·20N
HOURS: H24 RP 2 Lt buoy No.1
53°12ț·40E
PROCEDURE: 25°20ț·60N
(1) Active Participant Vessels: The following vessels, calling at any of the RP 3 Das Deep Water Channel Lt buoy No.5
53°04ț·85E
Petroleum Ports, for whatever purpose, in passage through the VTIS Area shall be
designated as an “Active Participant”: 25°17ț·76N
RP 4 Das Deep Water Channel Lt buoy No.7
(a) Vessels of 50m LOA or above 53°01ț·24E
(b) Vessels carrying dangerous cargo, irrespective of its size 25°14ț·36N
RP 5 Das Deep Water Channel Lt buoy No.9
(c) Vessels carrying passengers, irrespective of its size 52°56ț·86E
(2) Passive Participant Vessels: The following vessels shall be designated as a
“Passive Participant”: (13) Outward-bound vessels using the Das Deep Water Approach Channel report at
(a) Vessels less than 50m LOA, calling at any of the petroleum ports, not carrying the following positions:
dangerous cargoes, or passengers Name Position Description
(b) Vessels on passage through the PPA-VTIS Area 25°14ț·16N
RP 1 Lt buoy No.10
REPORTING (ACTIVE PARTICIPANT): 52°59ț·73E
(1) Active Participant vessels shall submit SP-1 and SP-2 reports, in writing through 25°19ț·21N
RP 2 Lt buoy No.6
their agent or direct to the applicable VTIS sector. 53°06ț·09E
(2) Any changes to the Sailing Plan shall be immediately reported to the VTIS without
25°24ț·73N
any delay. RP 3 Lt buoy No.2
53°15ț·11E
(3) Reports shall be properly prepared in the standard format and sent to the VTIS in
a timely manner. 25°27ț·00N
RP 4 Das Approach Channel Lt buoy
(4) Vessels shall maintain a record of reporting details and all information provided by 53°20ț·00E
the VTIS in the ship’s log.
(5) Sailing Plan-1 (SP-1 report) shall be provided: REPORTING (PASSIVE PARTICIPANT):
(a) 72h before entering the VTIS sector (1) Passive Participant Vessels are required to actively participate in the VTIS reporting
(b) 2h before departure from the port and are advised to communicate their movements to the relevant VTIS centre, such
(6) Sailing Plan-2 (SP-2 report) shall be provided: vessels shall continuously monitor the VHF channel of the relevant VTIS and shall
(a) 48h before entering the VTIS sector ensure that the advice given by the VTIS is followed.
(b) 24h before entering the VTIS sector (2) Passive Participant vessels shall submit a Sailing Report through their agent or on
(7) All Active Participants shall report through their agent or directly to the relevant VHF directly to the VTIS 2h prior to and upon entering the VTIS area, in the following
VTIS sector. format:
(a) Vessel’s name, call sign and ̩ag
continued on next columnn (b) Vessel’s position
(c) Date, time and point of entry into VTIS area (UTC)
(d) Any dęciencies
Wk04/22
6.13
VI
Hr Mr/PFSO PROCEDURE:
Telephone: +971(0)2 6021722 (1) Pilotage is compulsory for all vessels navigating within port limits.
+971(0)2 6021723 (2) Pilot boards in the following position 25°00ț·00N 53°02ț·50E (Das Zirkħ South)
Fax: +971(0)2 6028950 Vessel Tra̪c and Information Service
E-mail: ppadas@[Link]
AREA:
Senior Vice President Petroleum Ports Authority - Abu Dhabi The Das/Zirkħ sector of Das VTIS is bounded by the followiing positions:
Telephone: +971(0)2 7071222 (1) 25°16ț·60N 53°03ț·00E
E-mail: jalkhamiri@[Link] (2) 25°08ț·10N 53°03ț·70E
Website: [Link] (3) 25°02ț·20N 53°08ț·30E
[Link] (4) 25°04ț·00N 53°18ț·70E
Das Island Agency (ADMA-OPCO) (5) 25°11ț·24N 53°27ț·10E
VHF Channel: Ch 16; 12 (6) 25°07ț·70N 53°30ț·70E
Telephone: +971(0)2 6063415 (7) 24°48ț·90N 53°11ț·00E
+971(0)2 6063897 (8) 24°48ț·90N 53°04ț·80E
Fax: +971(0)2 6068188 (9) 25°00ț·00N 52°53ț·30E
E-mail: oscdas.o̧shore@[Link] (10) 25°04ț·50N 52°48ț·00E
oasciidas.o̧shore@[Link] (11) 25°14ț·00N 52°48ț·00E
(12) 25°26ț·50N 53°14ț·00E
HOURS: H24 (13) 25°24ț·92N 53°17ț·40E
PROCEDURE: SERVICES:
(1) Notice of ETA: Vessels should advise ETA to the Das Hr Mr by e-mail at least 72h Das VTIS provides the following services:
prior to arrival. (1) Information Service
(2) Vessels should con̨rm or amend such information 48h, 24h and 12h prior to (2) Tra̪c Organisation Service
arrival. (3) Navigational Assistance Service
(3) Vessels should con̨rm their ̨nal ETA to Port Control on VHF Ch 16 or 12, 4h prior
to arrival. CONTACT DETAILS:
(4) Vessels anchoring should advise Port Control on VHF Ch 16 or 12 of the following: Call: Das VTIS
(a) Anchoring time (LT) VHF Channel: Ch 16; 12 23
(b) Anchoring position (bearing and distance from Tanker Berth No 6 (SPM) Telephone: +971(0)2 6021727
(25°08ț·04N 52°55ț·63E)) +971(0)2 6021728
(5) All vessels at anchor should maintain a continuous listening watch on VHF Chs 16 Fax: +971(0)2 6021600
and 12. E-mail: vtisdas@[Link]
(6) Vessels departing from the anchorage must obtain prior approval from Port Control Website: [Link]
by stating the following information: [Link]
(a) Intended time of heaving up anchor HOURS: H24
(b) Reason for departure
(c) Time of departure PROCEDURE:
(1) Active Participant Vessels: The following vessels, calling at any of the
NOTE: Petroleum Ports, for whatever purpose, in passage through the VTIS Area shall be
Station is operated by Abu Dhabi National Oil Co, Petroleum Ports Authority (ADNOC- designated as an “Active Participant”:
PPA). (a) Vessels of 50m LOA or above
(b) Vessels carrying dangerous cargo, irrespective of its size
ADNOC correspondence, (RSDRA2022000002921), 4/22 (c) Vessels carrying passengers, irrespective of its size
(2) Passive Participant Vessels: The following vessels shall be designated as a
“Passive Participant”:
(a) Vessels less than 50m LOA, calling at any of the petroleum ports, not carrying
dangerous cargoes, or passengers
(b) Vessels on passage through the PPA-VTIS Area
REPORTING (ACTIVE PARTICIPANT):
(1) Active Participant vessels shall submit SP-1 and SP-2 reports, in writing through
their agent or direct to the applicable VTIS sector.
(2) Any changes to the Sailing Plan shall be immediately reported to the VTIS without
any delay.
(3) Reports shall be properly prepared in the standard format and sent to the VTIS in
a timely manner.
Wk04/22
6.14
VI
(4) Vessels shall maintain a record of reporting details and all information provided by Port
the VTIS in the ship’s log.
(5) Sailing Plan-1 (SP-1 report) shall be provided: CONTACT DETAILS:
(a) 72h before entering the VTIS sector Port Control
(b) 2h before departure from the port Call: Das Port Control
(6) Sailing Plan-2 (SP-2 report) shall be provided: VHF Channel: Ch 16; 12
(a) 48h before entering the VTIS sector Telephone: +971(0)2 6021726
(b) 24h before entering the VTIS sector +971(0)2 6028996
(7) All Active Participants shall report through their agent or directly to the relevant +971(0)2 8733029
VTIS sector. E-mail: pctas.o̧shore@[Link]
(8) Reporting can also be carried out on the respective VHF channel of each sector
when within range: Hr Mr/PFSO
(a) 6h before entering the VTIS Area/Sector, (by VHF, or as soon as in range) Telephone: +971(0)2 6021722
(b) 2h or 20 n miles (whichever comes ̨rst), thereafter at the time of entry into +971(0)2 6021723
VTIS Sectors Fax: +971(0)2 6028950
(c) 2h before leaving the Terminal and entering VTIS Area through agent and/or by E-mail: ppadas@[Link]
VHF directly to the VTIS Senior Vice President Petroleum Ports Authority - Abu Dhabi
(9) SP-1 reports are submitted using the following format: Telephone: +971(0)2 7071222
(a) Vessel’s name E-mail: jalkhamiri@[Link]
(b) Vessel’s call sign and IMO number. Website: [Link]
(c) Date, time and point of entry into VTIS area (UTC) [Link]
(d) Request a Pilot (Y/N), Pilot Station (East Ghash½/Ghash½)
(e) Port/terminal bound for Zirku ADNOC O̧shore Agency
(f) Reporting position (name of Reporting Point) Telephone: +971(0)2 6080716
(g) Any dęciencies +971(0)2 6056251
(10) SP-2 reports are submitted using the following format: Fax: +971(0)2 6080718
(a) Vessel’s name +971(0)2 6056251
(b) Vessel’s position E-mail: osogszirku.o̧shore@[Link]
(c) Date, time and point of entry into VTIS area (UTC)
HOURS: H24
(d) Any dęciencies
(11) Reporting Points: Active Participant vessels in passage through the VTIS area PROCEDURE:
should provide a Call Point Position Report via VHF, to the VTIS, at the positions (1) Notice of ETA: Vessels should advise ETA to the Das Hr Mr by e-mail at least 72h
designated. Furthermore, vessels should provide this report on any change of sector. prior to arrival.
The following format should be used: (2) Vessels should con̨rm or amend such information 48h, 24h and 12h prior to
(a) Vessel’s name arrival.
(b) Position (3) Vessels should con̨rm their ̨nal ETA to Port Control on VHF Ch 16 or 12, 4h prior
(12) Inward-bound vessels using the Zaqqum Channel report at the following positions: to arrival.
Name Position Description (4) Vessels anchoring should advise Port Control on VHF Ch 16 or 12 of their
anchoring time (LT)
25°06ț·50N
RP 1 Zaqqum Lt buoy (5) All vessels at anchor should maintain a continuous listening watch on VHF Chs 16
53°25ț·00E
and 12.
25°02ț·5N (6) Vessels departing from the anchorage must obtain prior approval from Port Control
RP 2 Zaqqum East Lt buoy
53°19ț·60E by stating the following information:
24°56ț·70N (a) Intended time of heaving up anchor
RP 3 Zaqqum West Lt buoy (b) Reason for departure
52°59ț·80E
(c) Time of departure
(13) Outward-bound vessels using the Zaqqum Channel report at the following
positions: ADNOC correspondence, (RSDRA2022000003036), 4/22
Name Position Description
24°56ț·70N ––––––––––––––––––––––––––––––
RP 1 Zaqqum West Lt buoy
52°59ț·80E
25°02ț·5N
RP 2 Zaqqum East Lt buoy
53°19ț·60E
25°06ț·50N
RP 3 Zaqqum Lt buoy
53°25ț·00E
Wk04/22
6.15
VII
As a result of ongoing effects of COVID-- 19 on distribution infrastructure around the world, for
safety reasons, we took the decision a few months ago to delay the publication of any non--essential
ADMIRALTY Nautical Publications until further notice.
We started to ease the restrictions on the dispatch of some of our paper publications for July 2020.
We are continuing this effort and following some positive feedback on successful receipts of
publications, we are now in a position to confirm the publications schedule for the rest of the year.
As previously, we will continue to closely monitor our distribution network capacities.
We reserve ourselves the right to amend this publications schedule accordingly should significant
dispatch issues start arising again.
7.1
Wk04/22
VIII
A list of ENCs temporarily withdrawn from AVCS for safety reasons can be found in the README file and the ‘Updates’ tab at
[Link]/AVCS
This file should be consulted each week to ensure that all related issues are taken into consideration. The file header indicates the last
time that the README file was updated and the date that it was issued.
Mariners should take temporary information into account when planning and executing a passage with ENCs and most ENC producers
now include temporary information in their ENCs. It is usually compiled as normal ENC updates, sometimes with the start and end dates
attributed or described as ‘Temporary’ in the pick report.
The latest confirmed status of T&P NM information in the ENCs that are available in ADMIRALTY services is shown in the ENC-
T&[Link] file in the INFO folder on the service media and at: [Link]/ENC-TP-NMs. Note that T&P NMs are
compiled for paper charts and may not align with any temporary information that is compiled into ENCs.
ADMIRALTY Information Overlay (AIO) includes ADMIRALTY T&P NMs for paper charts where the ENC Producer has not
confirmed that they include temporary information in their ENCs.
Further guidance can be found in the AIO User Guide in the INFO folder on AIO media and on the Support tab at [Link]/avcs.
Because of the limit to data volume that can be fitted onto a disc, AVCS Base and Update CDs are only available as .zip files to
download from the UKHO FTP Site.
e) Important notice for users of AVCS and ARCS Online Updating Services (AVCS OUS and ARCS OUS)
The email service for AVCS OUS was withdrawn at the end of February 2019 due to technology infrastructure changes at UKHO.
iv. ADMIRALTY Guide to ECDIS Implementation, Policy and Procedures (NP232). Provides clear guidance for any individual
or organisation responsible for the introduction of ECDIS, in particular those involved in the development of detailed ECDIS
operating procedures.
8.1
Wk 04/22
VIII
For information: Please note that there will not be a 2022 ADP release.
Historically we have made new versions of the ADP software available at the end of each year however, there will be no commercial
release of ADP this year. Regular changes/improvements have been made throughout the year and therefore there is no value in issuing
a new Software version.
The only change this year is a new Base Dataset for Week 42/21 will be added to V19 to refresh the Base Data from the current Week
40/20 to Week 40/21. Nothing else has changed on this V19 version.
The ADP software and the Data updates can still be downloaded from weekly ADP and AENP Update DVDs.
Users can also download ADP directly on the Distributors FTP Site at [Link]
For information: Ensure that Activation Key Requests and Update Data Requests for ADP are sent to ADPMailGateway@[Link]
There is currently an e-Reader 1.3 enabling users to read Digital copies of our Sailing Directions paper publications.
A new e-Reader 1.4 was released to the Channel on 01/10/2020. This version 1.4 has got the same functionalities as the current version
1.3 but is more performant and user-friendly. While the current 1.3 version can be used on Windows 7 and 8.1 Operating Systems (OS),
the e-Reader 1.4 can only be used on Windows 8.1 and 10 OS, to follow the Microsoft guidelines of withdrawing support for Windows
7 OS.
To enable users to activate this new application, users might need to delete one e-Reader application from their Fleet Manager Licences
if the maximum 3 allowed has been reached.
Both the e-Readers 1.3 and 1.4 are supported at the UKHO.
The e-Reader 1.4 software and the Data updates can be downloaded from weekly ADP Update and Software DVDs.
Users can also download the e-Reader 1.4 software directly on the Distributors FTP Site at [Link]
8.2
Wk 04/22
VIII
ADMIRALTY Vector Chart Service (AVCS) DVDs and ADMIRALTY Information Overlay (AIO) CDs are issued
weekly and contain all base and update data available at the time of issue.
If you are using an unsupported version, contact your Chart Agent to upgrade to the latest version as soon as possible.
8.3
Wk 04/22
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
NAME OF PORT
GENERAL REMARKS
Principal activities and trade.
Latest population figures and date.
ANCHORAGES
Designation, depths, holding ground,
shelter afforded.
PILOTAGE
Authority for requests.
Embark position.
Regulations.
DIRECTIONS
Entry and berthing information.
Tidal streams.
Navigational aids.
TUGS
Number available.
WHARVES
Names, numbers or positions & lengths.
Depths alongside.
CARGO HANDLING
Containers, lighters, Ro-Ro etc.
REPAIRS
Hull, machinery and underwater.
Shipyards.
Divers.
HYDROGRAPHIC NOTE FOR PORT
H.102A
INFORMATION (V7.0 Jan 2013)
(To accompany Form H.102)
SUPPLIES
Fuel.
(with type, quantities and methods of
delivery)
Fresh water.
(with method of delivery and rate of
supply)
Provisions.
SERVICES
Medical.
Ship Sanitation.
COMMUNICATIONS
Nearest airport or airfield.
PORT AUTHORITY
Designation, address, telephone, e-mail
address and website.
VIEWS
Photographs (where permitted) of the
approaches, leading marks, the entrance
to the harbour etc.
ADDITIONAL DETAILS
NOTES:
1. Form H.I02A lists the information required for ADMIRALTY Sailing Directions and has been designed to help the
sender and the recipient. The sections should be used as an aide-memoir, being used or followed closely,
whenever appropriate. Where there is insufficient space on the form an additional sheet should be used.
2. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings
should be stressed and any firm expectation of being able to check the information on a succeeding voyage should
be mentioned.
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)
Chart/ENC in use
(SEE NOTE 3a) Latitude/Longitude of position read Latitude/Longitude of position read from Additional
Time/Date of
Edition Date & from Chart/ECDIS GNSS Receiver (on WGS84) Information/Remarks
Observation Number /
NM / ENC (SEE NOTE 3b) (SEE NOTE 3c) (SEE NOTE 3d)
ENC
update status
HYDROGRAPHIC NOTE FOR
GNSS OBSERVATIONS AGAINST CORRESPONDING BRITISH ADMIRALTY H.102B
(V7.0 Jan 2014)
CHART POSITIONS
(To accompany Form H.102)
NOTES:
1. This form is designed to assist in the reporting of observed differences between WGS84 datum and the geodetic datum of British
ADMIRALTY Charts by mariners, including yachtsmen and should be submitted as an accompaniment to Form H.102 (full instructions
for the rendering of data are on Form H.102). Where there is insufficient space on the form an additional sheet should be used.
The UK Hydrographic Office would appreciate the reporting of Global Navigation Satellite Systems (GNSS) positions, referenced to WGS84 datum, at
identifiable locations or features on British ADMIRALTY Charts. Such observations could be used to calculate positional shifts between WGS84 datum and the
geodetic datum for those British ADMIRALTY Charts which it has not yet been possible to compute the appropriate shifts. These would be incorporated in future
new editions or new charts and promulgated by Preliminary Notices to Mariners in the interim.
It is unrealistic to expect that a series of reported WGS84 positions relating to a given chart will enable it to be referenced to that datum with the accuracy
required for geodetic purposes. Nevertheless, this provides adequate accuracy for general navigation, considering the practical limits to the precision of 0.2mm
(probably the best possible under ideal conditions – vessel alongside, good light, sharp dividers etc), this represents 10 metres on the ground at a chart scale of
1:50.000.
It is clear that users prefer to have some indication of the magnitude and direction of the positional shift, together with an assessment of its likely accuracy,
rather than be informed that a definitive answer cannot be formulated. Consequently, where a WGS84 version has not yet been produced, many charts now
carry approximate shifts relating WGS84 datum to the geodetic datum of the chart. Further observations may enable these values to be refined with greater
confidence.
3. Details required
a. It is essential that the chart number, edition date and its correctional state (latest NM) are stated. For ENCs, please state the ENC name and latest
update applied.
b. Position (to 2 decimal places of a minute) of observation point, using chart graticule or, if ungraduated, relative position by bearing/distance from
prominent charted features (navigation lights, trig. points, church spires etc.).
c. Position (to 2 decimal places of a minute) of observation point, using GNSS Receiver. Confirm that GNSS positions are referenced to WGS84 datum.
d. Include GNSS receiver model and aerial type (if known). Also of interest: values of PDOP, HDOP or GDOP displayed (indications of theoretical
quality of position fixing depending upon the distribution of satellites overhead) and any other comments.
HYDROGRAPHIC NOTE ± H.102 INSTRUCTIONS (V9.0 Dec 2017)
1. Mariners are requested to notify the United Kingdom Hydrographic Office (UKHO) when new or suspected dangers to
navigation are discovered, changes observed in aids to navigation, or corrections to publications are seen to be necessary.
Mariners can also report any ENC display issues experienced. The Mariner's Handbook (NP100) Chapter 4 gives general
instructions. The provisions of international and national laws should be complied with when forwarding such reports.
2. Accurate position or knowledge of positional error is of great importance. Where latitude and longitude have been used to
specifically position the details of a report, a full description of the method used to obtain the position should be given. Where
possible the position should be fixed by GPS or Astronomical Observations. A full description of the method, equipment,
time, estimated error and datum (where applicable) used should be given. Where the position has been recorded from a
smart phone or tablet, this is to be specifically mentioned. When position is defined by sextant angles or bearings (true or
magnetic to be specified), more than two should be used to provide a redundancy check. Where position is derived from
Electronic Position Fixing (e.g. LORAN C) or distances observed by radar, the raw readings of the system in use should be
quoted wherever possible. Where position is derived after the event, from other observations and / or Dead Reckoning, the
methodology of deriving the position should be included.
3. Paper Charts: A cutting from the largest scale chart is often the best medium for forwarding details, the alterations and
additions being shown thereon in red. When requested, a new copy will be sent in replacement of a chart that has been
used to forward information, or when extensive observations have involved defacement of the observer's chart. If it is
preferred to show the amendments on a tracing of the largest scale chart (rather than on the chart itself) these should be in
red as above, but adequate details from the chart must be traced in black ink to enable the amendments to be fitted correctly.
4. ENCs: A screen shot of the largest scale usage band ENC with the alterations and additions being shown thereon in red.
If it is to report an issue with the display of an ENC, a screen shot of the affected ENC should be sent along with details of
the ECDIS make, model or age and version in use at the time.
5. When soundings are obtained The Mariner's Handbook (NP100) should where possible be consulted. It is important to
ensure that full details of the method of collection are included with the report. This should include but not limited to:
(a) Make, model and type of echo sounder used.
(b) Whether the echo sounder is set to register depths below the surface or below the keel; in the latter case the vessel's
draught should be given.
(c) Time, date and time zone should be given in order that corrections for the height of the tide may be made where
necessary, or a statement made as to what corrections for tide have already been made.
(d) Where larger amounts of bathymetric data have been gathered, only those areas where a significant difference to
the current chart or ENC should be specifically mentioned on the H102. The full data set may also be sent in, with
an additional note added to this effect. If no significant differences are noted, the bathymetric data may still be of
use, and sent in accordingly. Where full data sets are included, a note as to the data owner and their willingness for
the data to be incorporated into charts and ENCs included.
6. FRU (FKR 6RXQGHUV WKDW XVH HOHFWURQLF µUDQJH JDWLQJ¶ FDUH VKRXOG be taken that the correct range scale and
appropriate gate width are in use. Older electro-mechanical echo sounders frequently record signals from echoes
received back after one or more rotations of the stylus have been completed. Thus, with a set whose maximum range is
500m, an echo recorded at 50m may be from depths of 50m, 550m or even 1050m. Soundings recorded beyond the set's
nominal range can usually be recognised by the following:
(a) the trace being weaker than normal for the depth recorded;
(b) the trace passing through the transmission line;
(c) the feathery nature of the trace.
As a check that apparently shoal soundings are not due to echoes received beyond the set's nominal range,
soundings should be continued until reasonable agreement with charted soundings is reached. However,
soundings received after one or more rotations of the stylus can still be useful and should be submitted if they
show significant differences from charted depths.
7. Reports which cannot be confirmed or are lacking in certain details should not be withheld. Shortcomings should
be stressed and any firm expectation of being able to check the information on a succeeding voyage should be mentioned.
8. Reports of shoal soundings, uncharted dangers and aids to navigation out of order should, at the mariner's discretion, also
be made by radio to the nearest coast radio station. The draught of modern tankers is such that any uncharted depth under
30 metres or 15 fathoms may be of sufficient importance to justify a radio message.
9. Changes to Port Information should be forwarded on Form H.102A and any GPS/Chart Datum observations should be
forwarded on Form H.102B together with Form H.102. Where there is insufficient space on the forms additional sheets
should be used.
10. Reports on ocean currents, magnetic variations and other marine observations should be made in accordance with
The Mariner's Handbook (NP100) Chapter 4 with forms also available at [Link]/MSI.
Note. - An acknowledgement or receipt will be sent and the information then used to the best advantage which may mean
immediate action or inclusion in a revision in due course; for these purposes, the UKHO may make reproductions of any
material supplied. When a Notice to Mariners is issued, the sender's ship or name is quoted as authority unless (as
sometimes happens) the information is also received from other authorities or the sender states that they do not want to
be named by using the appropriate tick box on the form. An explanation of the use made of contributions from all parts of
the world would be too great a task and a further communication should only be expected when the information is of
outstanding value or has unusual features.
Hydrographic Note ± H.102
Reporting information affecting ADMIRALTY Maritime Products & Services
For emergency information affecting safety of life at sea forward to: navwarnings@[Link]
Or alternatively contact T: +44 (0)1823 353448 (direct line) +44 (0)7989 398345 (mobile) F: +44 (0)1823 322352
For new information affecting all ADMIRALTY Charts and Publications forward to: sdr@[Link]
This form H.102 and instructions are available online: [Link]/msi
Subject
Position
Latitude Longitude
(see Instruction 2)