0% found this document useful (0 votes)
136 views350 pages

Amber Tools

AmberTools consists of several independently developed packages that work well with amber itself. Most of the programs included here can be redistributed and / or modified under the terms of the GNU General Public License.

Uploaded by

laksh688
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
136 views350 pages

Amber Tools

AmberTools consists of several independently developed packages that work well with amber itself. Most of the programs included here can be redistributed and / or modified under the terms of the GNU General Public License.

Uploaded by

laksh688
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

AmberTools

Users‛ Manual
AmberTools Users’ Manual
Version 1.4, April 25, 2010

AmberTools consists of several independently developed packages that work well with Amber
itself. The main components of AmberTools are listed below.

NAB (Nucleic Acid Builder) PBSA


Thomas J. Macke,1 W.A. Svrcek-Seiler,2 Jun Wang, Qin Cai, Xiang Ye, Meng-Juei
Russell A. Brown, 3 István Kolossváry,4 Hsieh, Chuck Tan, and Ray Luo12
Yannick J. Bomble13 and David A. Case5
Sqm
LEaP and gleap
Ross C. Walker15 , Michael F. Crowley13 ,
Wei Zhang,6 Tingjun Hou,7 Christian Scott Brozell, Tim Giese17 , Andreas W.
Schafmeister,8 Wilson S. Ross, and David A. Goetz15 ,and David A. Case
Case
CHAMBER
Antechamber
Michael F. Crowley, Mark Williamson15 ,
Junmei Wang10 Ross C. Walker

Ptraj 3D-RISM
Thomas E. Cheatham, III,11 , et al. (see Tyler Luchko5 , David A. Case, Sergey
[Link] Gusarov16 , Andriy Kovalenko16

1 Kosmix Corporation; 2 University of Vienna ; 3 Sun Microsystems, Inc. ; 4 Budapest University


of Technology and Economics and D.E. Shaw Research, LLC; 5 Rutgers University; 6 Univ. of
Texas, Health Center at Houston; 7 Univ. of California, San Diego; 8 University of
Pittsburgh;10 Univ. of Texas, Southwestern Medical Center; 11 University of Utah;
12 University of California, Irvine, 13 NREL, 14 SUNY Stony Brook,15 San Diego Supercomputer

Center, 16 National Institute for Nanotechnology, University of Alberta, 17 University of


Minnesota

1
Notes

• Most of the programs included here can be redistributed and/or modified under the terms
of the GNU General Public License; a few components have other open-source licenses.
See the amber11/AmberTools/LICENSE file for details. The programs are distributed in
the hope that they will be useful, but WITHOUT ANY WARRANTY; without even the
implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PUR-
POSE.

• Some of the force field routines were adapted from similar routines in the MOIL program
package: R. Elber, A. Roitberg, C. Simmerling, R. Goldstein, H. Li, G. Verkhivker, C.
Keasar, J. Zhang and A. Ulitsky, "MOIL: A program for simulations of macromolecules"
Comp. Phys. Commun. 91, 159-189 (1995).
• The "trifix" routine for random pairwise metrization is based on an algorithm designed
by Jay Ponder and was adapted from code in the Tinker package; see M.E. Hodsdon, J.W.
Ponder, and D.P. Cistola, J. Mol. Biol. 264, 585-602 (1996) and [Link]
• The "molsurf" routines for computing molecular surface areas were adapted from routines
written by Paul Beroza. The "sasad" routine for computing derivatives of solvent acces-
sible surface areas was kindly provided by S. Sridharan, A. Nicholls and K.A. Sharp. See
J. Computat. Chem. 8, 1038-1044 (1995).
• Some of the “pb_exmol” routines for mapping molecular surface to finite-difference grids
were adapted from routines written by Michael Gilson and Malcolm Davis in UHBD. See
Comp. Phys. Comm. 91, 57-95 (1995).
• The cifparse routines to deal with mmCIF formatted files were written by John West-
brook, and are distributed with permission. See cifparse/README for details.
• Sun, Sun Microsystems and Sun Performance Library are trademarks or registered trade-
marks of Sun Microsystems, Inc. in the United States and other countries.

Cover Illustration

The cover symbolizes the entangled, endless (yet finite) and somewhat imperfect nature of
the code at hand. This is a (2, 3) torus knot ([Link]
generated from a slightly modified program #9 from NAB, using a parametric representa-
tion of the knot, and rendered using chimera [1] and povray ([Link] by
Volodymyr Babin.

2
Contents

Contents 3

1 Getting started 11
1.1 Information flow in Amber . . . . . . . . . . . . . . . . . . . . . . . . . . . . 11
1.1.1 Preparatory programs . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
1.1.2 Simulation programs . . . . . . . . . . . . . . . . . . . . . . . . . . . 12
1.1.3 Analysis programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
1.2 Installation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 13
1.3 Contacting the developers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 15

2 Specifying a force field 17


2.1 Specifying which force field you want in LEaP . . . . . . . . . . . . . . . . . 18
2.2 The AMOEBA potentials . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 19
2.3 The Duan et al. (2003) force field . . . . . . . . . . . . . . . . . . . . . . . . 19
2.4 The Yang et al. (2003) united-atom force field . . . . . . . . . . . . . . . . . . 20
2.5 1999 force fields and recent updates . . . . . . . . . . . . . . . . . . . . . . . 20
2.6 The 2002 polarizable force fields . . . . . . . . . . . . . . . . . . . . . . . . . 22
2.7 Force related to semiempirical QM . . . . . . . . . . . . . . . . . . . . . . . . 23
2.8 GLYCAM-06 and GLYCAM-04EP force fields for carbohydrates and lipids . . 23
2.8.1 List of relevant files shipped with AMBER 11. . . . . . . . . . . . . . 23
2.8.2 File versioning and obtaining the latest parameters. . . . . . . . . . . . 24
2.8.3 General information regarding parameter development . . . . . . . . . 24
2.8.4 Scaling of electrostatic and nonbonded interactions . . . . . . . . . . . 24
2.8.5 Development of partial atomic charges . . . . . . . . . . . . . . . . . . 25
2.8.6 Carbohydrate parameters for use with the TIP5P water model . . . . . 25
2.8.7 Carbohydrate Naming Convention in GLYCAM . . . . . . . . . . . . 25
2.9 Ions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 29
2.10 Solvent models . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 30
2.11 Obsolete force field files . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 31
2.11.1 The Cornell et al. (1994) force field . . . . . . . . . . . . . . . . . . . 31
2.11.2 The Weiner et al. (1984,1986) force fields . . . . . . . . . . . . . . . . 32
2.12 CHAMBER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 33
2.12.1 Usage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 37
2.12.2 Validation . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 38
2.12.3 Known limitations / Issues . . . . . . . . . . . . . . . . . . . . . . . . 38
2.12.4 Acknowledgments . . . . . . . . . . . . . . . . . . . . . . . . . . . . 39

3
CONTENTS

3 LEaP 41
3.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41
3.2 Concepts . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41
3.2.1 Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 41
3.2.2 Variables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42
3.2.3 Objects . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 42
3.3 Basic instructions for using LEaP . . . . . . . . . . . . . . . . . . . . . . . . . 46
3.3.1 Building a Molecule For Molecular Mechanics . . . . . . . . . . . . . 47
3.3.2 Amino Acid Residues . . . . . . . . . . . . . . . . . . . . . . . . . . 47
3.3.3 Nucleic Acid Residues . . . . . . . . . . . . . . . . . . . . . . . . . . 48
3.4 Commands . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
3.4.1 add . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 48
3.4.2 addAtomTypes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 49
3.4.3 addIons . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
3.4.4 addIons2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
3.4.5 addPath . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
3.4.6 addPdbAtomMap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 50
3.4.7 addPdbResMap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 51
3.4.8 alias . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52
3.4.9 bond . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52
3.4.10 bondByDistance . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52
3.4.11 check . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 52
3.4.12 combine . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53
3.4.13 copy . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 53
3.4.14 createAtom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
3.4.15 createResidue . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
3.4.16 createUnit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
3.4.17 deleteBond . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
3.4.18 desc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 54
3.4.19 groupSelectedAtoms . . . . . . . . . . . . . . . . . . . . . . . . . . . 55
3.4.20 help . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56
3.4.21 impose . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 56
3.4.22 list . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.4.23 loadAmberParams . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.4.24 loadAmberPrep . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.4.25 loadOff . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 57
3.4.26 loadMol2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
3.4.27 loadPdb . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
3.4.28 loadPdbUsingSeq . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
3.4.29 logFile . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 58
3.4.30 measureGeom . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59
3.4.31 quit . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59
3.4.32 remove . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 59
3.4.33 saveAmberParm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60
3.4.34 saveMol2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60

4
CONTENTS

3.4.35 saveOff . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60
3.4.36 savePdb . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 60
3.4.37 sequence . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61
3.4.38 set . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 61
3.4.39 solvateBox and solvateOct . . . . . . . . . . . . . . . . . . . . . . . . 63
3.4.40 solvateCap . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 63
3.4.41 solvateShell . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64
3.4.42 source . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64
3.4.43 transform . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 64
3.4.44 translate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65
3.4.45 verbosity . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65
3.4.46 zMatrix . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 65
3.5 Building oligosaccharides and lipids . . . . . . . . . . . . . . . . . . . . . . . 66
3.5.1 Procedures for building oligosaccharides using the GLYCAM 06 pa-
rameters . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 67
3.5.2 Procedures for building a lipid using GLYCAM 06 parameters . . . . . 70
3.5.3 Procedures for building a glycoprotein in LEaP. . . . . . . . . . . . . . 71
3.6 Differences between tleap and sleap . . . . . . . . . . . . . . . . . . . . . . . 73
3.6.1 Limitations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 73
3.6.2 Unsupported Commands . . . . . . . . . . . . . . . . . . . . . . . . . 73
3.6.3 New Commands or New Features of old Commands . . . . . . . . . . 73
3.6.4 New keywords . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 74
3.6.5 The basic idea behind the new commands . . . . . . . . . . . . . . . . 75

4 Antechamber 77
4.1 Principal programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78
4.1.1 antechamber . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 78
4.1.2 parmchk . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 80
4.2 A simple example for antechamber . . . . . . . . . . . . . . . . . . . . . . . . 81
4.3 Programs called by antechamber . . . . . . . . . . . . . . . . . . . . . . . . . 84
4.3.1 atomtype . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 84
4.3.2 am1bcc . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 85
4.3.3 bondtype . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 86
4.3.4 prepgen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87
4.3.5 espgen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 87
4.3.6 respgen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 88
4.4 Miscellaneous programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89
4.4.1 acdoctor . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 89
4.4.2 database . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90
4.4.3 parmcal . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90
4.4.4 residuegen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 90
4.4.5 top2ff . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 91
4.4.6 top2mol2 . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92
4.4.7 translate . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 92

5
CONTENTS

4.5 New Development of Antechamber And GAFF . . . . . . . . . . . . . . . . . 93


4.5.1 Extensive Test of AM1-BCC Charges . . . . . . . . . . . . . . . . . . 94
4.5.2 New Development of GAFF . . . . . . . . . . . . . . . . . . . . . . . 94

5 Semiempirical quantum chemistry 97


5.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 97
5.2 General &qmmm Namelist Variables . . . . . . . . . . . . . . . . . . . . . . . 98

6 ptraj 103
6.1 Understanding ptraj commands and actions . . . . . . . . . . . . . . . . . . . 104
6.2 ptraj coordinate input/output commands . . . . . . . . . . . . . . . . . . . . . 105
6.3 ptraj commands that override the molecular information specified . . . . . . . 107
6.4 ptraj action commands - short list . . . . . . . . . . . . . . . . . . . . . . . . 108
6.5 ptraj action commands - detailed discussion . . . . . . . . . . . . . . . . . . . 108
6.6 Correlation and fluctuation facility . . . . . . . . . . . . . . . . . . . . . . . . 122
6.7 Parallel ptraj . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 126
6.8 Examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 127
6.8.1 Calculating and analyzing matrices and modes . . . . . . . . . . . . . 128
6.8.2 Projecting snapshots onto modes . . . . . . . . . . . . . . . . . . . . . 128
6.8.3 Calculating time correlation functions . . . . . . . . . . . . . . . . . . 128
6.9 Hydrogen bonding facility . . . . . . . . . . . . . . . . . . . . . . . . . . . . 129
6.10 rdparm . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 131
6.11 AMBER Trajectory NetCDF Format . . . . . . . . . . . . . . . . . . . . . . . 133
6.11.1 Program behavior . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 133
6.11.2 NetCDF file encoding . . . . . . . . . . . . . . . . . . . . . . . . . . 133
6.11.3 Global attributes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 134
6.11.4 Dimensions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135
6.11.5 Label variables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 135
6.11.6 Data variables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 136
6.11.7 Example . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 137

7 PBSA 139
7.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 139
7.1.1 Numerical solutions of the PB equation . . . . . . . . . . . . . . . . . 140
7.1.2 Numerical interpretation of energy and forces . . . . . . . . . . . . . . 141
7.1.3 Numerical accuracy and related issues . . . . . . . . . . . . . . . . . . 142
7.2 Usage and keywords . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143
7.2.1 File usage . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143
7.2.2 Basic input options . . . . . . . . . . . . . . . . . . . . . . . . . . . . 143
7.2.3 Options to define the physical constants . . . . . . . . . . . . . . . . . 145
7.2.4 Options to select numerical procedures . . . . . . . . . . . . . . . . . 146
7.2.5 Options to compute energy and forces . . . . . . . . . . . . . . . . . . 147
7.2.6 Options for visualization and output . . . . . . . . . . . . . . . . . . . 149
7.2.7 Options to select a non-polar solvation treatment . . . . . . . . . . . . 149

6
CONTENTS

7.3 Example inputs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 151


7.3.1 Single-point calculation of solvation free energies . . . . . . . . . . . . 151
7.3.2 Visualization of electrostatic potentials . . . . . . . . . . . . . . . . . 152
7.3.3 Single point calculation of forces . . . . . . . . . . . . . . . . . . . . 153
7.3.4 Comparing with Delphi results . . . . . . . . . . . . . . . . . . . . . . 153
7.4 PBSA in SANDER . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 154
7.5 PBSA in NAB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 154
7.5.1 Electrostatic Forces/Gradients in PBSA . . . . . . . . . . . . . . . . . 155
7.5.2 Example . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 155

8 Reference Interaction Site Model of Molecular Solvation 157


8.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 157
8.1.1 1D-RISM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 159
8.1.2 3D-RISM . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 160
8.2 Practical Considerations . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 161
8.2.1 Computational Requirements and Parallel Scaling . . . . . . . . . . . . 161
8.2.2 Output . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
8.2.3 Numerical Accuracy . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
8.3 Work Flow . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 162
8.4 rism1d . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 163
8.4.1 Parameters keywords . . . . . . . . . . . . . . . . . . . . . . . . . . . 163
8.4.2 Example . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 165
8.5 3D-RISM in NAB . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166
8.5.1 Solvation Box Size . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166
8.5.2 I/O . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166
8.5.3 Examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 166
8.5.4 Compiling MPI 3D-RISM . . . . . . . . . . . . . . . . . . . . . . . . 167
8.6 File Formats . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 167
8.6.1 MDL . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 167
8.6.2 XVV . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 169
8.6.3 OpenDX . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 170

9 Miscellaneous utilities 173


9.1 ambpdb . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 173
9.2 reduce . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 175
9.2.1 Running reduce . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 175
9.2.2 General input flags . . . . . . . . . . . . . . . . . . . . . . . . . . . . 176
9.2.3 Fixing an orientation . . . . . . . . . . . . . . . . . . . . . . . . . . . 177
9.2.4 Cliques . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 178
9.2.5 Contact . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 178
9.3 elsize . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 178

7
CONTENTS

10 NAB: Introduction 181


10.1 Background . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 182
10.1.1 Conformation build-up procedures . . . . . . . . . . . . . . . . . . . . 183
10.1.2 Base-first strategies . . . . . . . . . . . . . . . . . . . . . . . . . . . . 183
10.2 Methods for structure creation . . . . . . . . . . . . . . . . . . . . . . . . . . 184
10.2.1 Rigid-body transformations . . . . . . . . . . . . . . . . . . . . . . . 184
10.2.2 Distance geometry . . . . . . . . . . . . . . . . . . . . . . . . . . . . 185
10.2.3 Molecular mechanics . . . . . . . . . . . . . . . . . . . . . . . . . . . 186
10.3 Compiling nab Programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187
10.4 Parallel Execution . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 187
10.5 First Examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 188
10.5.1 B-form DNA duplex . . . . . . . . . . . . . . . . . . . . . . . . . . . 188
10.5.2 Superimpose two molecules . . . . . . . . . . . . . . . . . . . . . . . 189
10.5.3 Place residues in a standard orientation . . . . . . . . . . . . . . . . . 190
10.6 Molecules, Residues and Atoms . . . . . . . . . . . . . . . . . . . . . . . . . 191
10.7 Creating Molecules . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 192
10.8 Residues and Residue Libraries . . . . . . . . . . . . . . . . . . . . . . . . . . 193
10.9 Atom Names and Atom Expressions . . . . . . . . . . . . . . . . . . . . . . . 195
10.10Looping over atoms in molecules . . . . . . . . . . . . . . . . . . . . . . . . . 197
10.11Points, Transformations and Frames . . . . . . . . . . . . . . . . . . . . . . . 198
10.11.1 Points and Vectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . 198
10.11.2 Matrices and Transformations . . . . . . . . . . . . . . . . . . . . . . 198
10.11.3 Frames . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 199
10.12Creating Watson Crick duplexes . . . . . . . . . . . . . . . . . . . . . . . . . 200
10.12.1 bdna() and fd_helix() . . . . . . . . . . . . . . . . . . . . . . . . . . . 201
10.12.2 wc_complement() . . . . . . . . . . . . . . . . . . . . . . . . . . . . 201
10.12.3 wc_helix() Overview . . . . . . . . . . . . . . . . . . . . . . . . . . . 202
10.12.4 wc_basepair() . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 203
10.12.5 wc_helix() Implementation . . . . . . . . . . . . . . . . . . . . . . . . 206
10.13Structure Quality and Energetics . . . . . . . . . . . . . . . . . . . . . . . . . 210
10.13.1 Creating a Parallel DNA Triplex . . . . . . . . . . . . . . . . . . . . . 210
10.13.2 Creating Base Triads . . . . . . . . . . . . . . . . . . . . . . . . . . . 211
10.13.3 Finding the lowest energy triad . . . . . . . . . . . . . . . . . . . . . . 213
10.13.4 Assembling the Triads into Dimers . . . . . . . . . . . . . . . . . . . 215

11 NAB: Language Reference 221


11.1 Introduction . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221
11.2 Language Elements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221
11.2.1 Identifiers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221
11.2.2 Reserved Words . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 221
11.2.3 Literals . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 222
11.2.4 Operators . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 222
11.2.5 Special Characters . . . . . . . . . . . . . . . . . . . . . . . . . . . . 223
11.3 Higher-level constructs . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 223
11.3.1 Variables . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 223

8
CONTENTS

11.3.2 Attributes . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 224


11.3.3 Arrays . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 226
11.3.4 Expressions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 227
11.3.5 Regular expressions . . . . . . . . . . . . . . . . . . . . . . . . . . . 228
11.3.6 Atom Expressions . . . . . . . . . . . . . . . . . . . . . . . . . . . . 228
11.3.7 Format Expressions . . . . . . . . . . . . . . . . . . . . . . . . . . . . 229
11.4 Statements . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 231
11.4.1 Expression Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . 231
11.4.2 Delete Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 232
11.4.3 If Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 232
11.4.4 While Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 232
11.4.5 For Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 233
11.4.6 Break Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
11.4.7 Continue Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
11.4.8 Return Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
11.4.9 Compound Statement . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
11.5 Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 234
11.6 Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 236
11.6.1 Function Definitions . . . . . . . . . . . . . . . . . . . . . . . . . . . 236
11.6.2 Function Declarations . . . . . . . . . . . . . . . . . . . . . . . . . . 237
11.7 Points and Vectors . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 237
11.8 String Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 238
11.9 Math Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 238
11.10System Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 240
11.11I/O Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 240
11.11.1 Ordinary I/O Functions . . . . . . . . . . . . . . . . . . . . . . . . . . 240
11.11.2 matrix I/O . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 242
11.12Molecule Creation Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . 242
11.13Creating Biopoloymers . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 243
11.14Fiber Diffraction Duplexes in NAB . . . . . . . . . . . . . . . . . . . . . . . . 244
11.15Reduced Representation DNA Modeling Functions . . . . . . . . . . . . . . . 245
11.16Molecule I/O Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 246
11.17Other Molecular Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . 247
11.18Debugging Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 249
11.19Time and date routines . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 250

12 NAB: Rigid-Body Transformations 251


12.1 Transformation Matrix Functions . . . . . . . . . . . . . . . . . . . . . . . . . 251
12.2 Frame Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 251
12.3 Functions for working with Atomic Coordinates . . . . . . . . . . . . . . . . . 252
12.4 Symmetry Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 252
12.4.1 Matrix Creation Functions . . . . . . . . . . . . . . . . . . . . . . . . 253
12.4.2 Matrix I/O Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . 254
12.5 Symmetry server programs . . . . . . . . . . . . . . . . . . . . . . . . . . . . 255
12.5.1 matgen . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 255

9
CONTENTS

12.5.2 Symmetry Definition Files . . . . . . . . . . . . . . . . . . . . . . . . 255


12.5.3 matmerge . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 257
12.5.4 matmul . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 258
12.5.5 matextract . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 258
12.5.6 transform . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 258

13 NAB: Distance Geometry 259


13.1 Metric Matrix Distance Geometry . . . . . . . . . . . . . . . . . . . . . . . . 259
13.2 Creating and manipulating bounds, embedding structures . . . . . . . . . . . . 260
13.3 Distance geometry templates . . . . . . . . . . . . . . . . . . . . . . . . . . . 265
13.4 Bounds databases . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 268

14 NAB: Molecular mechanics and dynamics 271


14.1 Basic molecular mechanics routines . . . . . . . . . . . . . . . . . . . . . . . 271
14.2 Typical calling sequences . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 280
14.3 Second derivatives and normal modes . . . . . . . . . . . . . . . . . . . . . . 281
14.4 Low-MODe (LMOD) optimization methods . . . . . . . . . . . . . . . . . . . 284
14.4.1 LMOD conformational searching . . . . . . . . . . . . . . . . . . . . 284
14.4.2 LMOD Procedure . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 285
14.4.3 XMIN . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 286
14.4.4 Sample XMIN program . . . . . . . . . . . . . . . . . . . . . . . . . 288
14.4.5 LMOD . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 291
14.4.6 Sample LMOD program . . . . . . . . . . . . . . . . . . . . . . . . . 294
14.4.7 Tricks of the trade of running LMOD searches . . . . . . . . . . . . . 298

15 NAB: Sample programs 301


15.1 Duplex Creation Functions . . . . . . . . . . . . . . . . . . . . . . . . . . . . 301
15.2 nab and Distance Geometry . . . . . . . . . . . . . . . . . . . . . . . . . . . . 302
15.2.1 Refine DNA Backbone Geometry . . . . . . . . . . . . . . . . . . . . 303
15.2.2 RNA Pseudoknots . . . . . . . . . . . . . . . . . . . . . . . . . . . . 306
15.2.3 NMR refinement for a protein . . . . . . . . . . . . . . . . . . . . . . 309
15.3 Building Larger Structures . . . . . . . . . . . . . . . . . . . . . . . . . . . . 313
15.3.1 Closed Circular DNA . . . . . . . . . . . . . . . . . . . . . . . . . . . 313
15.3.2 Nucleosome Model . . . . . . . . . . . . . . . . . . . . . . . . . . . . 317
15.4 Wrapping DNA Around a Path . . . . . . . . . . . . . . . . . . . . . . . . . . 320
15.4.1 Interpolating the Curve . . . . . . . . . . . . . . . . . . . . . . . . . . 320
15.4.2 Driver Code . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 324
15.4.3 Wrap DNA . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 325
15.5 Other examples . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . . 328

Bibliography 329

Bibliography 329

Index 343

10
1 Getting started
AmberTools is a set of programs for biomolecular simulation and analysis. They are designed
to work well with each other, and with the “regular” Amber suite of programs. You can perform
many simulation tasks with AmberTools, and you can do more extensive simulations with the
combination of AmberTools and Amber itself.
The programs here are mostly released under the GNU General Public License (GPL). A
few components are included that are in the public domain or which have other, open-source,
licenses. See the README_at and LICENSE_at files for more information. We hope to add new
functionality to AmberTools as additional programs become available. If you have suggestions
for what might be added, please contact us.

1.1 Information flow in Amber


Understanding where to begin in AmberTools is primarily a problem of managing the flow
of information in this package–see Fig. 1.1. You first need to understand what information is
needed by the simulation programs (sander, pmemd or nab). You need to know where it comes
from, and how it gets into the form that the energy programs require. This section is meant to
orient the new user and is not a substitute for the individual program documentation.
Information that all the simulation programs need:

1. Cartesian coordinates for each atom in the system. These usually come from Xray crys-
tallography, NMR spectroscopy, or model-building. They should be in Protein Databank
(PDB) or Tripos "mol2" format. The program LEaP provides a platform for carrying out
many of these modeling tasks, but users may wish to consider other programs as well.

2. "Topology": connectivity, atom names, atom types, residue names, and charges. This
information comes from the database, which is found in the amber11/dat/leap/prep di-
rectory, and is described in Chapter 2. It contains topology for the standard amino acids
as well as N- and C-terminal charged amino acids, DNA, RNA, and common sugars. The
database contains default internal coordinates for these monomer units, but coordinate in-
formation is usually obtained from PDB files. Topology information for other molecules
(not found in the standard database) is kept in user-generated "residue files", which are
generally created using antechamber.

3. Force field: Parameters for all of the bonds, angles, dihedrals, and atom types in the sys-
tem. The standard parameters for several force fields are found in the amber11/dat/leap/parm
directory; consult Chapter 2 for more information. These files may be used "as is" for
proteins and nucleic acids, or users may prepare their own files that contain modifications
to the standard force fields.

11
1 Getting started

antechamber, LES
pdb
LEaP info

prmtop
prmcrd

NMR or sander,
XRAY info nab,
pmemd

mm-pbsa ptraj

Figure 1.1: Basic information flow in Amber

4. Commands: The user specifies the procedural options and state parameters desired. These
are specified in “driver” programs written in the nab language.

1.1.1 Preparatory programs


LEaP is the primary program to create a new system in Amber, or to modify old systems.
It combines the functionality of prep, link, edit, and parm from earlier versions. The
program sleap is an updated version of this, with some additional functionality.

antechamber is the main program from the Antechamber suite. If your system contains more
than just standard nucleic acids or proteins, this may help you prepare the input for LEaP.

1.1.2 Simulation programs


NAB (Nucleic Acid Builder) is a language that can be used to write programs to perform non-
periodic simulations, most often using an implicit solvent force field.

sander (part of Amber) is the basic energy minimizer and molecular dynamics program. This
program relaxes the structure by iteratively moving the atoms down the energy gradient
until a sufficiently low average gradient is obtained. The molecular dynamics portion
generates configurations of the system by integrating Newtonian equations of motion.

12
1.2 Installation

MD will sample more configurational space than minimization, and will allow the struc-
ture to cross over small potential energy barriers. Configurations may be saved at regular
intervals during the simulation for later analysis, and basic free energy calculations using
thermodynamic integration may be performed. More elaborate conformational searching
and modeling MD studies can also be carried out using the SANDER module. This al-
lows a variety of constraints to be added to the basic force field, and has been designed
especially for the types of calculations involved in NMR structure refinement.
pmemd (part of Amber) is a version of sander that is optimized for speed and for parallel
scaling. The name stands for "Particle Mesh Ewald Molecular Dynamics," but this code
can now also carry out generalized Born simulations. The input and output have only a
few changes from sander.

1.1.3 Analysis programs


ptraj is a general purpose utility for analyzing and processing trajectory or coordinate files cre-
ated from MD simulations (or from various other sources), carrying out superpositions,
extractions of coordinates, calculation of bond/angle/dihedral values, atomic positional
fluctuations, correlation functions, analysis of hydrogen bonds, etc. The same executable,
when named rdparm (from which the program evolved), can examine and modify prmtop
files.
pbsa is an analysis program for solvent-mediated energetics of biomolecules. It can be used
to perform both electrostatic and non-electrostatic continuum solvation calculations with
input coordinate files from molecular dynamics simulations and other sources. The elec-
trostatic solvation is modeled by the Poisson-Boltzmann equation. Both linear and full
nonlinear numerical solvers are implemented. The nonelectrostatic solvation is modeled
by two separate terms: dispersion and cavity.
mm-pbsa (part of Amber) is a script that automates energy analysis of snapshots from a molec-
ular dynamics simulation using ideas generated from continuum solvent models. There
are two versions of this, an older perl script (called mm_pbsa) and a new python script
(called mmpbsa_py). See the Amber11 Users’ Manual for more information.

1.2 Installation
1. First, extract the files in some location (we use /usr/local as an example here):
cd /usr/local
tar xvfj [Link].bz2

After this, check for bugfixes at [Link] follow the instruc-


tions there to install any needed updates. Note: if you have an amber11 directory that
contains a copy of AmberTools version 1.3, do not unpack AmberTools 1.4 in the same
place!
2. Next, set your AMBERHOME environment variable:

13
1 Getting started

export AMBERHOME=/usr/local/amber11 # (for bash, zsh, ksh...)


setenv AMBERHOME /usr/local/amber11 # (for csh, tcsh)

Be sure to change the “/usr/local” above to whatever directory is appropriate for your
machine. You should also add $AMBERHOME/bin to your PATH.
3. Now, in the src directory, you should run the configure script:
cd amber11/AmberTools/src
./configure --help

will show you the options. Choose a compiler and flags you want; for most systems, the
following should work:
./configure gnu
Don’t choose any parallel options at this point. (You may need to edit the resulting con-
fig.h file to change any variables that don’t match your compilers and OS. The comments
in the config.h file should help.)
4. Then,
make

will compile the codes. If the make fails, it is possible that some of the entries in "con-
fig.h" are not correct.
5. This can be followed by
cd ../test
make test

which will run tests and will report successes or failures.


6. If you wish to prepare parallel (MPI) versions of NAB and ptraj, do this:
cd $AMBERHOME/AmberTools/src
make clean
./configure -mpi <....other options....> <compiler-choice>
make parallel
cd ../test
make [Link]

This assumes that you have installed MPI, and that mpicc is in your PATH.
Note: Parallel versions of AmberTools are rather specialized, and many users will skip
this step. Consider the following points before compiling the MPI version:
a) The parallel version of ptraj can speed up some analysis, but requires special hard-
ware and software to support parallel i/o; see Section 6.7 for more information. If
you don’t have a high performance file environment, you may get better perfor-
mance from the regular version. If you want parallel ptraj only, type cd ptraj;
make parallel.

14
1.3 Contacting the developers

b) Currently, the MPI version of nab will over-write the serial version; that is: only the
most recently-compiled version of nab will be used. Be sure you are familiar with
the serial version, and that you really need the parallel version before compiling it.
If you have shared-memory nodes, the openmp version might be a better alternative.
See Section 10.4 for more information.

7. NAB can also be compiled using openmp:

./configure -openmp <....other options....> <compiler-choice>


make nabonly

See Section 10.4 for information on running the openmp version of NAB. There is no
current provision for more than one version of NAB; the last one compiled will be the
one that is used.

1.3 Contacting the developers


Please send suggestions and questions to amber@[Link]. You need to be subscribed
to post there; to subscribe, go to [Link]

15
2 Specifying a force field
Amber is designed to work with several simple types of force fields, although it is most
commonly used with parameterizations developed by Peter Kollman and his co-workers. There
are now a variety of such parameterizations, with no obvious "default" value. The "traditional"
parameterization uses fixed partial charges, centered on atoms. Examples of this are ff94, ff99
and ff03 (described below). The default in versions 5 and 6 of Amber was ff94; a comparable
default now would probably be ff03 or ff99SB, but users should consult the papers listed below
to see a detailed discussion of the changes made.
Less extensively used, but very promising, recent modifications add polarizable dipoles to
atoms, so that the charge description depends upon the environment; such potentials are called
"polarizable" or "non-additive". Examples are ff02 and ff02EP: the former has atom-based
charges (as in the traditional parameterization), and the latter adds in off-center charges (or
"extra points"), primarily to help describe better the angular dependence of hydrogen bonds.
Again, users should consult the papers cited below to see details of how these new force fields
have been developed.
(An alternative is to use force fields originally developed for the CHARMM codes; this
requires a completely different setup procedure, which is described in Section 2.12, below.)
In order to tell LEaP which force field is being used, the four types of information described
below need to be provided. This is generally accomplished by selecting an appropriate leaprc
file, which loads the information needed for a specific force field. (See section 2.2, below).

1. A listing of the atom types, what elements they correspond to, and their hybridizations.
This information is encoded as a set of LEaP commands, and is normally read from a
leaprc file.

2. Residue descriptions (or "topologies") that describe the chemical nature of amino acids,
nucleotides, and so on. These files specify the connectivities, atom types, charges, and
other information. These files have a "prep" format (a now-obsolete part of Amber)
and have a ".in" extension. Standard libraries of residue descriptions are in the am-
ber11/dat/leap/prep directory. The antechamber program may be used to generate prep
files for other organic molecules.

3. Parameter files give force constants, equilibrium bond lengths and angles, Lennard-Jones
parameters, and the like. Standard files have a ".dat" extension, and are found in am-
ber11/dat/leap/parm.

4. Extensions or changes to the parameters can be included in frcmod files. The expectation
is that the user will load a large, "standard" parameter file, and (if needed) a smaller
frcmod file that keeps track of any changes to the default parameters that are needed.
The frcmod files for changing the default water model (which is TIP3P) into other water

17
2 Specifying a force field

models are in files like amber11/dat/leap/parm/frcmod.tip4p. The parmchk program (part


of antechamber) can also generate frcmod files.

2.1 Specifying which force field you want in LEaP


Various combinations of the above files make sense, and we have moved to an "ff" (force
field) nomenclature to identify these; examples would then be ff94 (which was the default in
Amber 5 and 6), ff99, etc. The most straightforward way to specify which force field you want
is to use one of the leaprc files in $AMBERHOME/dat/leap/cmd. The syntax is

xleap -s -f <filename>

Here, the −s flag tells LEaP to ignore any leaprc file it might find, and the − f flag tells it to start
with commands for some other file. Here are the combinations we support and recommend:

filename topology parameters


leaprc.ff99SB " [Link]+frcmod.ff99SB
leaprc.ff99bsc0 " [Link]+frcmod.ff99SB+frcmod.parmbsc0
leaprc.ff03.r1 Duan et al. 2003 [Link]+frcmod.ff03
leaprc.ff03ua Yang et al. 2003 [Link]+frcmod.ff03+frcmod.ff03ua
leaprc.ff02 reduced charges [Link]+frcmod.ff02pol.r1
[Link] none [Link]
leaprc.GLYCAM_06 Woods et al. GLYCAM_06g.dat
leaprc.GLYCAM_04EP " GLYCAM_04EP.dat
[Link] Ren & Ponder Ren & Ponder

Notes:

1. There is no default leaprc file. If you make a link from one of the files above to a file
named leaprc, then that will become the default. For example:
cd $AMBERHOME/dat/leap/cmd
ln -s leaprc.ff03.r1 leaprc

or
cd $AMBERHOME/dat/leap/cmd
ln -s leaprc.ff99SB leaprc
will provide a good default for many users; after this you could just invoke tleap or xleap
without any arguments, and it would automatically load the ff03 or ff99SB force field. A
leaprc file in the current directory overrides any other such files that might be present in
the search path.

2. Most of the choices in the above table are for additive (non-polarizable) simulations; you
should use saveAmberParm (or saveAmberParmPert) to save the prmtop file, and keep
the default ipol=0 in sander or gibbs.

18
2.2 The AMOEBA potentials

3. The ff02 entries in the above table are for non-additive (polarizable) force fields. Use
saveAmberParmPol to save the prmtop file, and set ipol=1 in the sander input file. Note
that POL3 is a polarizable water model, so you need to use saveAmberParmPol for it as
well.

4. The files above assume that nucleic acids are DNA, if not explicitly specified. Use the
files [Link].ff98, [Link].ff99, [Link].ff02 or [Link].ff02EP to make the
default RNA. If you have a mixture of DNA and RNA, you will need to edit your PDB
file, or use the loadPdbUsingSequence command in LEaP (see that chapter) in order to
specify which nucleotide is which.

5. There is also a [Link] file, which sets you up for the "general" Amber force field.
This is primarily for use with Antechamber (see that chapter), and does not load any
topology files.

6. There are some leaprc files for older force fields in the $AMBERHOME/dat/leap/cmd/oldff
directory. We no longer recommend these combinations, but we recognize that there may
be reasons to use them, especially for comparisons to older simulations.

7. Our experience with generalized Born simulations is mainly with ff99 or ff03; the current
GB models are not compatible with polarizable force fields. Replacing explicit water
with a GB model is equivalent to specifying a different force field, and users should be
aware that none of the GB options (in Amber or elsewhere) is as "mature" as simulations
with explicit solvent; user discretion is advised! For example, it was shown that salt
bridges are too strong in some of these models [2, 3] and some of them provide secondary
structure distributions that differ significantly from those obtained using the same protein
parameters in explicit solvent, with GB having too much α-helix present.[4, 5]

2.2 The AMOEBA potentials


The amoeba force field for proteins, ions, organic solvents and water, developed by Ponder
and Ren [6–10], is available in sander. This force field is specified by setting iamoeba to 1 in
the sander input file. Setting up the system is described in Section 3.6. Basically, you follow the
usual procedure, loading [Link] at the beginning, and using saveAmoebaParm (rather
than the usual saveAmberParm) at the end.

2.3 The Duan et al. (2003) force field

frcmod.ff03 For proteins: changes to [Link], primarily in the


phi and psi torsions.
all_amino03.in Charges and atom types for proteins
all_aminont03.in For N-terminal amino acids
all_aminoct03.in For C-terminal amino acids

19
2 Specifying a force field

The ff03 force field [11, 12] is a modified version of ff99 (described below). The main changes
are that charges are now derived from quantum calculations that use a continuum dielectric to
mimic solvent polarization, and that the φ and ψ backbone torsions for proteins are modified,
with the effect of decreasing the preference for helical configurations. The changes are just for
proteins; nucleic acid parameters are the same as in ff99.
The original model used the old (ff94) charge scheme for N- and C-terminal amino acids.
This was what was distributed with Amber 9, and can still be activated by using oldff/leaprc.ff03.
More recently, new libraries for the terminal amino acids have been constructed, using the same
charge scheme as for the rest of the force field. This newer version (which is recommended for
all new simulations) is accessed by using leaprc.ff03.r1.

2.4 The Yang et al. (2003) united-atom force field

frcmod.ff03ua For proteins: changes to [Link], primarily in the


introduction of new united-atom carbon types and new
side chain torsions.
uni_amino03.in Amino acid input for building database
uni_aminont03.in NH3+ amino acid input for building database.
uni_aminoct03.in COO- amino acid input for building database.

The ff03ua force field [13] is the united-atom counterpart of ff03. This force field uses the same
charging scheme as ff03. In this force field, the aliphatic hydrogen atoms on all amino acid
sidechains are united to their corresponding carbon atoms. The aliphatic hydrogen atoms on all
alpha carbon atoms are still represented explicitly to minimize the impact of the united-atom
approximation on protein backbone conformations. In addition, aromatic hydrogens are also
explicitly represented. Van der Waals parameters of the united carbon atoms are refitted based
on solvation free energy calculations. Due to the use of all-atom protein backbone, the φ and ψ
backbone torsions from ff03 are left unchanged. The sidechain torsions involving united carbon
atoms are all refitted. In this parameter set, nucleic acid parameters are still in all atom and kept
the same as in ff99.

2.5 1999 force fields and recent updates


[Link] Basic force field parameters
all_amino94.in topologies and charges for amino acids
all_amino94nt.in same, for N-terminal amino acids
all_amino94ct.in same, for C-terminal amino acids
all_nuc94.in topologies and charges for nucleic acids
[Link] Force field for general organic molecules.
frcmod.ff99SB "Stony Brook" modification to ff99 backbone torsions
frcmod.ff99SP "Sorin/Pande" modification to ff99 backbone torsions
frcmod.parmbsc0 "Barcelona" changes to ff99 for nucleic acids
all_modrna08.lib topologies and charges for modified nucleotides

20
2.5 1999 force fields and recent updates

all_modrna08.frcmod parameters for modified nucleotides

The ff99 force field [14] points toward a common force field for proteins for "general" organic
and bioorganic systems. The atom types are mostly those of Cornell et al. (see below), but
changes have been made in many torsional parameters. The topology and coordinate files for
the small molecule test cases used in the development of this force field are in the parm99_lib
subdirectory. The ff99 force field uses these parameters, along with the topologies and charges
from the Cornell et al. force field, to create an all-atom nonpolarizable force field for proteins
and nucleic acids.
Proteins. Several groups have noticed that ff99 (and ff94 as well) do not provide a good
energy balance between helical and extended regions of peptide and protein backbones. An-
other problem is that many of the ff94 variants had incorrect treatment of glycine backbone
parameters. ff99SB is the recent attempt to improve this behavior, and was developed in the
Simmerling group.[15] It presents a careful reparametrization of the backbone torsion terms in
ff99 and achieves much better balance of four basic secondary structure elements (PP II , β , αL ,
and αR ). A detailed explanation of the parametrization as well as an extensive comparison with
many other variants of fixed charge Amber forcefields is given in the reference above. Briefly,
dihedral term parameters were obtained through fitting the energies of multiple conformations
of glycine and alanine tetrapeptides to high-level ab initio QM calculations. We have shown that
this force field provides much improved proportions of helical versus extended structures. In
addition, it corrected the glycine sampling and should also perform well for β -turn structures,
two things which were especially problematic with most previous Amber force field variants.
In order to use ff99SB, issue "source leaprc.ff99SB" at the start of your LEaP session.
An alternative is to simply zero out the torsional terms for the φ and ψ backbone angles.[16]
Another alteration along the same lines has been developed by Sorin and Pande,[17] and is
implemented in the frcmod.ff99SP file. Research in this area is ongoing, and users interested in
peptide and protein folding are urged to keep abreast of the current literature.
Nucleic acids. The nucleic acid force fields have recently been updated from those in ff99,
in order to address a tendency of DNA double helices to convert (after fairly long simulations)
to extended forms in the α and γ backbone torsion angles.[18] These updated parameters are in
the frcmod.parmbsc0 file, and are the ones we now recommend. The leaprc.ff99bsc0 file loads
these, along with the ff99SB protein parameters.
There are more than 99 naturally occurring modifications in RNA. Amber force field param-
eters for all these modifications have been developed to be consistent with ff94 and ff99.[19]
The modular nature of RNA is taken into consideration in computing the atom-centered par-
tial charges for these modified nucleosides, based on the charging model for the “normal”
nucleotides.[20] All the ab initio calculations are done at the Hartree-Fock level of theory with
6-31G(d) basis sets, using GAUSSIAN suite of programs. The computed electrostatic potential
(ESP) is fit using RESP charge fitting with the Antechamber module of AMBER. Three letter
codes for all of the fitted nucleosides were developed to standardize the naming of the modified
nucleosides in pdb files. For a detailed description of charge fitting for these nucleosides and
an outline for the three letter codes, please refer to Ref. [19].
The AMBER force field parameters for 99 modified nucleosides are distributed in the form
of library files. The all_modrna08.lib file contains coordinates, connectivity, and charges, and
all_modrna08.frcmod contains information about bond lengths, angles, dihedrals and others.

21
2 Specifying a force field

The AMBER force field parameters for the 99 modified nucleosides in RNA are also maintained
at the modified RNA database at [Link]
General organic molecules. The General Amber Force Field (gaff) is discussed in Chap. 4.

2.6 The 2002 polarizable force fields

[Link] Force field, for amino acids and some organic molecules;
can be used with either additive or
non-additive treatment of electrostatics.
[Link] Like [Link], but with "extra-points": off-center
atomic charges, somewhat like lone-pairs.
frcmod.ff02pol.r1 Updated torsion parameters for ff02.
all_nuc02.in Nucleic acid input for building database, for a non-
additive (polarizable) force field without extra points.
all_amino02.in Amino acid input ...
all_aminoct02.in COO- amino acid input ...
all_aminont02.in NH3+ amino acid input ....
all_nuc02EP.in Nucleic acid input for building database, for a non-
additive (polarizable) force field with extra points.
all_amino02EP.in Amino acid input ...
all_aminoct02EP.in COO- amino acid input ...
all_aminont02EP.in NH3+ amino acid input ....

The ff02 force field is a polarizable variant of ff99. (See Ref. [21] for a recent overview of po-
larizable force fields.) Here, the charges were determined at the B3LYP/cc-pVTZ//HF/6-31G*
level, and hence are more like "gas-phase" charges. During charge fitting the correction for
intramolecular self polarization has been included.[22] Bond polarization arising from interac-
tions with a condensed phase environment are achieved through polarizable dipoles attached to
the atoms. These are determined from isotropic atomic polarizabilities assigned to each atom,
taken from experimental work of Applequist. The dipoles can either be determined at each step
through an iterative scheme, or can be treated as additional dynamical variables, and propagated
through dynamics along with the atomic positions, in a manner analogous to Car-Parinello dy-
namics. Derivation of the polarizable force field required only minor changes in dihedral terms
and a few modification of the van der Waals parameters.
Recently, a set up updated torsion parameters has been developed for the ff02 polarizable
force field.[23] These are available in the frcmod.ff02pol.r1 file.
The user also has a choice to use the polarizable force field with extra points on which ad-
ditional point charges are located; this is called ff02EP. The additional points are located on
electron donating atoms (e.g. O,N,S), which mimic the presence of electron lone pairs.[24] For
nucleic acids we chose to use extra interacting points only on nucleic acid bases and not on
sugars or phosphate groups.
There is not (yet) a full published description of this, but a good deal of preliminary work
on small molecules is available.[22, 25] Beyond small molecules, our initial tests have focused
on small proteins and double helical oligonucleotides, in additive TIP3P water solution. Such

22
2.7 Force related to semiempirical QM

a simulation model, (using a polarizable solute in a non-polarizable solvent) gains some of


the advantages of polarization at only a small extra cost, compared to a standard force field
model. In particular, the polarizable force field appears better suited to reproduce intermolecular
interactions and directionality of H-bonding in biological systems than the additive force field.
Initial tests show ff02EP behaves slightly better than ff02, but it is not yet clear how significant
or widespread these differences will be.

2.7 Force related to semiempirical QM


ParmAM1 and parmPM3 are classical force field parameter sets that reproduce the
geometry of proteins minimized at the semiempirical AM1 or PM3 level, respectively.[26]
These new force fields provide an inexpensive, yet reliable, method to arrive at geometries that
are more consistent with a semiempirical treatment of protein structure. These force fields are
meant only to reproduce AM1 and PM3 geometries (warts and all) and were not tested for use
in other instances (e.g., in classical MD simulations, etc.) Since the minimization of a protein
structure at the semiempirical level can become cost-prohibitive, a "preminimization" with an
appropriately parameterized classical treatment will facilitate future analysis using AM1 or
PM3 Hamiltonians.

2.8 GLYCAM-06 and GLYCAM-04EP force fields for


carbohydrates and lipids
2.8.1 List of relevant files shipped with AMBER 11.
GLYCAM 2006 force field
GLYCAM_06g.dat Parameters for oligosaccharides (Check
[Link] for more recent versions)
GLYCAM_06.prep Structures and charges for glycosyl residues
GLYCAM_06_lipids.prep Structures and charges for sample lipid residues
(Check [Link] for additional residues)
leaprc.GLYCAM_06 LEaP configuration file for GLYCAM 06
GLYCAM_amino_06.lib Glycoprotein library for centrally-positioned
residues
GLYCAM_aminoct_06.lib Glycoprotein library for C-terminal residues
GLYCAM_aminont_06.lib Glycoprotein library for N-terminal residues

GLYCAM 2004EP force field using lone pairs (extra points)


GLYCAM_04EP.dat Parameters for oligosaccharides
GLYCAM_04EP.prep Structures and charges for glycosyl residues
leaprc.GLYCAM_04EP LEaP configuration file for GLYCAM 04EP

GLYCAM Force Field Parameters Download Page

23
2 Specifying a force field

[Link]

Unlike in previous releases of the GLYCAM force field, individual prep files will no longer
be released with Amber. Instead, one file contains prep entries for all carbohydrate residues.
Another file contains prep entries for lipid residues. For linking glycans to proteins, the libraries
containing amino acid residues that have been modified for the purpose must be loaded. At
present, it is possible to link to serine, threonine, hydroxyproline and asparagine.

2.8.2 File versioning and obtaining the latest parameters.


The latest releases of GLYCAM parameters, prep files, libraries, leaprc files and other docu-
mentation can be obtained from the Woods group’s GLYCAM Force Field Parameters Down-
load Page. Researchers are strongly encouraged to obtain the most recent files for their projects.
Online file names might vary slightly from those listed above. In general, prep files, library files
and leaprc files are not versioned, though they do change slightly from time to time, primarily
to correct typographical errors. The atomic charges, found in the prep and library files, rarely
change. Main parameter files are versioned by appending a letter to the year designation. The
first version is “a,” and the current version is “g”. Researchers are also encouraged to read the
version change documentation, available on the GLYCAM Parameters download page under
“Documents.” In this document, the changes specific to each version release are detailed.

2.8.3 General information regarding parameter development


In GLYCAM06,[27] the torsion terms have now been entirely developed by fitting to quan-
tum mechanical data (B3LYP/6-31++G(2d,2p)//HF/6-31G(d)) for small-molecules. This has
converted GLCYAM06 into an additive force field that is extensible to diverse molecular classes
including, for example, lipids and glycolipids. The parameters are self-contained, such that it is
not necessary to load any AMBER parameter files when modeling carbohydrates or lipids. To
maintain orthogonality with AMBER parameters for proteins, notably those involving the CT
atom type, tetrahedral carbon atoms in GLYCAM are called CG (C-GLYCAM). Thus, GLY-
CAM and AMBER may be combined for modeling carbohydrate-protein complexes and glyco-
proteins. Because the GLYCAM06 torsion terms were derived by fitting to data for small, often
highly symmetric molecules, asymmetric phase shifts were not required in the parameters. This
has the significant advantage that it allows one set of torsion terms to be used for both α- and
β -carbohydrate anomers regardless of monosaccharide ring size or conformation. A molecular
development suite of more than 75 molecules was employed, with a test suite that included
carbohydrates and numerous smaller molecular fragments. The GLYCAM06 force field has
been validated against quantum mechanical and experimental properties, including: gas-phase
conformational energies, hydrogen bond energies, and vibrational frequencies; solution-phase
rotamer populations (from NMR data); and solid-phase vibrational frequencies and crystallo-
graphic unit cell dimensions.

2.8.4 Scaling of electrostatic and nonbonded interactions


As in previous versions of GLYCAM,[28] the parameters were derived for use without scal-
ing 1-4 non-bonded and electrostatic interactions, e.g., SCNB and SCEE should typically be

24
2.8 GLYCAM-06 and GLYCAM-04EP force fields for carbohydrates and lipids

set to unity. We have shown that this is essential in order to properly treat internal hydrogen
bonds, particularly those associated with the hydroxymethyl group, and to correctly reproduce
the rotamer populations for the C5-C6 bond.[29] Beginning with AMBER 11, it is now possible
to employ mixed scaling of the SCNB and SCEE parameters. Anyone wishing to simulate sys-
tems containing both carbohydrates and proteins should use the new mixed scaling capability.
To do this, any scaling factors that differ from the default must be included in the parameter
file. Beginning with the GLYCAM_06g parameter file shipped with AMBER 11, these factors
are already included. Anyone wishing to employ earlier parameter sets must modify the files.
For further information on the format of the parameter files and the required LEAP commands,
please see "write14scale" in Section3.6.4

2.8.5 Development of partial atomic charges


As in previous versions of GLYCAM, the atomic partial charges were determined using the
RESP formalism, with a weighting factor of 0.01,[27, 30] from a wavefunction computed at
the HF/6-31G(d) level. To reduce artifactual fluctuations in the charges on aliphatic hydrogen
atoms, and on the adjacent saturated carbon atoms, charges on aliphatic hydrogens (types HC,
H1, H2, and H3) were set to zero while the partial charges were fit to the remaining atoms.[31]
It should be noted that aliphatic hydrogen atoms typically carry partial charges that fluctuate
around zero when they are included in the RESP fitting, particularly when averaged over con-
formational ensembles.[27, 32] In order to account for the effects of charge variation associated
with exocyclic bond rotation, particularly associated with hydroxyl and hydroxylmethyl groups,
partial atomic charges for each sugar were determined by averaging RESP charges obtained
from 100 conformations selected evenly from 10-50 ns solvated MD simulations of the methyl
glycoside of each monosaccharide, thus yielding an ensemble averaged charge set.[27, 32]

2.8.6 Carbohydrate parameters for use with the TIP5P water model
In order to extend GLYCAM to simulations employing the TIP-5P water model, an additional
set of carbohydrate parameters, GLYCAM04EP, has been derived in which lone pairs (or extra
points, EPs) have been incorporated on the oxygen atoms.[33] The optimal O-EP distance was
located by obtaining the best fit to the HF/6-31g(d) electrostatic potential. In general, the best
fit to the quantum potential coincided with a negligible charge on the oxygen nuclear position.
The optimal O-EP distance for an sp3 oxygen atom was found to be 0.70 Å; for an sp2 oxygen
atom a shorter length of 0.3 Åwas optimal. When applied to water, this approach to locating
the lone pair positions and assigning the partial charges yielded a model that was essentially
indistinguishable from TIP-5P. Therefore, we believe this model is well suited for use with
TIP-5P.[33]

2.8.7 Carbohydrate Naming Convention in GLYCAM


In order to incorporate carbohydrates in a standardized way into modeling programs, as well
as to provide a standard for X-ray and NMR protein database files (pdb), we have developed a
three-letter code nomenclature. The restriction to three letters is based on standards imposed on
protein database (pdb) files by the RCSB PDB Advisory Committee ([Link]/pdb/[Link]),

25
2 Specifying a force field

Carbohydrate Pyranose Furanose


α/β , D/L α/β , D/L
Arabinose yes yes
Lyxose yes yes
Ribose yes yes
Xylose yes yes
Allose yes
Altrose yes
Galactose yes a
Glucose yes a
Gulose yes
Idose a
Mannose yes
Talose yes
Fructose yes yes
Psicose yes yes
Sorbose yes yes
Tagatose yes yes
Fucose yes
Quinovose yes
Rhamnose yes
Galacturonic Acid yes
Glucuronic Acid yes
Iduronic Acid yes
N-Acetylgalactosamine yes
N-Acetylglucosamine yes
N-Acetylmannosamine yes
Neu5Ac yes, b yes,b
KDN a,b a,b
KDO a,b a,b

Table 2.1: Current Status of Monosaccharide Availability in GLYCAM. (a) Currently under de-
velopment. (b) Only one enantiomer and ring form known.

26
2.8 GLYCAM-06 and GLYCAM-04EP force fields for carbohydrates and lipids

Carbohydratea One letter codeb Common Abbreviation


1 D-Arabinose A Ara
2 D-Lyxose D Lyx
3 D-Ribose R Rib
4 D-Xylose X Xyl
5 D-Allose N All
6 D-Altrose E Alt
7 D-Galactose L Gal
8 D-Glucose G Glc
9 D-Gulose K Gul
10 D-Idose I Ido
11 D-Mannose M Man
12 D-Talose T Tal
13 D-Fructose C Fru
14 D-Psicose P Psi
15 D-Sorbose Bd Sor
16 D-Tagatose J Tag
17 D-Fucose (6-deoxy D-galactose) F Fuc
18 D-Quinovose (6-deoxy D-glucose) Q Qui
19 D-Rhamnose (6-deoxy D-mannose) H Rha
20 D-Galacturonic Acid Od GalA
21 D-Glucuronic Acid Zd GlcA
22 D-Iduronic Acid Ud IdoA
23 D-N-Acetylgalactosamine Vd GalNac
24 D-N-Acetylglucosamine Yd GlcNAc
25 D-N-Acetylmannosamine Wd ManNAc
26 N-Acetyl-neuraminic Acid Sd NeuNAc, Neu5Ac
KDN KNc,d KDN
KDO KOc,d KDO
N-Glycolyl-neuraminic Acid SGc,d NeuNGc, Neu5Gc

Table 2.2: The one-letter codes that form the core of the GLYCAM residue names for monosac-
charides a Users requiring prep files for residues not currently available may con-
tact the Woods group ([Link]) to request generation of structures and
ensemble averaged charges. b Lowercase letters indicate L-sugars, thus L-Fucose
would be “f”, see Table 2.5 . c Less common residues that cannot be assigned a
single letter code are accommodated at the expense of some information content.
d Nomenclature involving these residues will likely change in future releases.[34]

Please visit [Link] for the most updated information.

27
2 Specifying a force field

α−D-Glcp β −D-Galp α−D-Arap β −D-Xylp


Linkage Position Residue Name Residue Name Residue Name Residue Name
Terminalb 0GAb 0LB 0AA 0XB
1-c 1GAc 1LB 1AA 1XB
2- 2GA 2LB 2AA 2XB
3- 3GA 3LB 3AA 3XB
4- 4GA 4LB 4AA 4XB
6- 6GA 6LB
2,3- ZGAd ZLB ZAA ZXB
2,4- YGA YLB YAA YXB
2,6- XGA XLB
3,4- WGA WLB WAA WXB
3,6- VGA VLB
4,6- UGA ULB
2,3,4- TGA TLB TAA TXB
2,3,6- SGA SLB
2,4,6- RGA RLB
3,4,6- QGA QLB
2,3,4,6- PGA PLB

Table 2.3: Specification of linkage position and anomeric configuration in D-hexo- and D-
pentopyranoses in three-letter codes based on the GLYCAM one-letter code a In pyra-
noses A signifies α-configuration; B = β . b Previously called GA, the zero prefix in-
dicates that there are no oxygen atoms available for bond formation, i.e., that the
residue is for chain termination. c Introduced to facilitate the formation of a 1-1’
linkage as in α-D-Glc-1-1’-α-D-Glc {1GA 0GA}. d For linkages involving more than
one position, it is necessary to avoid employing prefix letters that would lead to a
three-letter code that was already employed for amino acids, such as ALA.

α-D-Glcf β -D-Manf α-D-Araf β -D-Xylf


Linkage position Residue name Residue name Residue name Residue name
Terminal 0GD 0MU 0AD 0XU
1- 1GD 1MU 1AD 1XU
2- 2GD 2MU 2AD 2XU
3- 3GD 3MU 3AD 3XU
··· ··· ··· ··· ···
etc. etc. etc. etc. etc.

Table 2.4: Specification of linkage position and anomeric configuration in D-hexo- and D-
pentofuranoses in three-letter codes based on the GLYCAM one-letter code. In fura-
noses D (down) signifies α; U (up) = β .

28
2.9 Ions

α-L-Glcp β -L-Manp α-L-Arap β -L-Xylp


Linkage position Residue name Residue name Residue name Residue name
Terminal 0gA 0mB 0aA 0xB
1- 1gA 1mB 1aA 1xB
2- 2gA 2mB 2aA 2xB
3- 3gA 3mB 3aA 3xB
··· ··· ··· ··· ···
etc. etc. etc. etc. etc.

Table 2.5: Specification of linkage position and anomeric configuration in L-hexo- and L-
pentofuranoses in three-letter codes.

and for the practical reason that all modeling and experimental software has been developed to
read three-letter codes, primarily for use with protein and nucleic acids.
As a basis for a three-letter pdb code for monosaccharides, we have introduced a one-letter
code for monosaccharides (Table 2.2).[34] Where possible, the letter is taken from the first letter
of the monosaccharide name. Given the endless variety in monosaccharide derivatives, the lim-
itation of 26 letters ensures that no one-letter (or three-letter) code can be all encompassing. We
have therefore allocated single letters firstly to all 5- and 6-carbon, non-derivatized monosac-
charides. Subsequently, letters have been assigned on the order of frequency of occurrence or
biological significance.
Using three letters (Tables 2.3 to 2.5), the present GLYCAM residue names encode the
following content: carbohydrate residue name (Glc, Gal, etc.), ring form (pyranosyl or
furanosyl), anomeric configuration (α or β ), enantiomeric form (D or L) and occupied linkage
positions (2-, 2,3-, 2,4,6-, etc.). Incorporation of linkage position is a particularly useful
addition, since, unlike amino acids, the linkage cannot otherwise be inferred from the
monosaccharide name. Further, the three-letter codes were chosen to be orthogonal to those
currently employed for amino acids.

2.9 Ions

frcmod.ionsjc_tip3p Joung/Cheatham ion parameters for TIP3P water


frcmod.ionsjc_spce same, but for SPC/E water
frcmod.ionsjc_tip4pew same, but for TIP4P/EW water
[Link] topologies for ions with the new naming scheme
[Link] topologies for ions with the old naming scheme

In the past, for alkali ions with TIP3P waters, Amber has provided the values of Aqvist,[35] ad-
justed for Amber’s nonbonded atom pair combining rules to give the same ion-OW potentials as
in the original (which were designed for SPC water); these values reproduce the first peak of the
radial distribution for ion-OW and the relative free energies of solvation in water of the various

29
2 Specifying a force field

ions. Note that these values would have to be changed if a water model other than TIP3P were
to be used. Rather arbitrarily, Amber also included chloride parameters from Dang.[36] These
are now known not to work all that well with the Aqvist cation parameters, particularly for the
K/Cl pair. Specifically, at concentrations above 200 mM, KCl will spontaneously crystallize;
this is also seen with NaCl at concentrations above 1 M.[37] The naming scheme for ions in the
older Amber force fields is also not very straightforward.
Recently, Joung and Cheatham have created a more consistent set of parameters, fitting sol-
vation free energies, radial distribution functions, ion-water interaction energies and crystal
lattice energies and lattice constants for non-polarizable spherical ions.[38] These have been
separately parameterized for each of three popular water models, as indicated above. Please
note: most leaprc files still load the “old” ion parameters; to use the newer versions, you will
need to load the [Link] file as well as the appropriate frcmod file.

2.10 Solvent models

[Link] library for water, methanol, chloroform, NMA, urea


frcmod.tip4p Parameter changes for TIP4P.
frcmod.tip4pew Parameter changes for TIP4PEW.
frcmod.tip5p Parameter changes for TIP5P.
[Link] Parameter changes for SPC/E.
frcmod.pol3 Parameter changes for POL3.
[Link] Parameters for methanol.
frcmod.chcl3 Parameters for chloroform.
[Link] Parameters for N-methyacetamide.
[Link] Parameters for urea (or urea-water mixtures).

Amber now provides direct support for several water models. The default water model is
TIP3P.[39] This model will be used for residues with names HOH or WAT. If you want to use
other water models, execute the following leap commands after loading your leaprc file:
WAT = PL3 (residues named WAT in pdb file will be POL3)
loadAmberParams frcmod.pol3 (sets the HW,OW parameters to POL3)

(The above is obviously for the POL3 model.) The [Link] file contains TIP3P,[39]
TIP3P/F,[40] TIP4P,[39, 41] TIP4P/Ew,[42, 43] TIP5P,[44] POL3[45] and SPC/E[46] models
for water; these are called TP3, TPF, TP4, T4E, TP5, PL3 and SPC, respectively. By default,
the residue name in the prmtop file will be WAT, regardless of which water model is used. If
you want to change this (for example, to keep track of which water model you are using), you
can change the residue name to whatever you like. For example,
WAT = TP4
set WAT.1 name "TP4"

would make a special label in PDB and prtmop files for TIP4P water. Note that Brookhaven
format files allow at most three characters for the residue label, which is why the residue names
above have to be abbreviated.

30
2.11 Obsolete force field files

Amber has two flexible water models, one for classical dynamics, SPC/Fw[47] (called
“SPF”) and one for path-integral MD, qSPC/Fw[48] (called “SPG”). You would use these in
the following manner:

WAT = SPG
loadAmberParams [Link]
set default FlexibleWater on

Then, when you load a pdb file with residues called WAT, they will get the parameters for
qSPC/Fw. (Obviously, you need to run some version of quantum dynamics if you are using
qSPC/Fw water.)
The [Link] file, which is automatically loaded with many leaprc files, also contains
pre-equilibrated boxes for many of these water models. These are called POL3BOX, QSPCFW-
BOX, SPCBOX, SPCFBOX, TIP3PBOX, TIP3PFBOX, TIP4PBOX, and TIP4PEWBOX. These
can be used as arguments to the solvateBox or solvateOct commands in LEaP.
In addition, non-polarizable models for the organic solvents methanol, chloroform and
N-methylacetamide are provided, along with a box for an 8M urea-water mixture. The input
files for a single molecule are in amber11/dat/leap/prep, and the corresponding frcmod files
are in amber11/dat/leap/parm. Pre-equilibrated boxes are in amber11/dat/leap/lib. For
example, to solvate a simple peptide in methanol, you could do the following:

source leaprc.ff99SB (get a standard force field)


loadAmberParams [Link] (get methanol parameters)
peptide = sequence { ACE VAL NME } (construct a simple peptide)
solvateBox peptide MEOHBOX 12.0 0.8 (solvate the peptide with meoh)
saveAmberParm peptide prmtop prmcrd
quit

Similar commands will work for other solvent models.

2.11 Obsolete force field files

The following files are included for historical interest. We do not recommend that these be used
any more for molecular simulations. The leaprc files that load these files have been moved to
$AMBERHOME/dat/leap/parm/oldff.

2.11.1 The Cornell et al. (1994) force field


all_nuc94.in Nucleic acid input for building database.
all_amino94.in Amino acid input for building database.
all_aminoct94.in COO- amino acid input for database.
all_aminont94.in NH3+ amino acid input for database.
[Link] Ion file.
[Link] 1994 force field file.

31
2 Specifying a force field

[Link] Modified version of 1994 force field, for proteins.


[Link] Modified version of 1994 force field, for nucleic acids.

Contained in ff94 are parameters from the so-called "second generation" force field developed
in the Kollman group in the early 1990’s.[49] These parameters are especially derived for sol-
vated systems, and when used with an appropriate 1-4 electrostatic scale factor, have been
shown to perform well at modeling many organic molecules. The parameters in [Link]
omit the hydrogen bonding terms of earlier force fields. This is an all-atom force field; no
united-atom counterpart is provided. 1-4 electrostatic interactions are scaled by 1.2 instead of
the value of 2.0 that had been used in earlier force fields.
Charges were derived using Hartree-Fock theory with the 6-31G* basis set, because this
exaggerates the dipole moment of most residues by 10-20%. It thus "builds in" the amount
of polarization which would be expected in aqueous solution. This is necessary for carrying
out condensed phase simulations with an effective two-body force field which does not include
explicit polarization. The charge-fitting procedure is described in Ref [49].
The ff96 force field [50] differs from [Link] in that the torsions for φ and ψ have been
modified in response to ab initio calculations [51] which showed that the energy difference be-
tween conformations were quite different than calculated by Cornell et al. (using [Link]).
To create [Link], common V1 and V2 parameters were used for φ and ψ, which were
empirically adjusted to reproduce the energy difference between extended and constrained al-
pha helical energies for the alanine tetrapeptide. This led to a significant improvement between
molecular mechanical and quantum mechanical relative energies for the remaining members of
the set of tetrapeptides studied by Beachy et al. Users should be aware that [Link] has
not been as extensively used as [Link], and that it almost certainly has its own biases and
idiosyncrasies, including strong bias favoring extended β conformations.[15, 52, 53]
The ff98 force field [54] differs from [Link] in torsion angle parameters involving the
glycosidic torsion in nucleic acids. These serve to improve the predicted helical repeat and
sugar pucker profiles.

2.11.2 The Weiner et al. (1984,1986) force fields


[Link] All atom database input.
[Link] All atom database input, COO- Amino acids.
[Link] All atom database input, NH3+ Amino acids.
[Link] United atom database input.
[Link] United atom database input, COO- Amino acids.
[Link] United atom database input, NH3+ Amino acids.
[Link] Parameters for 1984, 1986 force fields.

The ff86 parameters are described in early papers from the Kollman and Case groups.[55, 56]
[The "parm91" designation is somewhat unfortunate: this file is really only a corrected version
of the parameters described in the 1984 and 1986 papers listed above.] These parameters are
not generally recommended any more, but may still be useful for vacuum simulations of nucleic
acids and proteins using a distance-dependent dielectric, or for comparisons to earlier work. The
material in [Link] is the parameter set distributed with Amber 4.0. The STUB nonbonded

32
2.12 CHAMBER

set has been copied from [Link]; these sets of parameters are appropriate for united atom
calculations using the "larger" carbon radii referred to in the "note added in proof" of the 1984
JACS paper. If these values are used for a united atom calculation, the parameter scnb must be
defined in the prmtop file and should be set to 8.0; for all-atom calculations it should be 2.0.
The scee parameter should be defined in the prmtop file and set to 2.0 for both united atom and
all-atom variants. Note that the default value for scee is now 1.2 (the value for 1994 and later
force fields); this must be explicitly defined in the prmtop file when using the earlier force fields.
[Link] is not recommended. However, for historical completeness a number of terms
in the non-bonded list of [Link] should be noted. The non-bonded terms for I(iodine),
CU(copper), and MG(magnesium) have not been carefully calibrated, but are given as approx-
imate values. In the STUB set of non-bonded parameters, we have included parameters for a
large hydrated monovalent cation (IP) that represent work by Singh et al.[57] on large hydrated
counterions for DNA. Similar values are included for a hydrated anion (IM).
The non-bonded potentials for hydrogen-bond pairs in ff86 use a Lennard-Jones 10-12 poten-
tial. If you want to run sander with ff86 then you will need to recompile, adding -DHAS_10_12
to the Fortran preprocessor flags.

2.12 CHAMBER

CHAMBER (CHarmm↔AMBER) is a tool which enables the use of the CHARMM force
field within AMBER’s molecular dynamics engines (MDEs). If you make use of this tool,
please cite the following [58]. There are two components to CHAMBER:

1. The tool ($AMBERHOME/exe/chamber) which converts a CHARMM psf, associated


coordinated file, parameter and topology to a CHARMM force field enabled version of
AMBER’s prmtop and inpcrd.

2. The additional code within sander and pmemd to evaluate the extra CHARMM energies
and forces.

AMBER[49] and CHARMM[59, 60] are two approaches to the parameterization of classical
force fields that find extensive use in the modeling of biological systems. The high similarity
in the functional form of the two potential energy functions used by these force fields, Eq.(2.1
and 2.2), gives rise to the possible use of one force field within the other MDE.

Vn
VAMBER = ∑ k (r − req )2 + ∑ k (θ − θeq )2 + ∑ [1 + cos(nφ − γ)] 6
bonds angles dihedrals 2
" #  
Ai j Bi j qi q j
+∑ − + ∑ (2.1)
i< j R12
ij R6i j i< j εRi j

33
2 Specifying a force field

VCHARMM = ∑ kb (b − b0 )2 + ∑ kθ (θ − θ0 )2 + ∑ kφ [1 + cos (nφ − δ )]


bonds angles dihedrals

+ ∑ ku (u − u0 )2 + ∑ k (ω − ω0 )2 + ∑ VCMAP
Urey−Bradley impropers φ ,ψ
" 12 6 #
Rmini j Rmini j

qi q j
+ ∑ ε − + (2.2)
nonbonded ri j ri j εri j
In the case of the CHARMM force field, its MDE is also called CHARMM[61, 62]. For the
implementation of the CHARMM force field within Amber, parameters that are of the same
energy term can be directly translated. However, there are differences in the functional forms
of the two potentials, with CHARMM having three additional bonded terms. With respect to
the 1-4 non bonded interactions, CHARMM scales these in a different manner: the electrostatic
scaling factor (SCEE) is 1.0 within CHARMM, but 1.2 in Amber and the van der Waal’s scaling
factor (SCNB) is 1.0 within CHARMM, but 2.0 in Amber. Additionally, CHARMM uses a
different set of parameters in the Lennard Jones equation for the van der Waal’s interaction if
the two atoms are bonded 1-4 to each other.
The first additional bonded term is CHARMM’s two body Urey-Bradley term, which extends
over all 1-3 bonds, the second is a four body quadratic improper term and the final additional
term is a cross term, named CMAP, [63, 64] , which is a function of two sequential protein back
bone dihedrals. This term originates from differences observed between classically calculated
two dimensional φ /ψ peptide free energy surfaces using the CHARMM22 force field and that
of experiment. CMAP is a numerical energy correction which essentially transforms the 2D
φ /ψ classical energy map to match that of a QM calculated map.
Support for these extra terms has required the development of extra sections to AMBER’s
extensible prmtop format to accommodate this new information as well as modifications of the
precision of existing sections. For example, the CHARMM parameter file stores the equilib-
rium angle (θ0 , Eq.2.2) parameter in degrees in its parameter file and AMBER stores this in
radians in the prmtop. However, during the conversion with chamber, this becomes inexact
when converted to radians. Within CHARMM this is done internally at runtime and the inex-
actness is determined by the variable type that will hold the result of this conversion. However
for Amber, this conversion is done at the CHAMBER execution stage; and as a result is limited
by the precision to which that specific parameter is written to the prmtop file. Hence the preci-
sion of the ANGLE_EQUIL_VALUE has been increased; similar changes were carried out for
CHARGE and VDW sections for the same reasons. Specifically the modified sections of the
prmtop format. and new additions are as follows:

%FLAG CTITLE
The keyword CTITLE is used in place of TITLE to specify that this is a CHAMBER prmtop.

%FLAG FORCE_FIELD_TYPE
%FORMAT(i2,a78)
1 CHARMM 31 *>>>>>>>>CHARMM22 All-Hydrogen Topology File for Proteins <<
This section described the force field in use. The initial integer specifies the number of lines
to be read. The keyword CHARMM here indicates that this is the CHARMM force field.

34
2.12 CHAMBER

%FLAG CHARGE
%COMMENT Atomic charge multiplied by sqrt(332.0716D0) (CCELEC)
%FORMAT(3e24.16)
The default format for charge has been changed from 5e16.8 to 3e24.16

%FLAG CHARMM_UREY_BRADLEY_COUNT
%COMMENT V(ub) = K_ub(r_ik - R_ub)**2
%COMMENT Number of Urey Bradley terms and types
%FORMAT(2i8)
This additional section describes the number of CHARMM Urey Bradley terms present and
the total number of Urey Bradley types in use.

%FLAG CHARMM_UREY_BRADLEY
%COMMENT List of the two atoms and its parameter index
%COMMENT in each UB term: i,k,index
%FORMAT(10i8)
This additional section lists the atom indexes and parameter lookup index for each of the
Urey Bradley terms.

%FLAG CHARMM_UREY_BRADLEY_FORCE_CONSTANT
%COMMENT K_ub: kcal/mole/rad**2
%FORMAT(5e16.8)
This additional section lists the force constant for each of the Urey Bradley types.

%FLAG CHARMM_UREY_BRADLEY_EQUIL_VALUE
%COMMENT r_ub: A
%FORMAT(5e16.8)
This additional section lists the equilibrium value for each of the Urey Bradley types.

%FLAG SCEE_SCALE_FACTOR
%FORMAT(5e16.8)
This additional section lists a unique value of SCEE for each dihedral. This overides the
default or &cntrl values set for SCEE and in the case of the CHARMM force field will always
be 1.0 for all dihedrals.

%FLAG SCNB_SCALE_FACTOR
%FORMAT(5e16.8)
This is the analogous additional term for SCNB

%FLAG CHARMM_NUM_IMPROPERS
%COMMENT Number of terms contributing to the
%COMMENT quadratic four atom improper energy term:
%COMMENT V(improper) = K_psi(psi - psi_0)**2
%FORMAT(10i8)

35
2 Specifying a force field

This additional section lists the number of CHARMM improper terms present.

%FLAG CHARMM_IMPROPERS
%COMMENT List of the four atoms in each improper term
%COMMENT i,j,k,l,index i,j,k,l,index
%COMMENT where index is into the following two lists:
%COMMENT CHARMM_IMPROPER_{FORCE_CONSTANT,IMPROPER_PHASE}
%FORMAT(10i8)
This additional section lists the atom indicies and index into the parameter arrays for each
of the CHARMM improper terms.

%FLAG CHARMM_NUM_IMPR_TYPES
%COMMENT Number of unique parameters contributing to the
%COMMENT quadratic four atom improper energy term
%FORMAT(i8)
This additional section lists the number of types present for the CHARMM impropers.

%FLAG CHARMM_IMPROPER_FORCE_CONSTANT
%COMMENT K_psi: kcal/mole/rad**2
%FORMAT(5e16.8)
This additional section lists the force constant for each CHARMM improper types.

%FLAG CHARMM_IMPROPER_PHASE
%COMMENT psi: degrees
%FORMAT(5e16.8)
This additional section lists the equilibrium phase angle for each of the CHARMM improper
types.

%FLAG LENNARD_JONES_ACOEF
%FORMAT(3e24.16)
The default format for the Lennard Jones A and B coefficients has been changed from 5e16.8
to 3e24.16.

%FLAG LENNARD_JONES_14_ACOEF
%FORMAT(3e24.16)
This additional section and the corresponding BCOEF section provide the alternative pa-
rameters for 1-4 VDW interactions in the CHARMM force field.

In concert with these prmtop additions, the appropriate modifications have to be made within
sander and pmemd to enable the calculation of the energy and derivatives corresponding to
these new terms. The intention behind the approach of creating a CHARMM enabled prmtop
file is that the use of this prmtop file should be transparent to the user. Once a CHARMM
prmtop file is produced by CHAMBER the sander and pmemd dynamics engines automatically
detect the presence of CHARMM parameters in the prmtop file and automatically select the
correct parameters and code paths.

36
2.12 CHAMBER

WARNING, the use of an unpatched AMBER molecular dynamics engine with a CHAMBER
generated prmtop file will give undefined behavior, leading to incorrect results. If you see the
following error at runtime:

ERROR: Flag "TITLE" not found in PARM file

it most likely means that you are using an old PMEMD or SANDER executable.

2.12.1 Usage
Here is the set of options returned from running the chamber binary:

Usage: chamber [args]


args for input are <default>
-top <top_all27_prot_na.rtf>
-param <par_all27_prot_na.prm>
-psf <[Link]>
-crd <[Link]>
Note: -crd can specify a pdb, a CHARMM crd or CHARMM rst file.
The filetype is auto detected.
args for output are <default>
-p <prmtop>
-inpcrd <inpcrd>
args for options are:
-cmap / -nocmap (Required option. Specifies
whether CMAP terms should be
included or excluded.)
-tip3_flex (allow angle in water)
-box a b c
Set the Orthorhombic lattice parameters a b c
for the generated inpcrd file.
-verbose (lots of progress messages)
-radius_set (GB radius set) options are: <default>
0 bondi radii (bondi)
1 amber6 modified Bondi radii (amber6)
<2> modified Bondi radii (mbondi)
6 H(N)-modified Bondi radii (mbondi2)
arg for help (this message) -h

Typical usage would be as follows:

$AMBERHOME/bin/chamber -cmap -top top_all22_prot.inp \


-param par_all22_prot.inp -psf [Link] -crd [Link] \
-p [Link] -inpcrd [Link] -box 48.37 40.15 35.21

37
2 Specifying a force field

2.12.2 Validation
A force field is defined by its specific potential energy equation and its specific set of associ-
ated parameters; it is independent of the MDE that it is expressed in. For a faithful reproduction
of a force field that exists in a reference MDE, one needs to be able to reproduce the following
in another engine to within a specific precision:
1. The same total potential energy of the system.
2. The same energy gradients on each atom in the system.
However, as soon as dynamics are explored using a force field, external attributes such as ther-
mostat, long range electrostatic treatment, cutoffs come into play and are specific to the MDE;
these are considered outside of the definition of a force field and more closely linked to the type
of simulation being run and the MDE.
Starting with version c36a2 of CHARMM, a command (frcdump) has been implemented
which provides a validation route for alternate implementations of the CHARMM force fields.
The command, frcdump, for a given system, writes the various force field potential energy
contributions, as well as the energy gradient experienced by each atom, to a file using a spe-
cific format and to a high precision. The same formatted output can also be generated by the
AMBER MDEs to facilitate comparison and validation that the CHARMM force field is being
implemented correctly in AMBER’s MDEs.
An example section of a charmm script that will write this output to a file called
charmm_gold_c36a2 is as follows:
open unit 20 form write name charmm_gold_c36a2
frcdump unit 20
close unit 20

The analogous mdin section for AMBER is as follows:


&debugf
do_charmm_dump_gold = 1,
/

Given this directive, the AMBER MDE will stop after evaluating the potential energy of a sys-
tem and write the energy and forces pertaining to this to a (hardcorded) file called charmm_gold
in the same directory as the mdin file. The reader is invited to examine the various example test
calculations within the $AMBERHOME/test/chamber/dev_tests/ directory for in depth exam-
ples of the above. For such testing, it is recommended that both the CHARMM binary and the
AMBER MDE binaries be compiled with the same compiler. Given that CHARMM support
within AMBER and the CHAMBER software is still somewhat experimental it is recommended
that the user initially carries out such a comparison prior to running a long production run.

2.12.3 Known limitations / Issues


This is a non-exhaustive list of the current known bugs and/or limitations with CHAMBER:
• CHARMM polarization models are not supported. (IPOL /= 0)

38
2.12 CHAMBER

• The ability to read CHARMM restart files is no currently supported.


• The mdout file will contain extra potential energy fields pertaining to the CHARMM
terms. This may break or confuse third party scripts that parse such outputs.
• Third party scripts and/or tools which do not correctly parse the extensible prmtop format
may have issues with a CHAMBER generated prmtop file.
• The potential energy decomposition components (self, reciprocal, direct, adjusted) of the
Particle Mesh Ewald energy generated in the charmm_gold file when the do_charmm_dump_gold
= 1 mdin option in AMBER do not match with the breakdown used in CHARMM, how-
ever, the summation and resulting forces do match.

If other issues are found, the CHAMBER authors would be very grateful if these could be
reported to them, either via the Amber mailing list and/or directly to the authors. Please ensure
that prior to reporting an issue, the CHAMBER binary passes the in tree tests. Please provide
a standalone example of the problem with all input files present and a script reproducing the
sequence of commands that triggers the problem. The posting of large files (> 2 MB) to the
Amber mailing list is not recommended; instead one should make the files available on a website
somewhere and provide a link to it with the posting to the list.

2.12.4 Acknowledgments
The authors acknowledge financial support for this work under DoE SciDAC grant DE-
AC36-99G0-10337. RCW acknowledges additional financial support under UC Lab award
09-LR-06-117792 and the San Diego Supercomputer Center Advanced User Support program
and NSF grant TG-MCB090110 for providing supercomputer resources in support of this work.

39
3 LEaP

3.1 Introduction
LEaP is a module from the AMBER suite of programs, which can be used to generate force
field files compatible with NAB. Using tleap, the user can:

Read AMBER PREP input files


Read AMBER PARM format parameter sets
Read and write Object File Format files (OFF)
Read and write PDB files
Construct new residues and molecules using simple commands
Link together residues and create nonbonded complexes of molecules
Modify internal coordinates within a molecule
Generate files that contain topology and parameters for AMBER and NAB
usage: tleap [ -I<dir> ] [ -f <file>|- ]

The command tleap is a simple shell script that calls teLeap with a number of standard argu-
ments. Directories to be searched are indicated by one or more “-I” flags; standard locations
are provided in the tleap script. The “-f” flag is used to tell tleap to take its input from a file (or
from stdin if “-f -” is specified). If there is no “-f” flag, input is taken interactively from the
terminal.

3.2 Concepts
In order to effectively use LEaP it is necessary to understand the philosophy behind the
program, especially of concepts of LEaP commands, variables, and objects. In addition to
exploring these concepts, this section also addresses the use of external files and libraries with
the program.

3.2.1 Commands
A researcher uses LEaP by entering commands that manipulate objects. An object is just a
basic building block; some examples of objects are ATOMs, RESIDUEs, UNITs, and PARM-
SETs. The commands that are supported within LEaP are described throughout the manual and
are defined in detail in the "Command Reference" section.
The heart of LEaP is a command-line interface that accepts text commands which direct the
program to perform operations on objects. All LEaP commands have one of the following two
forms:

41
3 LEaP

command argument1 argument2 argument3 ...


variable = command argument1 argument2 ...

For example:

edit ALA trypsin = loadPdb [Link]

Each command is followed by zero or more arguments that are separated by whitespace. Some
commands return objects which are then associated with a variable using an assignment (=)
statement. Each command acts upon its arguments, and some of the commands modify their
arguments’ contents. The commands themselves are case- insensitive. That is, in the above
example, edit could have been entered as Edit, eDiT, or any combination of upper and lower
case characters. Similarly, loadPdb could have been entered a number of different ways, in-
cluding loadpdb. In this manual, we frequently use a mixed case for commands. We do this
to enhance the differences between commands and as a mnemonic device. Thus, while we
write createAtom, createResidue, and createUnit in the manual, the user can use any case when
entering these commands into the program.
The arguments in the command text may be objects such as NUMBERs, STRINGs, or LISTs
or they may be variables. These two subjects are discussed next.

3.2.2 Variables
A variable is a handle for accessing an object. A variable name can be any alphanumeric
string whose first character is an alphabetic character. (Alphanumeric means that the
characters of the name may be letters, numbers, or special symbols such as "*". The following
special symbols should not be used in variable names: dollar sign, comma, period, pound sign,
equal sign, space, semicolon, double quote, or list open or close characters { and }. LEaP
commands should not be used as variable names. Variable names are case-sensitive: "ARG"
and "arg" are different variables. Variables are associated with objects using an assignment
statement not unlike regular computer languages such as Fortran or C.

mole = 6.02E23
MOLE = 6.02E23
myName = "Joe Smith"
listOf7Numbers = { 1.2 2.3 3.4 4.5 6 7 8 }

In the above examples, both mole and MOLE are variable names, whose contents are the same
(6.02E23). Despite the fact that both mole and MOLE have the same contents, they are not the
same variable. This is due to the fact that variable names are case-sensitive. LEaP maintains a
list of variables that are currently defined and this list can be displayed using the list command.
The contents of a variable can be printed using the desc command.

3.2.3 Objects
The object is the fundamental entity in LEaP. Objects range from the simple objects NUM-
BERS and STRINGS to the complex objects UNITs, RESIDUEs, ATOMs. Complex objects

42
3.2 Concepts

have properties that can be altered using the set command and some complex objects can con-
tain other objects. For example, RESIDUEs are complex objects that can contain ATOMs and
have the properties: residue name, connect atoms, and residue type.

NUMBERs

NUMBERs are simple objects and they are identical to double precision variables in Fortran
and double in C.

STRINGs

STRINGS are simple objects that are identical to character arrays in C and similar to char-
acter strings in Fortran. STRINGS are represented by sequences of characters which may be
delimited by double quote characters. Example strings are:
"Hello there" "String with a "" (quote) character" "Strings contain letters and numbers:1231232"

LISTs

LISTs are made up of sequences of other objects delimited by LIST open and close
characters. The LIST open character is an open curly bracket ({) and the LIST close character
is a close curly bracket (}). LISTs can contain other LISTs and be nested arbitrarily deep.
Example LISTs are:

{ 1 2 3 4 } { 1.2 "string" } { 1 2 3 { 1 2 } { 3 4 } }

LISTs are used by many commands to provide a more flexible way of passing data to the
commands. The zMatrix command has two arguments, one of which is a LIST of LISTs where
each subLIST contains between three and eight objects.

PARMSETs (Parameter Sets)

PARMSETs are objects that contain bond, angle, torsion, and nonbond parameters for AM-
BER force field calculations. They are normally loaded from e.g. [Link] and frcmod files.

ATOMs

ATOMs are complex objects that do not contain any other objects. The ATOM object is
similar to the chemical concept of atoms. Thus, it is a single entity that may be bonded to other
ATOMs and it may be used as a building block for creating molecules. ATOMs have many
properties that can be changed using the set command. These properties are defined below.

name This is a case-sensitive STRING property and it is the ATOM’s name. The names for
all ATOMs in a RESIDUE should be unique. The name has no relevance to molecular
mechanics force field parameters; it is chosen arbitrarily as a means to identify ATOMs.
Ideally, the name should correspond to the PDB standard, being 3 characters long except
for hydrogens, which can have an extra digit as a 4th character.

43
3 LEaP

type This is a STRING property. It defines the AMBER force field atom type. It is impor-
tant that the character case match the canonical type definition used in the appropriate
"[Link]" or "frcmod" file. For smooth operation, all atom types need to have element
and hybridization defined by the addAtomTypes command. The standard AMBER force
field atom types are added by the default "leaprc" file.
charge The charge property is a NUMBER that represents the ATOM’s electrostatic point
charge to be used in a molecular mechanics force field.
element The atomic element provides a simpler description of the atom than the type, and
is used only for LEaP’s internal purposes (typically when force field information is not
available). The element names correspond to standard nomenclature; the character "?" is
used for special cases.
position This property is a LIST of NUMBERS. The LIST must contain three values: the (X,
Y, Z) Cartesian coordinates of the ATOM.

RESIDUEs

RESIDUEs are complex objects that contain ATOMs. RESIDUEs are collections of ATOMs,
and are either molecules (e.g. formaldehyde) or are linked together to form molecules (e.g.
amino acid monomers). RESIDUEs have several properties that can be changed using the set
command. (Note that database RESIDUEs are each contained within a UNIT having the same
name; the residue GLY is referred to as GLY.1 when setting properties. When two of these
single-UNIT residues are joined, the result is a single UNIT containing the two RESIDUEs.)
One property of RESIDUEs is connection ATOMs. Connection ATOMs are ATOMs that are
used to make linkages between RESIDUEs. For example, in order to create a protein, the N-
terminus of one amino acid residue must be linked to the C-terminus of the next residue. This
linkage can be made within LEaP by setting the N ATOM to be a connection ATOM at the N-
terminus and the C ATOM to be a connection ATOM at the C-terminus. As another example,
two CYX amino acid residues may form a disulfide bridge by crosslinking a connection atom
on each residue.
There are several properties of RESIDUEs that can be modified using the set command. The
properties are described below:
connect0 This defines an ATOM that is used in making links to other RESIDUEs. In UNITs
containing single RESIDUEs, the RESIDUEs’ connect0 ATOM is usually defined as the
UNITs’ head ATOM. (This is how the standard library UNITs are defined.) For amino
acids, the convention is to make the N-terminal nitrogen the connect0 ATOM.
connect1 This defines an ATOM that is used in making links to other RESIDUEs. In UNITs
containing single RESIDUEs, the RESIDUEs’ connect1 ATOM is usually defined as the
UNITs’ tail ATOM. (This is done in the standard library UNITs.) For amino acids, the
convention is to make the C-terminal oxygen the connect1 ATOM.
connect2 This is an ATOM property which defines an ATOM that can be used in making links
to other RESIDUEs. In amino acids, the convention is that this is the ATOM to which
disulphide bridges are made.

44
3.2 Concepts

restype This property is a STRING that represents the type of the RESIDUE. Currently, it
can have one of the following values: "undefined", "solvent", "protein", "nucleic", or
"saccharide". Some of the LEaP commands behave in different ways depending on the
type of a residue. For example, the solvate commands require that the solvent residues
be of type "solvent". It is important that the proper character case be used when defining
this property.

name The RESIDUE name is a STRING property. It is important that the proper character
case be used when defining this property.

UNITs

UNITs are the most complex objects within LEaP, and the most important. UNITs, when
paired with one or more PARMSETs, contain all of the information required to perform a
calculation using AMBER. UNITs have the following properties which can be changed using
the set command:

head

tail These define the ATOMs within the UNIT that are connected when UNITs are joined to-
gether using the sequence command or when UNITs are joined together with the PDB
or PREP file reading commands. The tail ATOM of one UNIT is connected to the head
ATOM of the next UNIT in any sequence. (Note: a "TER card" in a PDB file causes a
new UNIT to be started.)

box This property can either be null, a NUMBER, or a LIST. The property defines the bounding
box of the UNIT. If it is defined as null then no bounding box is defined. If the value is a
single NUMBER then the bounding box will be defined to be a cube with each side being
NUMBER of angstroms across. If the value is a LIST then it must be a LIST containing
three numbers, the lengths of the three sides of the bounding box.

cap This property can either be null or a LIST. The property defines the solvent cap of the
UNIT. If it is defined as null then no solvent cap is defined. If the value is a LIST then
it must contain four numbers, the first three define the Cartesian coordinates (X, Y, Z) of
the origin of the solvent cap in angstroms, the fourth NUMBER defines the radius of the
solvent cap in angstroms.

Examples of setting the above properties are:

set dipeptide head dipeptide.1.N


set dipeptide box { 5.0 10.0 15.0 }
set dipeptide cap { 15.0 10.0 5.0 8.0 }

The first example makes the amide nitrogen in the first RESIDUE within "dipeptide" the head
ATOM. The second example places a rectangular bounding box around the origin with the (X,
Y, Z) dimensions of ( 5.0, 10.0, 15.0 ) in angstroms. The third example defines a solvent cap
centered at ( 15.0, 10.0, 5.0 ) angstroms with a radius of 8.0 . Note: the "set cap" command does

45
3 LEaP

not actually solvate, it just sets an attribute. See the solvateCap command for a more practical
case.
UNITs are complex objects that can contain RESIDUEs and ATOMs. UNITs can be created
using the createUnit command and modified using the set commands. The contents of a UNIT
can be modified using the add and remove commands.

Complex objects and accessing subobjects

UNITs and RESIDUEs are complex objects. Among other things, this means that they can
contain other objects. There is a loose hierarchy of complex objects and what they are allowed
to contain. The hierarchy is as follows:
• UNITs can contain RESIDUEs and ATOMs.
• RESIDUEs can contain ATOMs.
The hierarchy is loose because it does not forbid UNITs from containing ATOMs directly. How-
ever, the convention that has evolved within LEaP is to have UNITs directly contain RESIDUEs
which directly contain ATOMs.
Objects that are contained within other objects can be accessed using dot "." notation. An
example would be a UNIT which describes a dipeptide ALA-PHE. The UNIT contains two
RESIDUEs each of which contain several ATOMs. If the UNIT is referenced (named) by the
variable dipeptide, then the RESIDUE named ALA can be accessed in two ways. The user
may type one of the following commands to display the contents of the RESIDUE:
desc [Link] desc dipeptide.1

The first translates to "some RESIDUE named ALA within the UNIT named dipeptide". The
second form translates as "the RESIDUE with sequence number 1 within the UNIT named
dipeptide". The second form is more useful because every subobject within an object is
guaranteed to have a unique sequence number. If the first form is used and there is more than
one RESIDUE with the name ALA, then an arbitrary residue with the name ALA is returned.
To access ATOMs within RESIDUEs, the notation to use is as follows:
desc [Link] desc dipeptide.1.3

Assuming that the ATOM with the name CA has a sequence number 3, then both of the above
commands will print a description of the $alpha$-carbon of RESIDUE [Link] or dipep-
tide.1. The reader should keep in mind that [Link] is the ATOM, an object, con-
tained within the RESIDUE named ALA within the variable dipeptide. This means that dipep-
[Link] can be used as an argument to any command that requires an ATOM as an argument.
However [Link] is not a variable and cannot be used on the left hand side of an assign-
ment statement.

3.3 Basic instructions for using LEaP


This section gives an overview of how LEaP is most commonly used. Detailed descriptions
of all the commands are given in the following section

46
3.3 Basic instructions for using LEaP

3.3.1 Building a Molecule For Molecular Mechanics


In order to prepare a molecule within LEaP for AMBER, three basic tasks need to be com-
pleted.
1. Any needed UNIT or PARMSET objects must be loaded;
2. The molecule must be constructed within LEaP;
3. The user must output topology and coordinate files from LEaP to use in AMBER.
The most typical command sequence is the following:
source leaprc.ff99SB (load a force field)
x = loadPdb [Link] (load in a structure)
.... add in cross-links, solvate, etc.
saveAmberParm x prmtop prmcrd (save files)

There are a number of variants of this:


1. Although loadPdb is by far the most common way to enter a structure, one might use
loadOff, or loadAmberPrep, or use the zmat command to build a molecule from a zmatrix.
See the Commands section below for descriptions of these options. If you do not have
a starting structure (in the form of a pdb file), LEaP can be used to build the molecule;
you will find, however, that this is not always as easy as it might be. Many experienced
Amber users turn to other (commercial and non-commercial) programs to create their
initial structures.
2. Be very attentive to any errors produced in the loadPdb step; these generally mean that
LEaP has mis-read the file. A general rule of thumb is to keep editing your input pdb
file until LEaP stops complaining. It is often convenient to use the addPdbAtomMap or
addPdbResMap commands to make systematic changes from the names in your pdb files
to those in the Amber topology files; see the leaprc files for examples of this.
3. The saveAmberParm command cited above is appropriate for calculations that do not
compute free energies; for the latter you will need to use saveAmberParmPert. For polar-
izable force fields, you will need to add Pol to the above commands (see the Commands
section, below.)

3.3.2 Amino Acid Residues


For each of the amino acids found in the LEaP libraries, there has been created an
n-terminal and a c-terminal analog. The n-terminal amino acid UNIT/RESIDUE names and
aliases are prefaced by the letter N (e.g. NALA) and the c-terminal amino acids by the letter C
(e.g. CALA}. If the user models a peptide or protein within LEaP, they may choose one of
three ways to represent the terminal amino acids. The user may use 1)standard amino acids, 2)
protecting groups (ACE/NME), or 3) the charged c- and n-terminal amino acid
UNITs/RESIDUEs. If the standard amino acids are used for the terminal residues, then these
residues will have incomplete valences. These three options are illustrated below:

47
3 LEaP

{ ALA VAL SER PHE }


{ ACE ALA VAL SER PHE NME }
{ NALA VAL SER CPHE }

The default for loading from PDB files is to use n- and c-terminal residues; this is established
by the addPdbResMap command in the default leaprc files. To force incomplete valences with
the standard residues, one would have to define a sequence (" x = { ALA VAL SER PHE }")
and use loadPdbUsingSeq, or use clearPdbResMap to completely remove the mapping feature.
Histidine can exist either as the protonated species or as a neutral species with a hydrogen at
the delta or epsilon position. For this reason, the histidine UNIT/RESIDUE name is either HIP,
HID, or HIE (but not HIS). The default "leaprc" file assigns the name HIS to HID. Thus, if a
PDB file is read that contains the residue HIS, the residue will be assigned to the HID UNIT
object. This feature can be changed within one’s own "leaprc" file.
The AMBER force fields also differentiate between the residue cysteine (CYS) and the simi-
lar residue which participates in disulfide bridges, cystine (CYX). The user will have to explic-
itly define, using the bond command, the disulfide bond for a pair of cystines, as this information
is not read from the PDB file. In addition, the user will need to load the PDB file using the load-
PdbUsingSeq command, substituting CYX for CYS in the sequence wherever a disulfide bond
will be created.

3.3.3 Nucleic Acid Residues


The "D" or "R" prefix can be used to distinguish between deoxyribose and ribose units; with
the default leaprc file, ambiguous residues are assumed to be deoxy. Residue names like "DA"
can be followed by a "5" or "3" ("DA5", "DA3") for residues at the ends of chains; this is also
the default established by addPdbResMap, even if the "5" or "3" are not added in the PDB
file. The "5" and "3" residues are "capped" by a hydrogen; the plain and "3" residues include
a "leading" phosphate group. Neutral residues capped by hydrogens are end in "N," such as
"DAN."

3.4 Commands
The following is a description of the commands that can be accessed using the command line
interface in tleap, or through the command line editor in xleap. Whenever an argument in a
command line definition is enclosed in brackets ([arg]), then that argument is optional. When
examples are shown, the command line is prefaced by "> ", and the program output is shown
without this character preface.
Some commands that are almost never used have been removed from this description to save
space. You can use the "help" facility to obtain information about these commands; most only
make sense if you understand what the program is doing behind the scenes.

3.4.1 add
add a b

48
3.4 Commands

UNIT/RESIDUE/ATOM a,b
Add the object b to the object a. This command is used to place ATOMs within RESIDUEs,
and RESIDUEs within UNITs. This command will work only if b is not contained by any other
object.
The following example illustrates both the add command and the way the tip3p water
molecule is created for the LEaP distribution tape.
> h1 = createAtom H1 HW 0.417
> h2 = createAtom H2 HW 0.417
> o = createAtom O OW -0.834
>
> set h1 element H
> set h2 element H
> set o element O
>
> r = createResidue TIP3
> add r h1
> add r h2
> add r o
>
> bond h1 o
> bond h2 o
> bond h1 h2
>
> TIP3 = createUnit TIP3
>
> add TIP3 r
> set TIP3.1 restype solvent
> set TIP3.1 imagingAtom TIP3.1.O
>
> zMatrix TIP3 {
> { H1 O 0.9572 }
> { H2 O H1 0.9572 104.52 }
> }
>
> saveOff TIP3 [Link]
Saving TIP3.
Building topology.
Building atom parameters.

3.4.2 addAtomTypes
addAtomTypes { { type element hybrid } { ... } ... }

Define element and hybridization for force field atom types. This command for the standard
force fields can be seen in the default leaprc files. The STRINGs are most safely rendered using

49
3 LEaP

quotation marks. If atom types are not defined, confusing messages about hybridization can
result when loading PDB files.

3.4.3 addIons
addIons unit ion1 numIon1 [ion2 numIon2]

Adds counterions in a shell around unit using a Coulombic potential on a grid. If numIon1
is 0, then the unit is neutralized. In this case, numIon1 must be opposite in charge to unit
and numIon2 cannot be specified. If solvent is present, it is ignored in the charge and steric
calculations, and if an ion has a steric conflict with a solvent molecule, the ion is moved to the
center of said molecule, and the latter is deleted. (To avoid this behavior, either solvate _after_
addions, or use addIons2.) Ions must be monoatomic. This procedure is not guaranteed to
globally minimize the electrostatic energy. When neutralizing regular-backbone nucleic acids,
the first cations will generally be placed between phosphates, leaving the final two ions to be
placed somewhere around the middle of the molecule. The default grid resolution is 1 angstrom,
extending from an inner radius of ( maxIonVdwRadius + maxSoluteAtomVdwRadius ) to an
outer radius 4 angstroms beyond. A distance-dependent dielectric is used for speed.

3.4.4 addIons2
addIons2 unit ion1 numIon1 [ion2 numIon2]

Same as addIons, except solvent and solute are treated the same.

3.4.5 addPath
addPath path

Add the directory in path to the list of directories that are searched for files specified by other
commands. The following example illustrates this command.
> addPath /disk/howard /disk/howard added to file search path.

After the above command is entered, the program will search for a file in this directory if a
file is specified in a command. Thus, if a user has a library named "/disk/howard/[Link]"
and the user wants to load that library, one only needs to enter load [Link] and not load
/disk/howard/[Link].

3.4.6 addPdbAtomMap
addPdbAtomMap list

The atom Name Map is used to try to map atom names read from PDB files to atoms within
residue UNITs when the atom name in the PDB file does not match an atom in the residue.
This enables PDB files to be read in without extensive editing of atom names. Typically, this
command is placed in the LEaP start-up file, "leaprc", so that assignments are made at the

50
3.4 Commands

beginning of the session. The LIST is a LIST of LISTs. Each sublist contains two entries to
add to the Name Map. Each entry has the form:

{ string string }

where the first string is the name within the PDB file, and the second string is the name in the
residue UNIT.

3.4.7 addPdbResMap
addPdbResMap list

The Name Map is used to map RESIDUE names read from PDB files to variable names within
LEaP. Typically, this command is placed in the LEaP start-up file, "leaprc", so that
assignments are made at the beginning of the session. The LIST is a LIST of LISTs. Each
sublist contains two or three entries to add to the Name Map. Each entry has the form:

{ double string string }

where double can be 0 or 1, the first string is the name within the PDB file, and the second
string is the variable name to which the first string will be mapped. To illustrate, the following
is part of the Name Map that exists when LEaP is started from the "leaprc" file included in the
distribution tape:

ADE --> DADE


: :
0 ALA --> NALA
0 ARG --> NARG
: :
1 ALA --> CALA
1 ARG --> CARG
: :
1 VAL --> CVAL

Thus, the residue ALA will be mapped to NALA if it is the N-terminal residue and CALA if it
is found at the C-terminus. The above Name Map was produced using the following (edited)
command line:

> addPdbResMap {
> { 0 ALA NALA } { 1 ALA CALA }
> { 0 ARG NARG } { 1 ARG CARG } : :
> { 0 VAL NVAL } { 1 VAL CVAL }
> : :
> { ADE DADE } : :
> }

51
3 LEaP

3.4.8 alias
alias [ string1 [ string2 ] ]

This command will add or remove an entry to the Alias Table or list entries in the Alias Table.
If both strings are present, then string1 becomes the alias to string2, the original command. If
only one string is used as an argument, then this string is removed from the Alias Table. If no
arguments are given with the command, the current aliases stored in the Alias Table will be
listed.
The proposed alias is first checked for conflict with the LEaP commands and it is rejected if
a conflict is found. A proposed alias will replace an existing alias with a warning being issued.
The alias can stand for more than a single word, but also as an entire string so the user can
quickly repeat entire lines of input.

3.4.9 bond
bond atom1 atom2 [ order ]

Create a bond between atom1 and atom2. Both of these ATOMs must be contained by the
same UNIT. By default, the bond will be a single bond. By specifying "-", "=", "#", or ":" as
the optional argument, order, the user can specify a single, double, triple, or aromatic bond,
respectively. Example:
bond [Link] [Link]

3.4.10 bondByDistance
bondByDistance container [ maxBond ]

Create single bonds between all ATOMs in container that are within maxBond angstroms of
each other. If maxBond is not specified then a default distance will be used. This command is
especially useful in building molecules. Example:
bondByDistance alkylChain

3.4.11 check
check unit [ parms ]

This command can be used to check the UNIT for internal inconsistencies that could cause
problems when performing calculations. This is a very useful command that should be used be-
fore a UNIT is saved with saveAmberParm or its variants. Currently it checks for the following
possible problems:
o long bonds o short bonds o non-integral total charge of the UNIT. o missing force field
atom types o close contacts (< 1.5 ) between nonbonded ATOMs.
The user may collect any missing molecular mechanics parameters in a PARMSET for
subsequent editing. In the following example, the alanine UNIT found in the amino acid
library has been examined by the check command:

52
3.4 Commands

> check ALA


Checking ’ALA’....
Checking parameters for unit ’ALA’.
Checking for bond parameters.
Checking for angle parameters.
Unit is OK.

3.4.12 combine
variable = combine list

Combine the contents of the UNITs within list into a single UNIT. The new UNIT is placed in
variable. This command is similar to the sequence command except it does not link the
ATOMs of the UNITs together. In the following example, the input and output should be
compared with the example given for the sequence command.
> tripeptide = combine { ALA GLY PRO }
Sequence: ALA
Sequence: GLY
Sequence: PRO
> desc tripeptide
UNIT name: ALA !! bug: this should be tripeptide!
Head atom: .R<ALA 1>.A<N 1>
Tail atom: .R<PRO 3>.A<C 13>
Contents:
R<ALA 1>
R<GLY 2>
R<PRO 3>

3.4.13 copy
newvariable = copy variable

Creates an exact duplicate of the object variable. Since newvariable is not pointing to the same
object as variable, changing the contents of one object will not alter the other object. Example:

> tripeptide = sequence { ALA GLY PRO }


> tripeptideSol = copy tripeptide
> solvateBox tripeptideSol WATBOX216 8 2

In the above example, tripeptide is a separate object from tripeptideSol and is not solvated.
Had the user instead entered
> tripeptide = sequence { ALA GLY PRO }
> tripeptideSol = tripeptide
> solvateBox tripeptideSol WATBOX216 8 2

53
3 LEaP

then both tripeptide and tripeptideSol would be solvated since they would both point to the same
object.

3.4.14 createAtom
variable = createAtom name type charge

Return a new and empty ATOM with name, type, and charge as its atom name, atom type, and
electrostatic point charge. (See the add command for an example of the createAtom command.)

3.4.15 createResidue
variable = createResidue name

Return a new and empty RESIDUE with the name "name". (See the add command for an
example of the createResidue command.)

3.4.16 createUnit
variable = createUnit name

Return a new and empty UNIT with the name "name". (See the add command for an example
of the createUnit command.)

3.4.17 deleteBond
deleteBond atom1 atom2

Delete the bond between the ATOMs atom1 and atom2. If no bond exists, an error will be
displayed.

3.4.18 desc
desc variable

Print a description of the object. In the following example, the alanine UNIT found in the
amino acid library has been examined by the desc command:

> desc ALA


UNIT name: ALA
Head atom: .R<ALA 1>.A<N 1>
Tail atom: .R<ALA 1>.A<C 9>
Contents: R<ALA 1>

Now, the desc command is used to examine the first residue (1) of the alanine UNIT:

54
3.4 Commands

> desc ALA.1


RESIDUE name: ALA
RESIDUE sequence number: 1
Type: protein
Connection atoms:
Connect atom 0: A<N 1>
Connect atom 1: A<C 9>
Contents:
A<N 1>
A<HN 2>
A<CA 3>
A<HA 4>
A<CB 5>
A<HB1 6>
A<HB2 7>
A<HB3 8>
A<C 9>
A<O 10>

Next, we illustrate the desc command by examining the ATOM N of the first residue (1) of the
alanine UNIT:
> desc ALA.1.N
ATOM Name: N
Type: N
Charge: -0.463
Element: N
Atom flags: 20000|posfxd- posblt- posdrn- sel- pert- notdisp- tchd-
posknwn+ int - nmin- nbld-
Atom position: 3.325770, 1.547909, -0.000002
Atom velocity: 0.000000, 0.000000, 0.000000
Bonded to .R<ALA 1>.A<HN 2> by a single bond.
Bonded to .R<ALA 1>.A<CA 3> by a single bond.

Since the N ATOM is also the first atom of the ALA residue, the following command will give
the same output as the previous example:
> desc ALA.1.1

3.4.19 groupSelectedAtoms
groupSelectedAtoms unit name

Create a group within unit with the name, "name", using all of the ATOMs within the UNIT
that are selected. If the group has already been defined then overwrite the old group. The desc
command can be used to list groups. Example:
groupSelectedAtoms TRP sideChain

55
3 LEaP

An expression like "TRP@sideChain" returns a LIST, so any commands that require LIST ’s
can take advantage of this notation. After assignment, one can access groups using the "@"
notation. Examples:
select TRP@sideChain
center TRP@sideChain
The latter example will calculate the center of the atoms in the "sideChain" group. (see the
select command for a more detailed example.)

3.4.20 help
help [string]

This command prints a description of the command in string. If the STRING is not given then
a list of help topics is provided.

3.4.21 impose
impose unit seqlist internals

The impose command allows the user to impose internal coordinates on the UNIT. The list of
RESIDUEs to impose the internal coordinates upon is in seqlist. The internal coordinates to
impose are in the LIST internals.
The command works by looking into each RESIDUE within the UNIT that is listed in the
seqlist argument and attempts to apply each of the internal coordinates within internals. The se-
qlist argument is a LIST of NUMBERS that represent sequence numbers or ranges of sequence
numbers. Ranges of sequence numbers are represented by two element LISTs that contain the
first and last sequence number in the range. The user can specify sequence number ranges that
are larger than what is found in the UNIT. For example, the range { 1 999 } represents all
RESIDUEs in a 200 RESIDUE UNIT.
The internals argument is a LIST of LISTs. Each sublist contains a sequence of ATOM
names which are of type STRING followed by the value of the internal coordinate. An
example of the impose command would be:

impose peptide { 1 2 3 } { { N CA C N -40.0 } { C N CA C -60.0 } }


This would cause the RESIDUE with sequence numbers 1, 2, and 3 within the UNIT peptide
to assume an alpha helical conformation. The command
impose peptide { 1 2 { 5 10 } 12 } { { CA CB 5.0 } }
will impose on the residues with sequence numbers 1, 2, 5, 6, 7, 8, 9, 10, and 12 within the
UNIT peptide a bond length of 5.0 angstroms between the alpha and beta carbons. RESIDUEs
without an ATOM named CB (like glycine) will be unaffected.
Three types of conformational change are supported: bond length changes, bond angle
changes, and torsion angle changes. If the conformational change involves a torsion angle,
then all dihedrals around the central pair of atoms are rotated. The entire list of internals are
applied to each RESIDUE.

56
3.4 Commands

3.4.22 list
List all of the variables currently defined. To illustrate, the following (edited) output shows
the variables defined when LEaP is started from the leaprc file included in the distribution
tape:
> list A ACE ALA ARG ASN : : VAL W WAT Y

3.4.23 loadAmberParams
variable = loadAmberParams filename

Load an AMBER format parameter set file and place it in variable. All interactions defined in
the parameter set will be contained within variable. This command causes the loaded
parameter set to be included in LEaP ’s list of parameter sets that are searched when
parameters are required. General proper and improper torsion parameters are modified during
the command execution with the LEaP general type "?" replacing the AMBER general type
"X".
> parm91 = loadAmberParams [Link]
> saveOff parm91 [Link]

3.4.24 loadAmberPrep
loadAmberPrep filename [ prefix ]

This command loads an AMBER PREP input file. For each residue that is loaded, a new UNIT
is constructed that contains a single RESIDUE and a variable is created with the same name as
the name of the residue within the PREP file. If the optional argument prefix is provided it will
be prefixed to each variable name; this feature is used to prefix UATOM residues, which have
the same names as AATOM residues with the string "U" to distinguish them.
> loadAmberPrep [Link]
Loaded UNIT: CRA

3.4.25 loadOff
loadOff filename

This command loads the OFF library within the file named filename. All UNITs and
PARMSETs within the library will be loaded. The objects are loaded into LEaP under the
variable names the objects had when they were saved. Variables already in existence that have
the same names as the objects being loaded will be overwritten. Any PARMSETs loaded using
this command are included in LEaP ’s library of PARMSETs that is searched whenever
parameters are required (The old AMBER format is used for PARMSETs rather than the OFF
format in the default configuration). Example command line:
> loadOff [Link]
Loading library: [Link]
Loading: PARAMETERS

57
3 LEaP

3.4.26 loadMol2
variable = loadMol2 filename

Load a Sybyl MOL2 format file in a UNIT. This command is very much like loadOff, except
that it only creates a single UNIT.

3.4.27 loadPdb
variable = loadPdb filename

Load a Protein Databank format file with the file name filename. The sequence numbers of the
RESIDUEs will be determined from the order of residues within the PDB file ATOM records.
This function will search the variables currently defined within LEaP for variable names that
map to residue names within the ATOM records of the PDB file. If a matching variable name
is found then the contents of the variable are added to the UNIT that will contain the structure
being loaded from the PDB file. Adding the contents of the matching UNIT into the UNIT
being constructed means that the contents of the matching UNIT are copied into the UNIT
being built and that a bond is created between the connect0 ATOM of the matching UNIT and
the connect1 ATOM of the UNIT being built. The UNITs are combined in the same way
UNITs are combined using the sequence command. As atoms are read from the ATOM
records their coordinates are written into the correspondingly named ATOMs within the UNIT
being built. If the entire residue is read and it is found that ATOM coordinates are missing,
then external coordinates are built from the internal coordinates that were defined in the
matching UNIT. This allows LEaP to build coordinates for hydrogens and lone-pairs which are
not specified in PDB files.

> crambin = loadPdb 1crn

3.4.28 loadPdbUsingSeq
loadPdbUsingSeq filename unitlist

This command reads a Protein Data Bank format file from the file named filename. This
command is identical to loadPdb except it does not use the residue names within the PDB file.
Instead the sequence is defined by the user in unitlist. For more details see loadPdb.

> peptSeq = { UALA UASN UILE UVAL UGLY }


> pept = loadPdbUsingSeq [Link] peptSeq

In the above example, a variable is first defined as a LIST of united atom RESIDUEs. A PDB
file is then loaded, in this sequence order, from the file "[Link]".

3.4.29 logFile
logFile filename

58
3.4 Commands

This command opens the file with the file name filename as a log file. User input and all output
is written to the log file. Output is written to the log file as if the verbosity level were set to 2.
An example of this command is
> logfile /disk/howard/[Link]

3.4.30 measureGeom
measureGeom atom1 atom2 [ atom3 [ atom4 ] ]

Measure the distance, angle, or torsion between two, three, or four ATOMs, respectively.
In the following example, we first describe the RESIDUE ALA of the ALA UNIT in order
to find the identity of the ATOMs. Next, the measureGeom command is used to determine a
distance, simple angle, and a dihedral angle. As shown in the example, the ATOMs may be
identified using atom names or numbers.
> desc [Link]
RESIDUE name: ALA
RESIDUE sequence number: 1
Type: protein ....

3.4.31 quit
Quit the LEaP program.

3.4.32 remove
remove a b

Remove the object b from the object a. If b is not contained by a then an error message will be
displayed. This command is used to remove ATOMs from RESIDUEs, and RESIDUEs from
UNITs. If the object represented by b is not referenced by some variable name then it will be
destroyed.
> dipeptide = combine { ALA GLY }
Sequence: ALA
Sequence: GLY
> desc dipeptide
UNIT name: ALA !! bug: this should be dipeptide!
Head atom: .R<ALA 1>.A<N 1>
Tail atom: .R<GLY 2>.A<C 6>
Contents: R<ALA 1> R<GLY 2>
> remove dipeptide dipeptide.2
> desc dipeptide UNIT name: ALA !! bug: this should be dipeptide!
Head atom: .R<ALA 1>.A<N 1>
Tail atom: null
Contents: R<ALA 1>

59
3 LEaP

3.4.33 saveAmberParm
saveAmberParm unit topologyfilename coordinatefilename

Save the AMBER/NAB topology and coordinate files for the UNIT into the files named topol-
ogyfilename and coordinatefilename respectively. This command will cause LEaP to search its
list of PARMSETs for parameters defining all of the interactions between the ATOMs within the
UNIT. This command produces topology files and coordinate files that are identical in format
to those produced by AMBER PARM and can be read into AMBER and NAB for calculations.
The output of this operation can be used for minimizations, dynamics, and thermodynamic
perturbation calculations.
In the following example, the topology and coordinates from the all_amino94.lib UNIT
ALA are generated:

> saveamberparm ALA [Link] [Link]

3.4.34 saveMol2
saveMol2 unit filename type-flag

Write UNIT to the file filename as a Tripos mol2 format file. If type-flag is 0, the Tripos (Sybyl)
atom types will be used; if type-flag is 1, the Amber atom types that are in the unit will be used.
Generally, you would want to set type-flag to 1, unless you need the Sybyl atom types for use in
some program outside Amber; Amber itself doesn’t have any force fields that use Sybyl atom
types.

3.4.35 saveOff
saveOff object filename

The saveOff command allows the user to save UNITs and PARMSETs to a file named filename.
The file is written using the Object File Format (off) and can accommodate an unlimited number
of uniquely named objects. The names by which the objects are stored are the variable names
specified in the argument of this command. If the file filename already exists then the new
objects will be added to the file. If there are objects within the file with the same names as
objects being saved then the old objects will be overwritten. The argument object can be a
single UNIT, a single PARMSET, or a LIST of mixed UNITs and PARMSETs. (See the add
command for an example of the saveOff command.)

3.4.36 savePdb
savePdb unit filename

Write UNIT to the file filename as a PDB format file. In the following example, the PDB file
from the "all_amino94.lib" UNIT ALA is generated:

> savepdb ALA [Link]

60
3.4 Commands

3.4.37 sequence
variable = sequence list

The sequence command is used to create a new UNIT by combining the contents of a LIST of
UNITs. The first argument is a LIST of UNITs. A new UNIT is constructed by taking each
UNIT in the sequence in turn and copying its contents into the UNIT being constructed. As
each new UNIT is copied, a bond is created between the tail ATOM of the UNIT being
constructed and the head ATOM of the UNIT being copied, if both connect ATOMs are
defined. If only one is defined, a warning is generated and no bond is created. If neither
connection ATOM is defined then no bond is created. As each RESIDUE is copied into the
UNIT being constructed it is assigned a sequence number which represents the order the
RESIDUEs are added. Sequence numbers are assigned to the RESIDUEs so as to maintain the
same order as was in the UNIT before it was copied into the UNIT being constructed. This
command builds reasonable starting coordinates for all ATOMs within the UNIT; it does this
by assigning internal coordinates to the linkages between the RESIDUEs and building the
external coordinates from the internal coordinates from the linkages and the internal
coordinates that were defined for the individual UNITs in the sequence.

> tripeptide = sequence { ALA GLY PRO }

3.4.38 set
set default variable value
or set container parameter object

This command sets the values of some global parameters (when the first argument is "default")
or sets various parameters associated with container. The following parameters can be set within
LEaP:
For "default" parameters

OldPrmtopFormat If set to "on", the saveAmberParm command will write a prmtop file in the
format used in Amber6 and before; if set to "off" (the default), it will use the new format.

Dielectric If set to "distance" (the default), electrostatic calculations in LEaP will use a distance-
dependent dielectric; if set to "constant", and constant dielectric will be used.

PdbWriteCharges If set to "on", atomic charges will be placed in the "B-factor" field of pdb
files saved with the savePdb command; if set to "off" (the default), no such charges will
be written.

PBRadii Used to choose various sets of atomic radii for generalized Born or Poisson-Boltzmann
calculations. Options are: bondi, which gives values from Ref. [65], which may be used
with igb=2, 5 or 7; mbondi, which is the default, and the recommended parameter set for
igb=1 [66]; mbondi2, which is a second modification of the Bondi radii set [67], and can
also be used with igb=2 or 5; and amber6, which is only to be used for reproducing very
early calculations that used igb=1 [68].

61
3 LEaP

For ATOMs:

name A unique STRING descriptor used to identify ATOMs.

type This is a STRING property that defines the AMBER force field atom type.

charge The charge property is a NUMBER that represents the ATOM’s electrostatic point
charge to be used in a molecular mechanics force field.

position This property is a LIST of NUMBERS containing three values: the (X, Y, Z) Carte-
sian coordinates of the ATOM.

pertName The STRING is a unique identifier for an ATOM in its final state during a Free
Energy Perturbation calculation.

pertType The STRING is the AMBER force field atom type of a perturbed ATOM.

pertCharge This NUMBER represents the final electrostatic point charge on an ATOM during
a Free Energy Perturbation.

For RESIDUEs:

connect0 This defines an ATOM that is used in making links to other RESIDUEs. In UNITs
containing single RESIDUEs, the RESIDUEsS connect0 ATOM is usually defined as the
UNIT’s head ATOM.

connect1 This is an ATOM property which defines an ATOM that is used in making links to
other RESIDUEs. In UNITs containing single RESIDUEs, the RESIDUEsS connect1
ATOM is usually defined as the UNIT’s tail ATOM.

connect2 This is an ATOM property which defines an ATOM that can be used in making links
to other RESIDUEs. In amino acids, the convention is that this is the ATOM to which
disulphide bridges are made.

restype This property is a STRING that represents the type of the RESIDUE. Currently, it
can have one of the following values: "undefined", "solvent", "protein", "nucleic", or
"saccharide".

name This STRING property is the RESIDUE name.

For UNITs:

head Defines the ATOM within the UNIT that is connected when UNITs are joined together:
the tail ATOM of one UNIT is connected to the head ATOM of the subsequent UNIT in
any sequence.

tail Defines the ATOM within the UNIT that is connected when UNITs are joined together: the
tail ATOM of one UNIT is connected to the head ATOM of the subsequent UNIT in any
sequence.

62
3.4 Commands

box The property defines the bounding box of the UNIT. If it is defined as null then no bound-
ing box is defined. If the value is a single NUMBER then the bounding box will be
defined to be a cube with each side being NUMBER of angstroms across. If the value is
a LIST then it must be a LIST containing three numbers, the lengths of the three sides of
the bounding box.

cap The property defines the solvent cap of the UNIT. If it is defined as null then no solvent
cap is defined. If the value is a LIST then it must contain four numbers, the first three
define the Cartesian coordinates (X, Y, Z) of the origin of the solvent cap in angstroms,
the fourth NUMBER defines the radius of the solvent cap in angstroms.

3.4.39 solvateBox and solvateOct


solvateBox solute solvent distance [ closeness ]
solvateOct solute solvent distance [ closeness ]

The solvateBox command creates a periodic solvent rectangular box around the solute UNIT.
The shape for solvateOct is a truncated octahedron. The solute UNIT is modified by the addition
of solvent RESIDUEs, such that the closest distance between any atom of the solute and the
edge of the periodic box is given by the distance parameter. The solvent box will be repeated
in all three spatial directions.
The optional closeness parameter can be used to control how close, in angstroms, solvent
ATOMs can come to solute ATOMs. The default value of the closeness argument is 1.0.
Smaller values allow solvent ATOMs to come closer to solute ATOMs. The criterion for
rejection of overlapping solvent RESIDUEs is if the distance between any solvent ATOM to
the closest solute ATOM is less than the sum of the ATOMs VANDERWAAL’s distances
multiplied by the closeness argument.

> mol = loadpdb [Link]


> solvateOct mol TIP3PBOX 12.0 0.75

3.4.40 solvateCap
solvateCap solute solvent position radius [ closeness ]

The solvateCap command creates a solvent cap around the solute UNIT. The solute UNIT is
modified by the addition of solvent RESIDUEs. The solvent box will be repeated in all three
spatial directions to create a large solvent sphere with a radius of radius angstroms.
The position argument defines where the center of the solvent cap is to be placed. If position
is a RESIDUE, ATOM, or a LIST of UNITs, RESIDUEs, or ATOMs, then the geometric center
of the ATOMs within the object will be used as the center of the solvent cap sphere. If position
is a LIST containing three NUMBERS, then the position argument will be treated as a vector
that defines the position of the solvent cap sphere center.
The optional closeness parameter can be used to control how close, in angstroms, solvent
ATOMs can come to solute ATOMs. The default value of the closeness argument is 1.0. Smaller
values allow solvent ATOMs to come closer to solute ATOMs. The criterion for rejection of

63
3 LEaP

overlapping solvent RESIDUEs is if the distance between any solvent ATOM to the closest
solute ATOM is less than the sum of the ATOMs VANDERWAAL’s distances multiplied by the
closeness argument.
This command modifies the solute UNIT in several ways. First, the UNIT is modified by the
addition of solvent RESIDUEs copied from the solvent UNIT. Secondly, the cap parameter of
the UNIT solute is modified to reflect the fact that a solvent cap has been created around the
solute.

> mol = loadpdb [Link]


> solvateCap mol WATBOX216 [Link] 12.0 0.75

3.4.41 solvateShell
solvateShell solute solvent thickness [ closeness ]

The solvateShell command adds a solvent shell to the solute UNIT. The resulting
solute/solvent UNIT will be irregular in shape since it will reflect the contours of the solute.
The solute UNIT is modified by the addition of solvent RESIDUEs. The solvent box will be
repeated in three directions to create a large solvent box that can contain the entire solute and a
shell thickness angstroms thick. The solvent RESIDUEs are then added to the solute UNIT if
they lie within the shell defined by thickness and do not overlap with the solute ATOMs. The
optional closeness parameter can be used to control how close solvent ATOMs can come to
solute ATOMs. The default value of the closeness argument is 1.0. Please see the solvateBox
command for more details on the closeness parameter.

> mol = loadpdb [Link]


> solvateShell mol WATBOX216 12.0 0.8

3.4.42 source
source filename

This command executes commands within a text file. To display the commands as they are
read, see the verbosity command.

3.4.43 transform
transform atoms, matrix

Transform all of the ATOMs within atoms by the ( 3 x 3 ) or ( 4 x 4 ) matrix represented by the
nine or sixteen NUMBERS in the LIST of LISTs matrix. The general matrix looks like:
r11 r12 r13 -tx r21 r22 r23 -ty r31 r32 r33 -tz 0 0 0 1
The matrix elements represent the intended symmetry operation. For example, a reflection
in the (x, y) plane would be produced by the matrix:

1 0 0 0 1 0 0 0 -1

64
3.4 Commands

This reflection could be combined with a six angstrom translation along the x-axis by using the
following matrix.
1 0 0 6 0 1 0 0 0 0 -1 0 0 0 0 1

In the following example, wrB is transformed by an inversion operation:


transform wrpB { { -1 0 0 } { 0 -1 0 } { 0 0 -1 } }

3.4.44 translate
translate atoms direction

Translate all of the ATOMs within atoms by the vector defined by the three NUMBERS in the
LIST direction.
Example:
translate wrpB { 0 0 -24.53333 }

3.4.45 verbosity
verbosity level

This command sets the level of output that LEaP provides the user. A value of 0 is the default,
providing the minimum of messages. A value of 1 will produce more output, and a value of 2
will produce all of the output of level 1 and display the text of the script lines executed with
the source command. The following line is an example of this command:
> verbosity 2 Verbosity level: 2

3.4.46 zMatrix
zMatrix object zmatrix

The zMatrix command is quite complicated. It is used to define the external coordinates of
ATOMs within object using internal coordinates. The second parameter of the zMatrix
command is a LIST of LISTs; each sub-list has several arguments:
{ a1 a2 bond12 }

This entry defines the coordinate of a1 by placing it bond12 angstroms along the x-axis from
ATOM a2. If ATOM a2 does not have coordinates defined then ATOM a2 is placed at the
origin.
{ a1 a2 a3 bond12 angle123 }

This entry defines the coordinate of a1 by placing it bond12 angstroms away from ATOM a2
making an angle of angle123 degrees between a1, a2 and a3. The angle is measured in a right
hand sense and in the x-y plane. ATOMs a2 and a3 must have coordinates defined.

65
3 LEaP

{ a1 a2 a3 a4 bond12 angle123 torsion1234 }

This entry defines the coordinate of a1 by placing it bond12 angstroms away from ATOM a2,
creating an angle of angle123 degrees between a1, a2, and a3, and making a torsion angle of
torsion1234 between a1, a2, a3, and a4.
{ a1 a2 a3 a4 bond12 angle123 angle124 orientation }

This entry defines the coordinate of a1 by placing it bond12 angstroms away from ATOM a2,
making angles angle123 between ATOMs a1, a2, and a3, and angle124 between ATOMs a1,
a2, and a4. The argument orientation defines whether the ATOM a1 is above or below a plane
defined by the ATOMs a2, a3, and a4. If orientation is positive then a1 will be placed in such
a way so that the inner product of (a3-a2) cross (a4-a2) with (a1-a2) is positive. Otherwise a1
will be placed on the other side of the plane. This allows the coordinates of a molecule like
fluoro-chloro-bromo-methane to be defined without having to resort to dummy atoms.
The first arguments within the zMatrix entries ( a1, a2, a3, a4 ) are either ATOMs or STRINGS
containing names of ATOMs within object. The subsequent arguments are all NUMBERS. Any
ATOM can be placed at the a1 position, even those that have coordinates defined. This feature
can be used to provide an endless supply of dummy atoms, if they are required. A predefined
dummy atom with the name "*" (a single asterisk, no quotes) can also be used.
There is no order imposed in the sub-lists. The user can place sub-lists in arbitrary order,
as long as they maintain the requirement that all atoms a2, a3, and a4 must have external co-
ordinates defined, except for entries that define the coordinate of an ATOM using only a bond
length. (See the add command for an example of the zMatrix command.)

3.5 Building oligosaccharides and lipids


Before continuing in this section, you should review the GLYCAM naming conventions cov-
ered in Section 2.8. After that, there are two important things to keep in mind. The first is
that GLYCAM is designed to build oligosaccharides, not just monosaccharides. In order to link
the monosaccharides together, each residue in GLYCAM will have at least one open valence
position. That is they are “lacking” either a hydroxyl group or a hydroxyl proton, and may be
lacking more than one proton depending on the number of branching locations. The result of
this is that none of the residues is a complete molecule unto itself. For example, if you wish to
build α-D-glucopyranose, you must explicitly specify the anomeric OH group (see Figure 3.1
for two examples).
The second thing to keep in mind is that when the “sequence” command is used in LEaP to
link monosaccharides together to form a linear oligosaccharide (analogous to peptide
generation) the residue ordering is opposite to the standard convention for writing the
sequence. For example, to build the disaccharides illustrated in Figure 3.1, using the sequence
command in LEaP, the format would be:
upperdisacc = sequence { ROH 3GB 0GB }
lowerdisacc = sequence { OME 4GB 0GA }

While the sequence command is the most direct method to build a linear glycan, it is not the
only method. Alternatives that facilitate building more complex glycans and glycoproteins are

66
3.5 Building oligosaccharides and lipids

HOH2C HOH2C HOH2C


HOH2C
O O O
HO HO O HO OH
HO
+ O + O H
HO
O
HO OH H
OH H OH H
OH H
0GB 3GB ROH

HOH2C HOH2C HOH2C


O O O
HO O HO
H + H
HO
OH
HO
OH H
+ O CH3
HO
OH
HOH2C
O
O OCH3
0GA 4GB OME HO
OH H

Figure 3.1: Schematic representation of disaccharide formation, indicating the need for open
valences on carbon and oxygen atoms at linkage positions.

presented below. For those who need to build structures (and generate topology and coordinate
files) that are more complex, a convenient interface that uses GLYCAM is available on the
internet ([Link] or [Link]
Throughout this section, sequences of LEaP commands will be entered in the following
format:

command argument(s) # descriptive comment

This format was chosen so that the lines can be copied directly into a file to be read into LEaP.
The number sign (#) signifies a comment. Comments following commands may be left in
place for future reference and will be ignored by LEaP. Files may be read into leap either by
sourcing the file or by specifying it on the command line at the time that leap is invoked, e.g.:

sleap -f leap_input_file

Note that it is, as of the time of this writing, necessary to build your topology files us-
ing sleap because of the required electrostatic and nonbonded interaction scaling. See
Section 2.8.4 for further discussion on the requirement. See "write14scale" in Section
3.6.4 for discussion of its implementation in sleap. Also, note that any GLYCAM param-
eter set shipped with AMBER is likely to be updated in the future. The current version is
GLYCAM_06g.dat. This file and GLYCAM_06.prep are automatically loaded with the default
leaprc.GLYCAM_06. The user is encouraged to check [Link] for updated versions
of these files.

3.5.1 Procedures for building oligosaccharides using the GLYCAM 06


parameters
[Link] Example: Linear oligosaccharides

This section contains instructions for building a simple, straight-chain tetrasaccharide:

α−D-Manp-(1-3)-β -D-Manp-(1-4)-β -D-GlcpNAc-(1-4)-β -D-GlcpNAc-OH

67
3 LEaP

First, it is necessary to determine the GLYCAM residues that will be used to build it. Since
the initial α-D-Manp residue links only at its anomeric site, the first character in its name is
0 (zero), indicating that it has no branches or other connections, i.e. it is terminal. Since it is
a D-mannose, the second character, the one-letter code, is M (capital). Since it is an alpha-
pyranose, the third character is A. Therefore, the first residue in the sequence above is 0MA.
Since the second residue links at its number three position as well as at the anomeric position,
the first character in its name is 3, and, being beta-pyranose, it is 3MB. Similarly, residues three
and four are both 4YB. It will also be necessary to add an OH residue at the end to generate
a complete molecule. Note that in Section 3.5.3, below, the terminal OH must be omitted in
order to allow subsequent linking to a protein or lipid. Note that when present, a terminal OH
(or OME etc) is assigned its own residue number.
Converting the order for use with the sequence command in LEaP, gives:

Residue name sequence: ROH 4YB 4YB 3MB 0MA


Residue number: 1 2 3 4 5

Here is a set of LEaP instructions that will build the sequence (there are, of course, other ways
to do this):

source leaprc.GLYCAM_06 # load leaprc


glycan = sequence { ROH 4YB 4YB 3MB 0MA } # build oligosaccharide

Using the sequence command, the phi angles are automatically set to the orientation that is
expected on the basis of the exo-anomeric effect (± 60°). If you wish to change the torsion
angle between two residues, the impose command may be used. In the following example, the
psi-angles between the two 4YB’s and between the 4YB and the 3MB are being set to the
standard value of zero.

impose glycan {3 2} { {C1 O4 C4 H4 0.0} } # set psi between 4YB & 4YB
impose glycan {4 3} { {C1 O4 C4 H4 0.0} } # set psi between 3MB & 4YB

You may now generate coordinate, topology and pdb files, for example:

saveamberparm glycan [Link] [Link] # save top & crd


savepdb glycan [Link] # save pdb file

[Link] Example: Branched oligosaccharides

This section contains instructions for building a simple branched oligosaccharide. The ex-
ample used here builds on the previous one. Again, it will be assumed that the carbohydrate is
not destined to be linked to a protein or a lipid. If it were, one should omit the ROH residue
from the structure. The branched oligosaccharide is

68
3.5 Building oligosaccharides and lipids

Note that the β -D-mannopyranose is now branched at the number three and six positions.
Consulting Tables 2.2 to 2.5 informs us that the first character assigned to a carbohydrate linked
at the three and six positions is V. So, the name of the residue called 3MB in the previous section
must change to VMB.
Thus, when rewritten for LEaP this glycan becomes:

Residue name sequence: ROH 4YB 4YB VMB 0MA 0MA


Residue number: 1 2 3 4 5 6

To ensure that the correct residues are linked at the three and six positions in VMB, it is safest
to specify these linkages explicitly in LEaP. In the current example, the two terminal residues
are the same (0MA), but that need not be the case.

source leaprc.GLYCAM_06 # load leaprc


glycan = sequence { ROH 4YB 4YB VMB } # linear sequence to branch

The longest linear sequence is built first, ending at the branch point “VMB” in order to
explicitly specify subsequent linkages. The following commands will place a terminal, 0MA
residue at the number three position:

set glycan tail glycan.4.O3 # set attachment point to the O3 in VMB


glycan = sequence { glycan 0MA } # add one of the 0MA’s

The following commands will link the other 0MA to the number six position. Note that the
name of the molecule changes from “glycan” to “branch”. This change is not necessary, but
makes such command sequences easier to read, particularly with complex structures.

set glycan tail glycan.4.O6 # set attachment point to the O6 in VMB


branch = sequence { glycan 0MA } # add the other 0MA

It can be especially important to reset torsion angles when building branched oligosaccharides.
The following set of commands cleans up the geometry considerably and then generates a set
of output files:

impose branch {4 6} { {H1 C1 O6 C6 -60.0} } # set phi torsion and


impose branch {4 6} { {C1 O6 C6 H6 0.0} } # set psi 0MA(6) & VMB
impose branch {4 3} { {H1 C1 O4 C4 60.0} } # set phi torsion and
impose branch {4 3} { {C1 O4 C4 H4 0.0} } # set psi 3MB & 4YB
impose branch {3 2} { {H1 C1 O4 C4 60.0} } # set phi torsion and
impose branch {3 2} { {C1 O4 C4 H4 0.0} } # set psi 4YB & 4YB
impose branch {5 4} { {H1 C1 O3 C3 -60.0} } # set phi torsion and
impose branch {5 4} { {C1 O3 C3 H3 0.0} } # set psi 0MA(3) & VMB
saveamberparm branch [Link] [Link] # save top & crd
savepdb branch [Link] # save pdb

69
3 LEaP

O2
O3 MYR
PGL C1 C3 C1 C3 C5 C7 C9 C11 C13
O2 P O4 C2 O1 C2 C4 C6 C8 C10 C12 C14

O1
O1
O2 C1 MY2
C5
C2 C4 C6 C8 C10 C12 C14
C3 C5 C7 C9 C11 C13
C4

N CHO

C1 C3
C2

Figure 3.2: DMPC

3.5.2 Procedures for building a lipid using GLYCAM 06 parameters


The procedure described here allows a user to produce a single lipid molecule without con-
sideration for axial alignment. Lipid bilayers are typically built in the x-y plane of a Cartesian
coordinate system which requires the individual lipids to be aligned hydrophilic ‘head’ to hy-
drophobic ‘tail’ along the z-axis. This can be done relatively easily by loading a template pdb
file that has been appropriately aligned on the z-axis.
The lipid described in this example is 1,2-dimyristoyl-sn-glycero-3-phosphocholine or DMPC.
For this example DMPC will be composed of four fragments: CHO, the choline ‘head’ group;
PGL, the phosph-glycerol ‘head’ group; MYR, the sn-1 chain myristic acid ‘tail’ group; and
MY2, the sn-2 chain myristic acid ‘tail’ group. See the molecular diagram in3.2 for atom la-
bels (hydrogens and atomic charges are removed for clarity) and bonding points between each
residue (dashed lines). This tutorial will use only prep files for each of the four fragments.
These prep files were initially built as pdb files and formatted as prep files using the antecham-
ber module. GLYCAM compatible charges were added to the prep files and a prep file database
(GLYCAM_06_lipids.prep) was created containing all four files.

[Link] Example: Building a lipid with LEaP.

One need not load the main GLYCAM prep files in order to build a lipid using the
GLYCAM 06 parameter set, but it is automatically loaded with the default
leaprc.GLYCAM_06. Note that the lipid generated by this set of commands is not necessarily
aligned appropriately to create a bilayer along an axis. The commands to use are:

source leaprc.GLYCAM_06 # source the leaprc for GLYCAM 06


loadamberprep GLYCAM_06_lipids.prep # load the lipid prep file
set CHO tail CHO.1.C5 # set the tail atom of CHO as C5.
set PGL head PGL.1.O1 # set the head atom of PGL to O1
set PGL tail PGL.1.C3 # set the tail atom of PGL to C3
lipid = sequence { CHO PGL MYR } # generate the straight-chain
# portion of the lipid
set lipid tail lipid.2.C2 # set the tail atom of PGL to C2

70
3.5 Building oligosaccharides and lipids

lipid = sequence { lipid MY2 } # add MY2 to the "lipid" unit


impose lipid {2 3} { {C1 C2 C3 O1 163} } # set torsions for
impose lipid {2 3} { {C2 C3 O1 C1 -180} } # PGL & MYR
impose lipid {2 3} { {C3 O1 C1 C2 180} }
impose lipid {2 4} { {O4 C1 C2 O1 -60} } # set torsions for
impose lipid {2 4} { {C1 C2 O1 C1 -180} } # PGL & MY2
impose lipid {2 4} { {C2 O1 C1 C2 180} }
# Note that the values here may not necessarily
# reflect the best choice of torsions.
savepdb lipid [Link] # save pdb file
saveamberparm lipid [Link] [Link] # save top and crd files

3.5.3 Procedures for building a glycoprotein in LEaP.


The leap commands given in this section assume that you already have a pdb file containing
a glycan and a protein in an appropriate relative configuration. Thorough knowledge of the
commands in LEaP is required in order to successfully link any but the simplest glycans to the
simplest proteins, and is beyond the scope of this discussion. Several options for generating the
relevant pdb file are given below (see Items 5a-5c).
The protein employed in this example is bovine ribonuclease A (PDBID: 3RN3). Here the
branched oligosaccharide assembled in the second example will be attached (N-linked) to ASN
34 to generate ribonuclease B.

[Link] Setting up protein pdb files for glycosylation in LEaP.

1. Delete any atoms with the “HETATM” card from the pdb file. These would typically
include bound ligands, non-crystallographic water molecules and non-coordinating metal
ions. Delete any hydrogen atoms if present.

2. In general, check the protein to make sure there are no duplicate atoms in the file. This
can be quickly done by loading the protein in LEaP and checking for such warnings. In
this particular example, residue 119 (HIS) contained duplicate side chain atoms. Delete
all but one set of duplicate atoms.

3. Check for the presence of disulphide bonds (SSBOND) by looking at the header section
of the pdb file. 3RN3 has four pairs of disulphide bonds between the following cysteine
residues: 26 – 84, 40 – 95, 58 – 110, and 65 – 72. Change the names of these cysteine
residues from CYS to CYX.

4. At present, it is possible to link glycans to serine, threonine, hydroxyproline and as-


paragine. You must rename the amino acid in the protein pdb file manually prior to
loading it into LEaP. The modified residue names are OLS (for O-linkages to SER), OLT
(for O-linkages to THR), OLP (for O-linkages to hydroxyproline, HYP) and NLN (for
N-linkages to ASN). Libraries containing amino acid residues that have been modified
for the purpose are automatically loaded when leaprc.GLYCAM_06 is sourced. See the
lists of library files in2.8 for more information.

71
3 LEaP

5. Prepare a pdb file containing the protein and the glycan, with the glycan correctly aligned
relative to the protein surface. There are several approaches to performing this including:
a) It is often the case that one or more glycan residues are present in the experimental pdb
file. In this case, a reasonable method is to superimpose the linking sugar residue
in the GLYCAM-generated glycan with that present in the experimental pdb file.
Then save the altered coordinates. If you use this method, remember to delete
the experimental glycan from the pdb file! It is also essential to ensure that each
carbohydrate residue is separated by a “TER” card in the pdb file. Also remember
to delete the terminal OH or OMe from the glycan. Alternately, the experimental
glycan may be retained in the pdb file provided that it is renamed according to the
GLYCAM 3-letter code, and that the atom names and order in the pdb file match
the GLYCAM standard. This is tedious, but will work. Again, be sure to insert TER
cards if they are missing between the protein and the carbohydrate and between the
carbohydrate residues themselves.
b) Use a molecular modeling package to align the GLYCAM-generated glycan with the
protein and save the coordinates in a single file. Remember to delete the terminal
OH or OMe from the glycan.
c) Use the Glycoprotein Builder tool at [Link] This tool allows the user
to upload protein coordinates, build a glycan (or select it from a library), and attach
it to the protein. All necessary AMBER files may then be downloaded. This site is
also convenient for preprocessing protein-only files for subsequent uploading to the
glycoprotein builder.

[Link] Example: Adding a branched glycan to 3RN3 (N-linked glycosylation).

In this example we will assume that the glycan generated above “[Link]” has been
aligned relative to the ASN 34 in the protein file and that the complex has been saved as a
new pdb file (for example as, 3rn3_nlink.pdb). The last amino acid residue should be VAL 124,
and the glycan should be present as 4YB 125, 4YB 126, VMB 127, OMA 128 and OMA 129.
Remember to change the name of ASN 34 from ASN to NLN. For the glycan structure,
ensure that each residue in the pdb file is separated by a “TER” card. The sequence command
is not to be used here, and all linkages (within the glycan and to the protein) will be specified
individually.
Enter the following commands into xleap (or tleap if a graphical representation is not
desired). Alternately, copy the commands into a file to be sourced.

source leaprc.GLYCAM_06 # load the GLYCAM 06 leaprc


source leaprc.ff99SB # load the (modified) ff99 force field
glyprot = loadpdb 3rn3_nlink.pdb # load protein and glycan pdb file
bond glyprot.125.O4 glyprot.126.C1 # make inter glycan bonds
bond glyprot.126.O4 glyprot.127.C1
bond glyprot.127.O6 glyprot.128.C1
bond glyprot.127.O3 glyprot.129.C1
bond [Link] glyprot.125.C1 # make glycan -- protein bond

72
3.6 Differences between tleap and sleap

bond [Link] [Link] # make disulphide bonds


bond [Link] [Link]
bond [Link] [Link]
bond [Link] [Link]
addions glyprot Cl- 0 # neutralize appropriately
solvateBox glyprot TIP3P BOX 8 # solvate the solute
savepdb glyprot 3nr3_glycan.pdb # save pdb file
saveamberparm glyprot 3nr3_glycan.top 3nr3_glycan.crd # save top, crd
quit # exit leap

3.6 Differences between tleap and sleap


The sleap program is a new text-based tool that is almost entirely compatible with tleap, and
at some point in the future we will retire tleap. Below, we discuss the differences between the
two codes. Please note that sleap is a new code, and has not been tested nearly as much as
tleap has. We encourage people to use it – that’s the only way it will get better! – but be on the
lookout for places where it might not do what it should. The “gleap” and “mort” foundations,
on which sleap is built, will be the basis for a lot of new functionality in the future.

3.6.1 Limitations
For now, sleap has the following limitations:

SaveAmberParm won’t give the identical topology file as tleap does, while the energy should
be identical.

SolvateDontClip has not been implemented.

addions won’t give the identical result as of tleap does due to the different set of vdw radii
they are using.

3.6.2 Unsupported Commands


The following commands are not going to be implemented, since it is not clear to me why do
they even exist.

addAtomTypes: It seems to me the only usage of it is designating the hybrid type of an atom,
which is determined by chemical environment in sleap.

logFile: All the information are dumped to standard output now.

3.6.3 New Commands or New Features of old Commands


The following new commands have been introduced into sleap:

loadsdf allows users to read mdl’s sdf format file. The syntax is

73
3 LEaP

unitname = loadsdf filename

savesdf allows users to save mdl sdf format files. The syntax is

savesdf unitname filename

loadmol2 can now load molecules that have more than one residue.

savemol2 allows users to save tripos mol2 format files. The syntax is

savemol2 unitname filename

fixbond assigns bond orders automatically. Note that the input molecule should have only one
residue. There is a test case showing how to use fixbond in amber11/test/sleap/fastbld.
The syntax is

fixbond unitname

addhydr adds hydrogens to a molecule. The molecule should have only one residue and have
correct bond order assigned. There is a test case showing how to use addhydr in am-
ber11/test/sleap/fastbld. The syntax is

addhydr unitname

setpchg calls antechamber to set partial charges (AM1-BCC) and gaff atom types for a molecule.
The molecule should have only one residue. There is a test case showing how to use set-
pchg in amber11/test/sleap/fastbld. The syntax is

setpchg unitname

saveamoebaparm save a topology file for the AMOEBA force field. The syntax is

saveamoebaparm unitname [Link] [Link]

There is a test case showing how to use saveamoebaparm in amber11/test/sleap/amoeba. The


only difference is that the user should load [Link] at startup which loads the AMOEBA
force field parameters and AMOEBA specialized libraries.
parmchk calls parmchk on a molecule to get missing force field parameters and add them to
the database. The syntax is

parmchk unitname

3.6.4 New keywords


The following new keywords have been introduced into sleap:
echo: if set to "on", the input command will be echoed. This is very useful for the construction
of test cases.

74
3.6 Differences between tleap and sleap

disulfide is used to control the behavior of loadpdb on disulfide bonds. if disulfide is set to
"off", loadpdb will not create disulfide bonds unless they are specified in the CONECT
records; if disulfide is set to "auto", loadpdb will create disulfide bonds between two
sulfur atoms whose distance is less then the value specified by keyword "disulfcut" (by
default the cutoff is 2.2 angstrom); if disulfide is set to "manu", loadpdb will ask the
user if they want to create a disulfide bond when such a pair of sulfur atoms is found; by
default it is set to off.
disulfcut is used as the cutoff of disulfide bonds.

fastbld is used to control the behavior of loadpdb for unknown residues. if fastbld is set to "on"
and an unknown residue is encountered in the pdb file, loadpdb will try to run fixbond,
addhydr, setpchg and parmchk on the unknown residue and put all the the necessary
information together into the molecule. The resulting molecule will then be ready for
SaveAmberParm.
write14scale instructs sleap to output SCEE and SCNB sections to any topology files it gener-
ates when set to "on" (default: "off"). For this directive to change values from the default,
the parameter file must contain the new values. New values are specified in the comment
field of each relevant line in the torsions section using keyword/value pairs SCEE=value1
and SCNB=value2 . These values must be present for each line of multi-term torsions.
The exact position within the comment field is irrelevant, but there cannot be any whites-
pace before or after the equals sign (=). The information written into the topology file
overrides both internal defaults for SCEE and SCNB as well as any specification made
in the simulation input file. The following are sample parameter-file torsion entries that
specify SCEE and SCNB. In this example, whitespace has been compressed for format-
ting purposes.

O2-S -N -H 1 -0.10 0.0 6. N-Sulfates SCEE=1.0 SCNB=1.0


O2-S -N -CG 1 0.11 0.0 -3. SCEE=1.0 SCNB=1.0 N-Sulfates
1 0.0 0.0 -2. SCEE=1.0 and SCNB=1.0
1 0.0 0.0 1. SCEE=1.0 & SCNB=1.0

3.6.5 The basic idea behind the new commands


As has been mentioned before, quite a few new commands have been introduced into sleap.
The ultimate goal of these new commands is that users will be able to generate topology files
right from pdb files without calling any other programs such as antechamber. The easiest way
to prepare a topology from a pdb file is to use the new keyword fastbld. Ideally the script
would look like the following:
source leaprc.ff03.r1
source [Link]
set default fastbld on
xxx = loadpdb [Link]
saveamberparm xxx [Link] [Link]
quit

75
3 LEaP

However, real world cases can not always be that simple. There are several issues which could
interrupt the procedure. First, the fixbond command could fail on distorted structures. Fixbond
uses the geometrical evidence to determine the bond orders, and won’t work for distorted struc-
tures. Second, the addhydr command might not give the proper answer since it does not con-
sider protonation states. Third, the setpchg command only assigns AM1-BCC charges to the
residue. Sometimes users might want to use resp charges.
In all, experienced users might want to customize the procedure. They might use some of
the new commands but not all of them. That is the reason the separate commands are provided.
A template is the following:
source leaprc.ff03.r1
source [Link]
res = loadpdb [Link]
fixbond res
addhydr res
setpchg res
parmchk res
all = loadpdb [Link]
savemaberparm all [Link] [Link]
quit

Users may make changes to this script. For instance, one can assign the bond orders manually,
save the result in sdf format (or mol2 format), then reload in sleap and do the rest, or one could
even add hydrogens manually. In all, it is a highly customizable procedure.

76
4 Antechamber

This is a set of tools to generate files for organic molecules, which can then be read into LEaP.
The Antechamber suite was written by Junmei Wang, and is designed to be used in conjunction
with the "general AMBER force field (GAFF)" ([Link]).[69] See Ref. [70] for an explanation
of the algorithms used to classify atom and bond types, to assign charges, and to estimate force
field parameters that may be missing in [Link].
Like the traditional AMBER force fields, GAFF uses a simple harmonic function form for
bonds and angles. Unlike the traditional AMBER force fields, atom types in GAFF are more
general and cover most of the organic chemical space. In total there are 33 basic atom types and
22 special atom types. The charge methods used in GAFF can be HF/6-31G* RESP or AM1-
BCC.[71, 72] All of the force field parameterizations were carried out with HF/6-31G* RESP
charges. However, in most cases, AM1-BCC, which was parameterized to reproduce HF/6-
31G* RESP charges, is recommended in large-scale calculations because of its efficiency.
The van der Waals parameters are the same as those used by the traditional AMBER force
fields. The equilibrium bond lengths and bond angles came from statistics derived from the
Cambridge Structural Database, and ab initio calculations at the MP2/6-31G* level. The force
constants for bonds and angles were estimated using empirical models, and the parameters in
these models were trained using the force field parameters in the traditional AMBER force
fields. General torsional angle parameters were extensively applied in order to reduce the huge
number of torsional angle parameters to be derived. The force constants and phase angles in the
torsional angle parameters were optimized using our PARMSCAN package,[73] with an aim
to reproduce the rotational profiles depicted by high-level ab initio calculations [geometry opti-
mizations at the MP2/6-31G* level, followed by single point calculations at MP4/6-311G(d,p)].
By design, GAFF is a complete force field (so that missing parameters rarely occur), it covers
almost all the organic chemical space that is made up of C, N, O, S, P, H, F, Cl, Br and I.
Moreover, GAFF is totally compatible to the AMBER macromolecular force fields. It should
be noted that GAFF atom types are in lowercase except metals, while AMBER atom types are
always in upper case. This feature makes it possible to load both AMBER protein/nucleic acid
force fields and GAFF without any conflict. One even can merge the two kinds of force fields
into one file. The combined force fields are capable to study complicated systems that include
both proteins/nucleic acids and organic molecules. We believe that the combination of GAFF
with AMBER macromolecular force fields will provide an useful molecular mechanical tool
for rational drug design, especially in binding free energy calculations and molecular docking
studies. Since its introduction, GAFF has been used for a wide range of applications, including
ligand docking,[74] bilayer simulations,[75, 76] and ....

77
4 Antechamber

4.1 Principal programs


The antechamber program itself is the main program of Antechamber: if your molecule falls
in fairly broad categories, this should be all you need to convert an input pdb file into files
ready for LEaP. Otherwise you may use molecular formats that having bond information, such
as mol2, sdf to run antechamber programs. If there are missing parameters after antechamber
is finished, you may want to run parmchk to generate a frcmod template that will assist you in
generating the needed parameters.

4.1.1 antechamber
This is the most important program in the package. It can perform many file conversions, and
can also assign atomic charges and atom types. As required by the input, antechamber executes
the following programs: mopac (or optionally, divcon), atomtype, am1bcc, bondtype, espgen,
respgen and prepgen. It may also generate a lot of intermediate files (all in capital letters). If
there is a problem with antechamber, you may want to run the individual programs that are
described below.

Antechamber options:

-help print these instructions


-i input file name
-fi input file format
-o output file name
-fo output file format
-c charge method
-cf charge file name
-nc net molecular charge (int)
-a additional file name
-fa additional file format
-ao additional file operation
crd : only read in coordinate
crg: only read in charge
name : only read in atom name
type : only read in atom type
bond : only read in bond type
-m multiplicity (2S+1), default is 1
-rn residue name, if not available in the input file, default is MOL
-rf residue topology file name in prep input file, default is [Link]
-ch check file name in gaussian input file, default is molecule
-ek empirical calculation (mopac or sqm) keyword (in quotes)
-gk gaussian keyword in a pair of quotation marks
-gm gaussian assign memory, inside a pair of quotes, such as"%mem=1000MB"
-gn gaussian assign number of processor, inside a pair of quotes, such as "%nproc=8"
-df use divcon flag, 0 - use mopac; 2 - use sqm (the default)

78
4.1 Principal programs

-at atom type, can be gaff, amber, bcc and sybyl, default is gaff
-du check atom name duplications, can be yes(y) or no(n), default is yes
-j atom type and bond type prediction index, default is 4
0 : no assignment
1 : atom type
2 : full bond types
3 : part bond types
4 : atom and full bond type
5 : atom and part bond type
-s status information, can be 0 (brief), 1 (the default) and 2 (verbose)
-pf remove the intermediate files: can be yes (y) and no (n), default is no
-i -o -fi and -fo must appear in command lines and the others are optional

List of the File Formats:

file format type abbre. index | file format type abbre. index
---------------------------------------------------------------
Antechamber ac 1 | Sybyl Mol2 mol2 2
PDB pdb 3 | Modified PDB mpdb 4
AMBER PREP (int) prepi 5 | AMBER PREP (car) prepc 6
Gaussian Z-Matrix gzmat 7 | Gaussian Cartesian gcrt 8
Mopac Internal mopint 9 | Mopac Cartesian mopcrt 10
Gaussian Output gout 11 | Mopac Output mopout 12
Alchemy alc 13 | CSD csd 14
MDL mdl 15 | Hyper hin 16
AMBER Restart rst 17 | Jaguar Cartesian jcrt 18
Jaguar Z-Matrix jzmat 19 | Jaguar Output jout 20
Divcon Input divcrt 21 | Divcon Output divout 22
Charmm charmm 23
--------------------------------------------------------------

AMBER restart file can only be read in as additional file

List of the Charge Methods:

charge method abbre. index | charge method abbre.


----------------------------------------------------------------
RESP resp 1 | AM1-BCC bcc 2
CM1 cm1 3 | CM2 cm2 4
ESP (Kollman) esp 5 | Mulliken mul 6
Gasteiger gas 7 | Read in charge rc 8
Write out charge wc 9 | Delete Charge dc 10
----------------------------------------------------------------

79
4 Antechamber

Examples:

antechamber -i [Link] -fi gout -o sustiva_resp.mol2 -fo mol2 -c resp


antechamber -i [Link] -fi gout -o sustiva_bcc.mol2 -fo mol2 -c bcc -j 5
antechamber -i [Link] -fi gout -o sustiva_gas.mol2 -fo mol2 -c gas
antechamber -i [Link] -fi gout -o sustiva_cm2.mol2 -fo mol2 -c cm2
antechamber -i [Link] -fi gout -o [Link] -fo ac
antechamber -i [Link] -fi ac -o [Link] -fo mpdb
antechamber -i [Link] -fi ac -o sustiva.mol2 -fo mol2
antechamber -i sustiva.mol2 -fi mol2 -o [Link] -fo gzmat
antechamber -i [Link] -fi ac -o sustiva_gas.ac -fo ac -c gas
antechamber -i [Link] -fi pdb -o mtx.mol2 -fo mol2 -c rc -cf [Link]

The -rn line specifies the residue name to be used; thus, it must be one to three characters
long. The -at flag is used to specify whether atom types are to be created for the general AM-
BER force field (gaff) or for atom types consistent with [Link] and [Link] (amber).
If you are using antechamber to create a modified residue for use with the standard AMBER
parm94/parm99 force fields, you should set this flag to amber; if you are looking at a more arbi-
trary molecule, set this to gaff, even if you plan to use this as a ligand bound to a macromolecule
described by the AMBER force fields.

4.1.2 parmchk
Parmchk reads in an ac file as well as a force field file (the default is [Link] in
$AMBERHOME/dat/leap/parm). It writes out a force field modification (frcmod) file for the
missing or all force field parameters. Problematic parameters are indicated with "ATTN, need
revision". Such parameters are typically zero. This can cause fatal terminations of programs
that later use a resulting prmtop file; for example, a zero value for the periodicity of the
torsional barrier of a dihedral parameter. For each atom type, an atom type corresponding file
([Link]) lists its replaceable general atom types. By the default, only the missing
parameters are written to the frcmod file. When the ’-a Y’ flag is used, parmchk prints out all
force field parameters used by the input molecule, no matter whether they are already in the
parm file or not. This file can be used to prepare the frcmod file used by thermodynamic
integration calculations using sander.

parmchk -i input file name


-o frcmod file name
-f input file format (prepi, ac ,mol2)
-p ff parmfile
-c atom type corresponding file, default is [Link]
-a print out all force field parameters including those in the parmfile
can be ’Y’ (yes) or ’N’ (no), default is ’N’
-w print out parameters that matching improper dihedral parameters
that contain ’X’ in the force field parameter file, can be ’Y’ (yes)
or ’N’ (no), default is ’Y’

80
4.2 A simple example for antechamber

Example:
parmchk -i [Link] -f prepi -o frcmod

This command reads in [Link] and finds the missing force field parameters listed in frc-
mod.

4.2 A simple example for antechamber


The most common use of the antechamber program suite is to prepare input files for LEaP,
starting from a three-dimensional structure, as found in a pdb file. The antechamber suite
automates the process of developing a charge model and assigning atom types, and partially
automates the process of developing parameters for the various combinations of atom types
found in the molecule.
As with any automated procedure, caution should be taken to examine the output. Consider-
ing the complicate nature of the problem, users should certainly be on the lookout for unusual
or incorrect behavior of the suite program of Antechamber.
Suppose you have a PDB-format file for your ligand, say thiophenol, which looks like this:

ATOM 1 CG TP 1 -1.959 0.102 0.795


ATOM 2 CD1 TP 1 -1.249 0.602 -0.303
ATOM 3 CD2 TP 1 -2.071 0.865 1.963
ATOM 4 CE1 TP 1 -0.646 1.863 -0.234
ATOM 5 C6 TP 1 -1.472 2.129 2.031
ATOM 6 CZ TP 1 -0.759 2.627 0.934
ATOM 7 HE2 TP 1 -1.558 2.719 2.931
ATOM 8 S15 TP 1 -2.782 0.365 3.060
ATOM 9 H19 TP 1 -3.541 0.979 3.274
ATOM 10 H29 TP 1 -0.787 -0.043 -0.938
ATOM 11 H30 TP 1 0.373 2.045 -0.784
ATOM 12 H31 TP 1 -0.092 3.578 0.781
ATOM 13 H32 TP 1 -2.379 -0.916 0.901

(This file may be found at $AMBERHOME/test/antechamber/tp/[Link]). The basic command


to create a mol2 file for LEaP is just:
antechamber -i [Link] -fi pdb -o tp.mol2 -fo mol2 -c bcc

The output file will look like this:


@<TRIPOS>MOLECULE
TP
13 13 1 0 0
SMALL
bcc
@<TRIPOS>ATOM

81
4 Antechamber

1 CG -1.9590 0.1020 0.7950 ca 1 TP -0.118600


2 CD1 -1.2490 0.6020 -0.3030 ca 1 TP -0.113500
3 CD2 -2.0710 0.8650 1.9630 ca 1 TP 0.016500
4 CE1 -0.6460 1.8630 -0.2340 ca 1 TP -0.137200
5 C6 -1.4720 2.1290 2.0310 ca 1 TP -0.145300
6 CZ -0.7590 2.6270 0.9340 ca 1 TP -0.112400
7 HE2 -1.5580 2.7190 2.9310 ha 1 TP 0.129800
8 S15 -2.7820 0.3650 3.0600 sh 1 TP -0.254700
9 H19 -3.5410 0.9790 3.2740 hs 1 TP 0.191000
10 H29 -0.7870 -0.0430 -0.9380 ha 1 TP 0.134700
11 H30 0.3730 2.0450 -0.7840 ha 1 TP 0.133500
12 H31 -0.0920 3.5780 0.7810 ha 1 TP 0.133100
13 H32 -2.3790 -0.9160 0.9010 ha 1 TP 0.143100
@<TRIPOS>BOND
1 1 2 ar
2 1 3 ar
3 1 13 1
4 2 4 ar
5 2 10 1
6 3 5 ar
7 3 8 1
8 4 6 ar
9 4 11 1
10 5 6 ar
11 5 7 1
12 6 12 1
13 8 9 1
@<TRIPOS>SUBSTRUCTURE
1 TP 1 TEMP 0 **** **** 0 ROOT

This command says that the input format is pdb, output format is Sybyl mol2, and the BCC
charge model is to be used. The output file is shown in the box titled .mol2. The format of this
file is a common one understood by many programs. However, to display molecules properly
in software packages other than LEaP and gleap, one needs to assign atom types using the ’-at
sybyl’ flag rather than using the default gaff atom types.
You can now run parmchk to see if all of the needed force field parameters are available:
parmchk -i tp.mol2 -f mol2 -o frcmod

This yields the frcmod file:


remark goes here
MASS
BOND
ANGLE
DIHE
IMPROPER

82
4.2 A simple example for antechamber

ca-ca-ca-ha 1.1 180.0 2.0 General improper \\


torsional angle (2 general atom types)
ca-ca-ca-sh 1.1 180.0 2.0 Using default value
NONBON

In this case, there were two missing dihedral parameters from the [Link] file, which were
assigned a default value. (As [Link] continues to be developed, there should be fewer and
fewer missing parameters to be estimated by parmchk.) In rare cases, parmchk may be unable
to make a good estimate; it will then insert a placeholder (with zeros everywhere) into the
frcmod file, with the comment "ATTN: needs revision". After manually editing this to take
care of the elements that "need revision", you are ready to read this residue into LEaP, either as
a residue on its own, or as part of a larger system. The following LEaP input file ([Link]) will
just create a system with thiophenol in it:
source [Link]
mods = loadAmberParams frcmod
TP = loadMol2 tp.mol2
saveAmberParm TP prmtop inpcrd
quit

You can read this into LEaP as follows:


tleap -s -f [Link]

This will yield a prmtop and inpcrd file. If you want to use this residue in the context of a larger
system, you can insert commands after the loadAmberPrep step to construct the system you
want, using standard LEaP commands.
In this respect, it is worth noting that the atom types in [Link] are all lower-case, whereas
the atom types in the standard AMBER force fields are all upper-case. This means that you
can load both [Link] and (say) [Link] into LEaP at the same time, and there won’t be
any conflicts. Hence, it is generally expected that you will use one of the AMBER force fields
to describe your protein or nucleic acid, and the [Link] parameters to describe your ligand;
as mentioned above, [Link] has been designed with this in mind, i.e. to produce molecular
mechanics descriptions that are generally compatible with the AMBER macromolecular force
fields.
The procedure above only works as it stands for neutral molecules. If your molecule is
charged, you need to set the -nc flag in the initial antechamber run. Also note that this procedure
depends heavily upon the initial 3D structure: it must have all hydrogens present, and the
charges computed are those for the conformation you provide, after minimization in the AM1
Hamiltonian. In fact, this means that you must have an reasonable all-atom initial model of
your molecule (so that it can be minimized with the AM1 Hamiltonian), and you may need to
specify what its net charge is, especially for those molecular formats that have no net charge
information, and no partial charges or the partial charges in the input are not correct. The
system should really be a closed-shell molecule, since all of the atom-typing rules assume this
implicitly.
Further examples of using antechamber to create force field parameters can be found in the
$AMBERHOME/test/antechamber directory. Here are some practical tips from Junmei Wang:

83
4 Antechamber

1. For the input molecules, make sure there are no open valences and the structures are
reasonable.

2. The Antechamber package produces two kinds of messages, error messages and informa-
tive messages. You may safely ignore those message starting with "Info". For example:
"Info: Bond types are assigned for valence state 1 with penalty of 1".

3. Failures are most often produced when antechamber infers an incorrect connectivity. In
such cases, you can revise by hand the connectivity information in "ac" or "mol2" files.
Systematic errors could be corrected by revising the parameters in $AMBERHOME/-
dat/antechamber/[Link].

4. It is a good idea to check the intermediate files in case of a program failure, and you can
run separate programs one by one. Use the "-s 2" flag to antechamber to see details of
what it is doing.

5. Beginning with Amber 10, a new program called acdoctor is provided to diagnose pos-
sible problem of an input molecule. If you encounter failure when running antechamber
programs, it is highly recommended to let acdoctor perform a diagnosis.

6. By default, the AM1 Mulliken charges that are required for the AM1-BCC procedure are
computed using the sqm program, with the following keyword (which is placed inside the
&qmmm namelist):

qm_theory=’AM1’, grms_tol=0.0002, tight_p_conv=1, scfconv=1.d-10,

For some molecules, especially if they have bad starting geometries, convergence to these
tight criteria may not be obtained. If you have trouble, examine the [Link] file, and try
changing scfconv to 1.d-8 and/or tight_p_conv to 0. You may also need to increase the
value of grms_tol. You can use the -ek flag to antechamber to change these, or just
manually edit the [Link] file. But be aware that there may be something “wrong” with
your molecule if these problems arise; the acdoctor program may help.

4.3 Programs called by antechamber


The following programs are automatically called by antechamber when needed. Generally,
you should not need to run them yourself, unless problems arise and/or you want to fine-tune
what antechamber does.

4.3.1 atomtype
Atomtype reads in an ac file and assigns the atom types. You may find the default definition
files in $AMBERHOME/dat/antechamber: ATOMTYPE_AMBER.DEF (AMBER),
ATOMTYPE_GFF.DEF (general AMBER force field). ATOMTYPE_GFF.DEF is the default
definition file. It is pointed out that the usage of atomtype is not limited to assign force field
atom types, it can also be used to assign atom types in other applications, such as QSAR and

84
4.3 Programs called by antechamber

QSPR studies. The users can define their own atom type definition files according to certain
rules described in the above mentioned files.

atomtype -i input file name


-o output file name (ac)
-f input file format(ac (the default) or mol2)
-p amber or gaff or bcc or gas, it is suppressed by "-d" option
-d atom type definition file, optional

Example:

atomtype -i sustiva_resp.ac -o sustiva_resp_at.ac -f ac -p amber

This command assigns atom types for sustiva_resp.ac with amber atom type definitions. The
output file name is sustiva_resp_at.ac

4.3.2 am1bcc
Am1bcc first reads in an ac or mol2 file with or without assigned AM1-BCC atom types and
bond types. Then the bcc parameter file (the default, [Link] is in
$AMBERHOME/dat/antechamber) is read in. An ac file with AM1-BCC charges [71, 72] is
written out. Be sure the charges in the input ac file are AM1-Mulliken charges.

am1bcc -i input file name in ac format


-o output file name
-f output file format(pdb or ac, optional, default is ac)
-p bcc parm file name (optional))
-j atom and bond type judge option, default is 0)
0: No judgement
1: Atom type
2: Full bond type
3: Partial bond type
4: Atom and full bond type
5: Atom and partial bond type

Example:

am1bcc -i [Link] -o comp1_bcc.ac -f ac -j 4

This command reads in [Link], assigns both atom types and bond types and finally performs
bond charge correction to get AM1-BCC charges. The ’-j’ option of 4, which is the default,
means that both the atom and bond type information in the input file is ignored and a full atom
and bond type assignments are performed. The ’-j’ option of 3 and 5 implies that bond type
information (single bond, double bond, triple bond and aromatic bond) is read in and only a
bond type adjustment is performed. If the input file is in mol2 format that contains the basic
bond type information, option of 5 is highly recommended. comp1_bcc.ac is an ac file with the
final AM1-BCC charges.

85
4 Antechamber

4.3.3 bondtype
bondtype is a program to assign six bond types based upon the read in simple bond types
from an ac or mol2 format with a flag of “-j part” or purely connectivity table using a flag of
“-j full”. The six bond types as defined in AM1-BCC [71, 72] are single bond, double bond,
triple bond, aromatic single, aromatic double bonds and delocalized bond. This program takes
an ac file or mol2 file as input and write out an ac file with the predicted bond types. After the
continually improved algorithm and code, the current version of bondtype can correctly assign
bond types for most organic molecules (>99% overall and >95% for charged molecules) in our
tests.
Starting with Amber 10, bond type assignment is proceeded based upon residues. The
bonds that link two residues are assumed to be single bonded. This feature allows antechamber
to handle residue-based molecules, even proteins are possible. It also provides a remedy for
some molecules that would otherwise fail: it can be helpful to dissect the whole molecule into
residues. Some molecules have more than one way to assign bond types; for example, there
are two ways to alternate single and double bonds for benzene. The assignment adopted by
bondtype is purely affected by the atom sequence order. To get assignments for other resonant
structures, one may freeze some bond types in an ac or mol2 input file (appending ’F’ or ’f’ to
the corresponding bond types). Those frozen bond types are ignored in the bond type
assignment procedure. If the input molecules contain some unusual elements, such as metals,
the involved bonds are automatically frozen. This frozen bond feature enables bondtype to
handle unusual molecules in a practical way without simply producing an error message.
bondtype -i input file name
-o output file name
-f input file format (ac or mol2)
-j judge bond type level option, default is part
full full judgment
part partial judgment, only do reassignment according
to known bond type information in the input file
Example:
#! /bin/csh -fv
set mols = \‘/bin/ls *.ac\‘
foreach mol ($mols)
set mol_dir = $mol:r
antechamber -i $mol_dir.ac -fi ac -fo ac -o $mol_dir.ac -c mul
bondtype -i $mol_dir.ac -f ac -o $mol_dir.dat -j full
am1bcc -i $mol_dir.dat -o $mol_dir\_bcc.ac -f ac -j 0
end
exit(0)
The above script finds all the files with the extension of "ac", calculates the Mulliken charges
using antechamber, and predicts the atom and bond types with bondtype. Finally, AM1-BCC
charges are generated by running am1bcc to do the bond charge correction. More examples are
provided in $AMBERHOME/test/antechamber/bondtype and $AMBERHOME/test/antecham-
ber/chemokine.

86
4.3 Programs called by antechamber

4.3.4 prepgen
Prepgen generates the prep input file from an ac file. By default, the program generates a
mainchain itself. However, you may also specify the main-chain atoms in the main chain file.
From this file, you can also specify which atoms will be deleted, and whether to do charge
correction or not. In order to generate the amino-acid-like residue (this kind of residue has one
head atom and one tail atom to be connected to other residues), you need a main chain file.
Sample main chain files are in $AMBERHOME/dat/antechamber.

Usage: prepgen -i input file name(ac)


-o output file name
-f output file format (car or int, default: int)
-m mainchain file name
-rn residue name (default: MOL)
-rf residue file name (default: [Link])
-f -m -rn -rf are optional

Examples:

prepgen -i [Link] -o sustiva_int.prep -f int -rn SUS -rf [Link]


prepgen -i [Link] -o sustiva_car.prep -f car -rn SUS -rf [Link]
prepgen -i [Link] -o sustiva_int_main.prep -f int -rn SUS
-rf [Link] -m mainchain_sus.dat
prepgen -i ala_cm2_at.ac -o ala_cm2_int_main.prep -f int -rn ALA
-rf [Link] -m mainchain_ala.dat

The above commands generate different kinds of prep input files with and without specifying a
main chain file.

4.3.5 espgen
Espgen reads in a gaussian (92,94,98,03) output file and extracts the ESP information. An
esp file for the resp program is generated.

Usage: espgen -i input file name


-o output file name

Example:

espgen -i sustiva_g98.out -o [Link]

The above command reads in sustiva_g98.out and writes out [Link], which can be used by
the resp program. Note that this program replaces shell scripts formerly found on the AMBER
web site that perform equivalent tasks.

87
4 Antechamber

4.3.6 respgen
Respgen generates the input files for two-stage resp fitting. Starting with Amber 10, the
program supports a single molecule with one or multiple conformations RESP fittings. Atom
equivalence is recognized automatically. Frozen charges and charge groups are read in with
’-a’ flag. If there are some frozen charges in the additional input data file, a RESP charge file,
QIN is generated as well.
Usage: respgen -i input file name(ac)
-o output file name
-f output file format (resp1 or resp2)
resp1 - first stage resp fitting
resp2 - second stage resp fitting
-a additional input data (predefined charges, atom groups etc)
-n number of conformations (default is 1)

The following is a sample of additional respgen input file

//predefined charges in a format of (CHARGE partial_charge atom_ID atom_name)


CHARGE -0.417500 7 N1
CHARGE 0.271900 8 H4
CHARGE 0.597300 15 C5
CHARGE -0.567900 16 O2
//charge groups in a format of (GROUP num_atom net_charge),
//more than one group may be defined.
GROUP 10 0.00000
//atoms in the group in a format of (ATOM atom_ID atom_name)
ATOM 7 N1
ATOM 8 H4
ATOM 9 C3
ATOM 10 H5
ATOM 11 C4
ATOM 12 H6
ATOM 13 H7
ATOM 14 H8
ATOM 15 C5
ATOM 16 O2

Example:
respgen -i [Link] -o sustiva.respin1 -f resp1
respgen -i [Link] -o sustiva.respin2 -f resp2
resp -O -i sustiva.respin1 -o sustiva.respout1 -e [Link] -t qout_stage1
resp -O -i sustiva.respin2 -o sustiva.respout2 -e [Link]
-q qout_stage1 -t qout_stage2
antechamber -i [Link] -fi ac -o sustiva_resp.ac -fo ac -c rc
-cf qout_stage2

88
4.4 Miscellaneous programs

The above commands first generate the input files (sustiva.respin1 and sustiva.respin2) for resp
fitting, then do two-stage resp fitting and finally use antechamber to read in the resp charges
and write out an ac file, sustiva_resp.ac. A more complicated example has been provided in
$AMBERHOME/test/antechamber/residuegen.

4.4 Miscellaneous programs


The Antechamber suite also contains some utility programs that perform various tasks in
molecular mechanical calculations. They are listed in alphabetical order.

4.4.1 acdoctor
Acdoctor reads in all kinds of file formats applied in the antechamber program and
’diagnose’ possible reasons that cause antechamber failure. Molecular format is first checked
for some commonly-used molecular formats, such as pdb, mol2, mdl (sdf), etc. Then unusual
elements (elements other than C, O, N, S, P, H, F, Cl, Br and I) are checked for all the formats.
Unfilled valence is checked when atom types and/or bond types are read in. Those file formats
include ac, mol2, sdf, prepi, prepc, mdl, alc and hin. Acdoctor also applies a more stringent
criterion than that utilized by antechamber to determine whether a bond is formed or not. A
warning message is printed out for those bonds that fail to meet the standard. Then acdoctor
diagnoses if all atoms are linked together through atomic paths. If not, an error message is
printed out. This kind of errors typically imply that the input molecule has one or several bonds
missing. Finally, acdoctor tries to assign bond types and atom types for the input molecule. If
no error occurs during running bondtype and atomtype, presumably the input molecule should
be free from problems when running the other Antechamber programs. It is recommended to
diagnose your molecules with acdoctor when you encounter Antechamber failures.

Usage: acdoctor -i input file name


-f input file format

List of the File Formats

file format type abbre. index | file format type abbre. index
---------------------------------------------------------------
Antechamber ac 1 | Sybyl Mol2 mol2 2
PDB pdb 3 | Modified PDB mpdb 4
AMBER PREP (int) prepi 5 | AMBER PREP (car) prepc 6
Gaussian Z-Matrix gzmat 7 | Gaussian Cartesian gcrt 8
Mopac Internal mopint 9 | Mopac Cartesian mopcrt 10
Gaussian Output gout 11 | Mopac Output mopout 12
Alchemy alc 13 | CSD csd 14
MDL mdl 15 | Hyper hin 16
AMBER Restart rst 17 | Jaguar Cartesian jcrt 18
Jaguar Z-Matrix jzmat 19 | Jaguar Output jout 20
Divcon Input divcrt 21 | Divcon Output divout 22

89
4 Antechamber

Charmm charmm 23
--------------------------------------------------------------

Example:
acdoctor -i test.mol2 -f mol2

The program reads in test.mol2 and checks the potential problem when running the Antecham-
ber programs. Errors and warning message are printed out.

4.4.2 database
Database reads in a multiple sdf or mol2 file and a definition file to run a set of commands
for each record sequentially. The commands are defined in the definition file. It is noted that
the database program can handle other well-organized file formats exemplified by the
all_amino94.in file in dat/leap/parm as well. The definition file also describes how to dissect
records and how to name them, as well as rules of selecting a subset of the database. A more
detailed sample input file is in $AMBERHOME/test/antechamber/database.
Usage: database -i database file name
-d definition file name

Example:
database -i sample_database.mol2 -d [Link]

This command reads in a multiple mol2 database - sample_database.mol2 and a description


file [Link] to run a set of commands (defined in [Link]) to generate prep input files and
merge them to a single file called [Link]. Both files are located in the following directory:
$AMBERHOME/test/antechamber/database/mol2.

4.4.3 parmcal
Parmcal is an interactive program to calculate the bond length and bond angle parameters,
according to the rules outlined in Ref. [69].
Please select:
1. calculate the bond length parameter: A-B
2. calculate the bond angle parameter: A-B-C
3. exit

4.4.4 residuegen
It can be painful to prepare an amino-acid-like residues. In AMBER 10, a new program,
residuegen, is developed to facilitate the residue topology generation. The program reads in an
input file and applies a set of antechamber programs to generate residue topologies in prepi
format. The program can be applied to generate amino-acid-like topologies for amino acids,
nucleic acids and other polymers as well. An example is provided below and the file format of
the input file is also explained.

90
4.4 Miscellaneous programs

Usage: residuegen input_file

Example:

residuegen [Link]

This command reads in [Link] and generate residue topology for alanine. The file format of
[Link] is explained below.

#INPUT_FILE: structure file in ac format, generated from a Gaussian output


INPUT_FILE [Link]
#CONF_NUM: Number of conformations utilized
CONF_NUM 2
#ESP_FILE: esp file generated from gaussian output with ’espgen’
# for multiple conformations, cat all CONF_NUM esp files onto ESP_FILE
ESP_FILE [Link]
#SEP_BOND: bonds that separate residue and caps, input in a format of
# (Atom_Name1 Atom_Name2), where Atom_Name1 belongs to residue and
# Atom_Name2 belongs to a cap; must show up two times
SEP_BOND N1 C2
SEP_BOND C5 N2
#NET_CHARGE: net charge of the residue
NET_CHARGE 0
#ATOM_CHARGE: predefined atom charge, input in a format of
# (Atom_Name Partial_Charge); can show up multiple times.
ATOM_CHARGE N1 -0.4175
ATOM_CHARGE H4 0.2719
ATOM_CHARGE C5 0.5973
ATOM_CHARGE O2 -0.5679
#PREP_FILE: prep file name
PREP_FILE: [Link]
#RESIDUE_FILE_NAME: residue file name in PREP_FILE
RESIDUE_FILE_NAME: [Link]
#RESIDUE_SYMBOL: residue symbol in PREP_FILE
RESIDUE_SYMBOL: ALA

4.4.5 top2ff
Top2ff extracts the force field parameter information in a topology file and save it in frcmod
format. It is useful if one is not sure what kinds of force field parameters he used for his MD
simulations.

Usage: top2ff -p topology file name


-o output file name in frcmod format

Example:

top2ff -i [Link] -c [Link]

91
4 Antechamber

This command reads in a topology file ([Link]) and write out all the force field parameters
into a frcmod file. Examination on the output can reveal which force field is used in the topology
file.

4.4.6 top2mol2
Top2mol2 essentially resembles ambpdb. It reads in an AMBER topology file and an
AMBER restart file and writes out a mol2 file. This mol2 file can be read by many software
packages, such as sybyl, chimera, pymol, etc. The atom types in the mol2 file can be either
sybyl (the default) or amber (AMBER and GAFF atom types). The sybyl atom type
information is obtained from an atom type corresponding file (ATOMTYPE_CHECK.TAB).
Similarly, a bond type corresponding file (BONDTYPE_CHECK.TAB) is used to assign bond
types (single, double, triple and aromatic). The two parameter files are located in the
dat/antechamber sub-directory.
Usage: top2mol2 -p topology file name
-c rst or crd file name
-o output file name)
-ac atom type corresponding file (optional)
-bc bond type corresponding file (optional)
-at atom type: sybyl (the default) or amber, optional
-bt bond type: sybyl (the default) or amber (all set to 1), optional
-wt keep water flag: 1 (including water) or 0 (removing water, the defa

Example:
top2mol2 -i [Link] -c 1be9_md.rst -c 1be9_md.mol2
top2mol2 -i [Link] -c 1be9_md.rst -c 1be9_md.mol2 -at amber

This first command reads in a topology file ([Link]) and a MD restart file (1be9_md.rst)
then writes out a mol2 file with the sybyl atom types. The second command, on the other hand,
keeps the original atom types in the topology file.

4.4.7 translate
Translate reads a pdb, ac or mol2 file and writes out a file in the same format after an
operation. The supported actions include, dimension check (’check’), centerization (’center’),
translation in three dimensions (’translate’), rotation along an axis defined by two atoms
(’rotate1’) or two space points (’rotate2’), least-squares fitting (’match’), alignment to X, Y or
Z-axis (’alignx’, ’aligny’ and ’alignz’). The manipulation of molecules with this program may
be useful in manual docking and molecular complexes modeling, such as membrane protein
construction.

translate -i input file name (pdb, ac or mol2)


-o output file name
-r reference file name

92
4.5 New Development of Antechamber And GAFF

-f file format
-c command (check, center, translate, rotate1, rotate2, match)
center: need -a1;
translate: need -vx, -vy and -vz;
rotate1: need -a1, -a2 and -d;
rotate2: need -x1, -y1, -z1, -x2, -y2, -z2 and -d;
match: need -r;
alignx: align to X-axis, need -x1, -y1, -z1, -x2, -y2, -z2;
aligny: align to Y-axis, need -x1, -y1, -z1, -x2, -y2, -z2;
alignz: align to Z-axis, need -x1, -y1, -z1, -x2, -y2, -z2;
image: reflect by (0,0,0)
imagex: reflect by Y-Z plane
imagey: reflect by X-Z plane
imagez: reflect by X-Y plane
-d degree to be rotated
-vx x vector
-vy y vector
-vz z vector
-a1 id of atom 1 (0 coordinate center)
-a2 id of atom 2
-x1 coord x for point 1
-y1 coord y for point 1
-z1 coord z for point 1
-x2 coord x for point 2
-y2 coord y for point 2
-z2 coord z for point 2

Example:

translate -i [Link] -f pdb -c alignz -x1 -33.088 -x2 -33.088 -y1 -14.578
-y2 50.061 -z1 7.0287 -z2 7.0287 -o 2rh1_Z.pdb
translate -i 2rh1_Z.pdb -f pdb -c rotate2 -x1 0 -x2 0 -y1 0 -y2 0 -z1 -10
-z2 10 -o 2rh1_Z60.pdb -d 60

This first command align a GPCR crystal structure, 2rh1 from Y-axis to Z-axis to get protein
2rh1_Z.pdb. Then the second command rotates 2rh1_Z 60 degrees along the Z-axis to get
2rh1_Z60.pdb.

4.5 New Development of Antechamber And GAFF


One important of functions of Antechamber is to assign AM1-BCC charges for organic
molecules. Openeye’s Quacpak module can also assign AM1-BCC charges. The careful users
may find that the charges assigned by the two programs are only marginally different (the largest
charge difference is smaller than 0.05) in most cases. The difference is probably rooted from

93
4 Antechamber

the difference of AM1 Mulliken charges. In unusual cases, large discrepancy occurs (the largest
charge difference is larger than 0.1). Recently, we have systematically studied 585 marketed
drugs using the both packages and the result is presented below. As the general AMBER force
field is tightly related to the antechamber package, the new development of the GAFF is also
summarized here.

4.5.1 Extensive Test of AM1-BCC Charges


Three methods, namely Antechamber/Mopac (Mulliken charges are calculated by Mopac),
Antechamber/Sqm (Mulliken charges are calculated by sqm) and Openeye’s Quacpak have been
applied to assign the AM1-BCC charges for the 585 drug molecules. The first two methods
give essentially similar charges for all the cases and the average charge difference is 0.005.
The Quacpak, on the other hand, has an average charge difference of 0.015 to Antechamber/-
Mopac. When compared to RESP charges, the average charge differences are 0.102 and 0.105
for Antechamber/Mopac and Quacpak, respectively. In AM1-BCC, five BCC parameters were
adjusted in order to improve agreement with the experimental free energies of solvation. Adjust-
ments were made to bonds of amine nitrogen-H and amine nitrogen-tetravalent carbon.[71, 72]
As a consequence, the average largest charge differences between AM1-BCC and RESP charges
are very big: 0.441 for Antechamber/Mopac and 0.452 for Quacpak.
There are 71 molecules (12%) having the largest charge difference larger than 0.1 between
Antechamber/Mopac and Quacpak. In comparison with the RESP charges, the average charge
differences of the 71 molecules are 0.107 and 0.129 for Antechamber/Mopac and Quacpack,
respectively. As to the average largest charge differences, the corresponding values are 0.444
and 0.522. It is clearly that Antechamber/Mopac-bcc has a similar average charge differences to
RESP for the whole data set and the 71-molecule subset (0.102 vs 0.107), in contrast, Quacpac
has a much larger average charge difference for the 71 molecules (0.129) than that of the whole
data set (0.105). The similar trend is observed for the average largest charge difference as well
(0.441 vs 0.444 for Antechamber/Mopac and 0.452 vs 0.522 for Quacpac).

4.5.2 New Development of GAFF


We have modified some parameters according to users’ feedback. We would like to thank
users who provide us nice feedback/suggestion, especially David Mobley and Gabriel Rocklin.
This version (GAFF1.4) is a meta-version between gaff1.0 and gaff2.0 and the following is the
major changes:
1. All the sp2 carbon in a AR2 ring (such as pyrrole, furan, pyrazole) are either ’cc’ or ’cd’
atom types (not ’c2’ any more). This is suggested by Gabriel Rocklin from UCSF. This
modification improves the planarity of multiple-ring systems
2. New van der Waals parameters have been developed for ’br’ and ’i’ atom types. The
current parameters can well reproduce the experimental density data of CH3 Br (1.6755,
20 degree) and CH3 I (2.2789, 20 degree): 1.642 for CH3 Br and 2.25 for CH3 I, in contrast,
the old parameters give 1.31 and 1.84, respectively. (Junmei, unpublished result)
3. New van der Waals parameters have been suggested by David Mobley for ’c1’, ’cg’ and
’ch’ atom types. The justification of the changes is discussed at [Link]

94
4.5 New Development of Antechamber And GAFF

4. We have performed B3LYP/6-31G* optimization for 15 thousands marketed or experi-


mental drugs/bio-actives. Reliable bond length and bond angle equilibrium parameters
were obtained by statistics: each bond length parameter must show up at least five times
and has a rmsd smaller than 0.02 Å; each bond angle parameter must show up at least five
times and has a rmsd smaller than 2.5 degrees. Those new parameters not showing up in
old gaff were directly added into gaff 1.4; and some low-quality gaff parameters which
show up less than five times or have large rmsd values (>0.02 Å for bond length and
>5 degrees for bond angles) were replaced with those newly generated. In summary, 59
low quality bond stretching parameters were replaced and 56 new parameters were intro-
duced; 437 low quality bond bending parameters were replaced and 618 new parameters
were introduced.

95
5 Semiempirical quantum chemistry

5.1 Introduction
AmberTools now contains its own quantum chemistry program, called sqm. This is code
extracted from the QM/MM portions of sander, but is limited to “pure QM” calculations. A
principal current use is as a replacement for mopac for deriving AM1-bcc charges, but the code
is much more general than that. Right now, it is limited to carrying out energy minimizations
for a wide variety of Hamiltonians, including many recent ones. Our plan is to add capabilities
to subsequent versions.
Support currently exists for gas phase simulations. Available semi-empirical Hamiltoni-
ans are PM3,[77] AM1,[78] RM1,[79] MNDO,[80] PDDG/PM3,[81] PDDG/MNDO,[81] and
PM3CARB1.[82] PM6 is supported for all elements which do not require d-orbitals. Support is
also available for the Density Functional Theory-based-tight- binding (DFTB) Hamiltonian,[83–
85] as well as the Self-Consistent-Charge version, SCC-DFTB.[86] DFTB/SCC-DFTB also
supports approximate inclusion of dispersion effects,[87] as well as reporting CM3 charges [88]
for molecules containing only the H, C, N, O, S and P atoms and third-order corrections[89].
The elements supported by each QM method are:

MNDO: H, Li, Be, B, C, N, O, F, Al, Si, P, S, Cl, Zn, Ge, Br, Sn, I, Hg, Pb
AM1: H, C, N, O, F, Al, Si, P, S, Cl, Zn, Ge, Br, I, Hg
PM3: H, Be, C, N, O, F, Mg, Al, Si, P, S, Cl, Zn, Ga, Ge, As, Se, Br, Cd, In, Sn, Sb
PDDG/PM3: H, C, N, O, F, Si, P, S, Cl, Br, I
PDDG/MNDO: H, C, N, O, F, Cl, Br, I
RM1: H, C, N, O, P, S, F, Cl, Br, I
PM3CARB1: H, C, O
PM6: H, He, Li, Be, B, C, N, O, F, Ne, Na, Mg, Ar, K, Ca, Zn, Ga, Ge,Kr, Rb,
DFTB/SCC-DFTB: (Any atom set available from the [Link] website)

The DFTB/SCC-DFTB code was originally based on the DFT/DYLAX code by Marcus El-
stner et al.. but has since been extensively re-written and optimized. In order to use DFTB
(qm_theory=DFTB) a set of integral parameter files are required. These are not distributed
with Amber and must be obtained from the [Link] website and placed in the $AM-
BERHOME/dat/slko directory. Dispersion parameters for H, C, N, O, P and S are available
in the $AMBERHOME/dat/slko/DISPERSION.INP_ONCHSP file, and CM3 parameters for
the same atoms are in the $AMBERHOME/dat/slko/CM3_PARAMETERS.DAT file. Parame-
ters for two parameterizations of the third-order SCC-DFTB terms, namely SCC-DFTB-PA
and SCC-DFTB-PR are distributed with Amber in the files DFTB_3RD_ORDER_PA.DAT and
DFTB_3RD_ORDER_PR.DAT, located in the same directory.

97
5 Semiempirical quantum chemistry

The semi-empirical support was written by Ross Walker, Mike Crowley, and Dave Case,[90]
based originally on public-domain MOPAC codes of J.J.P. Stewart. The generalised Born im-
plementation uses the model described by Pellegrini and Field[91]. SCC-DFTB support was
written by Gustavo Seabra, Ross Walker and Adrian Roitberg,[83] and is based on earlier work
of Marcus Elstner.[86, 92] Support for third-order SCC-DFTB was written by Gustavo Seabra
and Josh Mcclellan.

5.2 General &qmmm Namelist Variables


An example input file for running a simple minimization is shown here:
Run semi-empirical minimization
&qmmm
qm_theory=’AM1’, qmcharge=0,
/
6 CG -1.9590 0.1020 0.7950
6 CD1 -1.2490 0.6020 -0.3030
6 CD2 -2.0710 0.8650 1.9630
6 CE1 -0.6460 1.8630 -0.2340
6 C6 -1.4720 2.1290 2.0310
6 CZ -0.7590 2.6270 0.9340
1 HE2 -1.5580 2.7190 2.9310
16 S15 -2.7820 0.3650 3.0600
1 H19 -3.5410 0.9790 3.2740
1 H29 -0.7870 -0.0430 -0.9380
1 H30 0.3730 2.0450 -0.7840
1 H31 -0.0920 3.5780 0.7810
1 H32 -2.3790 -0.9160 0.9010
The &qmmm namelist contains variables that allow you to control the options used. Following
that is one line per atom, giving the atomic number, atom name, and Cartesian coordinates (free
format). The variables in the &qmmm namelist are these:
qm_theory Level of theory to use for the QM region of the simulation. (Hamiltonian). Default
is to use the semi-empirical Hamiltonian PM3. Options are AM1, RM1, MNDO,
PM3-PDDG, MNDO-PDDG, PM3-CARB1, PM6, and DFTB.
dftb_disper Flag turning on (1) or off (0) the use of a dispersion correction to the DFTB/SCC-
DFTB energy. Requires qm_theory=DFTB. It is assumed that you have the file
DISPERSION.INP_ONCHSP in your $AMBERHOME/dat/slko/ directory. This
file must be downloaded from the website [Link], as described in the begin-
ning of this chapter. Not available for the Zn atom. (Default = 0)
dftb_3rd_order Third order correctio to SCC-DFTB. Default=” (no third order correction).
= ’PA’ Use the SCC-DFTB-PA parameterization, which was developed for pro-
ton affinities. The parameters will be read from the $AMBERHOME/dat/s-
lko/DFTB_3RD_ORDER_PA.DAT file.

98
5.2 General &qmmm Namelist Variables

= ’PR’ Use the SCC-DFTB-PR parameterization, which was developed for phos-
phate hydrolysis reactions. The parameters will be read from the $AMBER-
HOME/dat/slko/DFTB_3RD_ORDER_PR.DAT file.
= ’READ’ Parameters will be red from the mdin file, in a separate “dftb_3rd_order”
namelist, which must have the same format as the files above.
= ’filename’ Parameters will be red from the file specified by filename, in the
“dftb_3rd_order” namelist, which must have the same format as the files
above.
dftb_chg Flag to choose the type of charges to report when doing a DFTB calculation.
= 0 (default) - Print Mulliken charges
= 2 Print CM3 charges. Only available for H, C, N, O, S and P.

dftb_telec Electronic temperature, in K, used to accelerate SCC convergence in DFTB calcu-


lations. The electronic temperature affects the Fermi distribution promoting some
HOMO/LUMO mixing, which can accelerate the convergence in difficult cases.
In most cases, a low telec (around 100K) is enough. Should be used only when
necessary, and the results checked carefully. Default: 0.0K
dftb_maxiter Maximum number of SCC iterations before resetting Broyden in DFTB calcula-
tions. (default: 70 )
qmcharge Charge on the QM system in electron units (must be an integer). (Default = 0)
spin Multiplicity of the QM system. Currently only singlet calculations are possible
and so the default value of 1 is the only available option. Note that this option
is ignored by DFTB/SCC-DFTB, which allows only ground state calculations. In
this case, the spin state will be calculated from the number of electrons and orbital
occupancy.
qmqmdx Flag for whether to calculate QM-QM derivatives analytically or pseudo numeri-
cally. The default (and recommended) option is to use ANALYTICAL QM-QM
derivatives.
= 1 (default) - Use analytical derivatives for QM-QM forces.
= 2 Use numerical derivatives for QM-QM forces. Note: the numerical derivative
code has not been optimised as aggressively as the analytical code and as such
is significantly slower. Numerical derivatives are intended mainly for testing
purposes.
verbosity Controls the verbosity of QM/MM related output. Warning: Values of 2 or higher
will produce a lot of output.
= 0 (default) - only minimal information is printed - Initial QM geometry and link
atom positions as well as the SCF energy at every ntpr steps.
= 1 Print SCF energy at every step to many more significant figures than usual.
Also print the number of SCF cycles needed on each step.

99
5 Semiempirical quantum chemistry

= 2 As 1 but also print info about memory reallocations, number of pairs per QM
atom. Also prints QM core - QM core energy, QM core - MM charge energy
and total energy.
= 3 As 2 but also print SCF convergence information at every step.
= 4 As 3 but also print forces on QM atoms due to the SCF calculation and the
coordinates of the link atoms at every step.
= 5 As 4 but also print all of the info in KJ/mol as well as KCal/mol.

tight_p_conv Controls the tightness of the convergence criteria on the density matrix in the
SCF.
=0 (default) - loose convergence on the density matrix (or Mulliken charges, in
case of a SCC-DFTB calculation). SCF will converge if the energy is con-
verged to within scfconv and the largest change in the density matrix is within
0.05*sqrt(scfconv).
= 1 Tight convergence on density(or Mulliken charges, in case of a SCC-DFTB
calculation). Use same convergence (scfconv) for both energy and density
(charges) in SCF. Note: in the SCC-DFTB case, this option can lead to insta-
bilities.

scfconv Controls the convergence criteria for the SCF calculation, in kcal/mol. In order to
conserve energy in a dynamics simulation with no thermostat it is often necessary
to use a convergence criterion of 1.0d-9 or tighter. Note, the tighter the conver-
gence the longer the calculation will take. Values tighter than 1.0d-11 are not
recommended as these can lead to oscillations in the SCF, due to limitations in ma-
chine precision, that can lead to convergence failures. Default is 1.0d-8 kcal/mol.
Minimum usable value is 1.0d-14.

pseudo_diag Controls the use of ’fast’ pseudo diagonalisations in the SCF routine. By default
the code will attempt to do pseudo diagonalisations whenever possible. However,
if you experience convergence problems then turning this option off may help. Not
available for DFTB/SCC-DFTB.
= 0 Always do full diagonalisation.
= 1 Do pseudo diagonalisations when possible (default).

pseudo_diag_criteria Float controlling criteria used to determine if a pseudo diagonalisation


can be done. If the difference in the largest density matrix element between two
SCF iterations is less than this criteria then a pseudo diagonalisation can be done.
This is really a tuning parameter designed for expert use only. Most users should
have no cause to adjust this parameter. (Not applicable to DFTB/SCC-DFTB cal-
culations.) Default = 0.05

diag_routine Controls which diagonalization routine should be used during the SCF procedure.
This is an advanced option which has no effect on the results but can be used to fine
tune performance. The speed of each diagonalizer is both a function of the number

100
5.2 General &qmmm Namelist Variables

and type of QM atoms as well as the LAPACK library that Sander was linked
to. As such there is not always an obvious choice to obtain the best performance.
The simplest option is to set diag_routine = 0 in which case Sander will test each
diagonalizer in turn, including the pseudo diagonalizer, and select the one that gives
optimum performance. This should ideally be the default behavior but this option
has not been tested on sufficient architectures to be certain that it will always work.
Not available for DFTB/SCC-DFTB.
= 0 Automatically select the fastest routine (recommended).
= 1 Use internal diagonalization routine (default).
= 2 Use lapack dspev.
= 3 Use lapack dspevd.
= 4 Use lapack dspevx.
= 5 Use lapack dsyev.
= 6 Use lapack dsyevd.
= 7 Use lapack dsyevr.

printcharges
= 0 Don’t print any info about QM atom charges to the output file (default)
= 1 Print Mulliken QM atom charges to output file every ntpr steps.

peptide_corr
= 0 Don’t apply MM correction to peptide linkages. (default)
= 1 Apply a MM correction to peptide linkages. This correction is of the form
Esc f = Esc f + htype (itype ) sin2 φ , where φ is the dihedral angle of the H-N-C-O
linkage and htype is a constant dependent on the Hamiltonian used. (Recom-
mended, except for DFTB/SCC-DFTB.)

itrmax Integer specifying the maximum number of SCF iterations to perform before as-
suming that convergence has failed. Default is 1000. Typically higher values will
not do much good since if the SCF hasn’t converged after 1000 steps it is unlikely
to. If the convergence criteria have not been met after itrmax steps the SCF will
stop and the minimisation will proceed with the gradient at itrmax. Hence if you
have a system which does not converge well you can set itrmax smaller so less
time is wasted before assuming the system won’t converge. In this way you may
be able to get out of a bad geometry quite quickly. Once in a better geometry SCF
convergence should improve.

maxcyc Maximum number of minimization cycles to allow, using the xmin minimizer (see
Section 14.4) with the TNCG method. Default is 9999. Single point caclulations
can be done with maxcyc = 0.

ntpr Print the progress of the minimization every ntpr steps; default is 10.

101
5 Semiempirical quantum chemistry

grms_tol Terminate minimization when the gradient falls below this value; default is 0.02
ndiis_attempts Controls the number of iterations that DIIS (direct inversion of the iterative sub-
space) extrapolations will be attempted. Not available for DFTB/SCC-DFTB. The
SCF does not even begin to exhaust its attempts at using DIIS extrapolations until
the end of iteration 100. Therefore, for example, if ndiis_attempts=50, then DIIS
extrapolations would be performed at end of iterations 100 to 150. The purpose
of not performing DIIS extrapolations before iteration 100 is because the exist-
ing code base performs quite well for most molecules; however, if convergence
is not met after 100 iterations, then it is presumed that further iterations will not
yield SCF convergence without doing something different, i.e., DIIS. Thus, the im-
plementation of DIIS in SQM is a mechanism to try and force SCF convergence
for molecules that are otherwise difficult to converge. Default 0. Maximum 1000.
Minimum 0. Note that DIIS will automatically turn itself on for 100 attempts at the
end of iteration 800 even if you did not explicitly set ndiis_attempts to a nonzero
value. This is done as a final effort to achieve convergence.
ndiis_matrices Controls the number of matrices used in the DIIS extrapolation. Including only
one matrix is the same as not performing an extrapolation. Including an excessive
number of matrices may require a large amount of memory. Not available for
DFTB/SCC-DFTB. Default 6. Minimum 1. Maximum 20.
errconv SCF tolerance on the maximum absolute value of the error matrix, i.e., the com-
mutator of the Fock matrix with the density matrix. The value has units of Hartree.
The default value of errconv is sufficiently large to effectively remove this tolerance
from the SCF convergence criteria. Not available for DFTB/SCC-DFTB. Default
1.d-1. Minimum 1.d-16. Maximum 1.d0.

102
6 ptraj
ptraj is really two interfaces contained within the same C source code:

1. rdparm: a program to read and help interpret Amber prmtop files


usage: rdparm prmtop

2. ptraj (and the MPI parallelized compilation of the code, [Link]): programs to pro-
cess and analyze a series of 3-D atomic coordinates (one molecular configuration or frame
at a time). Molecular information, such as atom and residue names, is loaded from the
file prmtop and this file can be an Amber prmtop, CHARMM PSF or PDB file. Note
that the input atomic coordinates must be in the same order as the atoms stored in the
molecular information file (i.e. prmtop).

usage: ptraj prmtop script or ptraj prmtop < script >& [Link]

The interface used at runtime by default is ptraj, unless the executable is named “rdparm”.
rdparm is interactive – type “?” or “help” for a list of commands – and only supports the
reading of Amber prmtop files. If the executable name does not contain the string “rdparm”,
ptraj is run instead. Commands to ptraj can either be piped in through standard input or
from a file (script). To save runtime information from ptraj it is often convenient to pipe the
standard output and error to a file (>& [Link]). The code is documented and can be
extended by users. Information absent from this manual can often be found by consulting the
code directly. An example input script is shown below:

trajin [Link] 1 20 1
trajin traj2.Z 1 100 1
trajin restrt.bz2
trajout [Link] nobox
center :1-20 mass origin
image origin center
rms first out rms @CA,C,N
strip :WAT
average [Link] pdb
go

The above ptraj script reads in three sets of coordinates (specified with the trajin key-
word), i.e. [Link] frames 1 to 20, traj2.Z frames 2, 4, 6, ..., 100, and the single frame
of restrt.bz2. A variety of file types are supported including Amber ascii and NetCDF tra-
jectories and restart files, CHARMM DCD files of either endian order, PDB files, and binpos

103
6 ptraj

binary files. For each frame of coordinates, a series of actions are performed, in the order spec-
ified, and a new trajectory file ([Link]) of the processed coordinates is output without
any periodic box information. The actions performed include centering the coordinates, peri-
odically imaging the coordinates to the primary unit cell, rms fitting of the coordinates to the
first frame, deleting the coordinates for residues named WAT, and accumulation of an average
structure over all the frames. Atom selections, for example specifying the list of atoms to be
used in the rms fitting (i.e. @CA,C,N), are chosen using the Amber mask syntax which is similar
to that used in Midas/Chimera. Note that some commands alter the coordinates, and therefore
the ordering of action commands is important. For example, since rotation information is not
stored at present when rms fitting, imaging should be performed prior to rms fitting otherwise
the periodic box could rotate out of its reference frame.

6.1 Understanding ptraj commands and actions


In the discussion that follows commands are listed in bold type. Words in italics are values
that need to be specified by the user, and words in typewriter text are keywords to specify an
option (which may or may not be followed by a value). In the specification of the commands,
arguments in square brackets ([]’s) are optional and the "|" character represents "or". Arguments
that are not in square brackets are required. In general, if there is an error in processing a
particular action, that action will be ignored and the user warned (rather than terminating the
program), so check the printed warning’s carefully. A few of the commonly used argument
types are described below:

mask : this is used to specify a list of atoms. The syntax for specifying atoms is equivalent
to the Amber mask syntax (see ambmask as described in the miscellaneous section of
the manual) and also supports most of the MidasPlus/Chimera syntax. Note that spaces
are only interpreted if the mask is surrounded by double quotes (“ ”). The “@” character
selects atom names or numbers, the “:” character selects residue names or numbers,
the "-" character represents a continuation, the “,” character allows specifying multiple
names or numbers, and the “*” and “?” commands are wildcard matches for multiple
or single characters, respectively. To understand or check what atoms are selected, the
checkmask command to rdparm can be applied.

filename: this refers to the name of the file, relative to the current directory (unless the full
path is provided). No checking is done for existing files, so be careful when specifying
output files as existing files of the same name will be overwritten.

commands: each command effectively needs to be on a single line and values separated by
whitespace are considered as different tokens. If you have a mask with spaces, be sure to
wrap the specification in quotes. If you want to break up a command over multiple lines,
use a continuation character “\”.

The following sections discuss input and output commands to ptraj, commands that modify
the state (such as the box size or definition of solvent atoms), and each of the defined action
commands.

104
6.2 ptraj coordinate input/output commands

6.2 ptraj coordinate input/output commands


trajin filename [ start stop offset] [remdtraj remdtrajtemp reptemp]
Load the trajectory file specified by filename using only the frames starting with start
(default 1) and ending with (and including) stop (default, the final configuration) using
an offset of offset (default 1) if specified. Amber trajectory, Amber restart, PDB, binpos,
CHARMM DCD, and Amber REMD trajectory files are all currently supported. To read
an Amber REMD trajectory at a particular temperature from an ensemble of replica tra-
jectories, specify the remdtraj remdtrajtemp keywords followed immediately by the
replica temperature (reptemp, default 0.0), and then files will be searched and the final
trajectory found at that particular temperature will be used. Note that in this case, trajin
assumes the Amber REMD files are named according to the convention that the end of the
filename includes “.N”, “.[Link]” or “.N.bz2” where N is the number of replicas eading
specification of the replica number (i.e. NNN = 000, 001, ...). An example call is “trajin
[Link] remdtraj remdtrajtemp 300.0” which will search all existing files at
that path location named [Link] for the final replica at 300.0 degrees. Filenames
with an appended .Z or .gz or .bz2 are also recognized and treated appropriately, with the
exception of compressed Amber NetCDF files (and .Z compressed Amber REMD files).
Finally, please note that the coordinates must match the names/ordering of the molecular
information file (prmtop) previously read in.

reference filename
Load up the first coordinate set from the trajectory specified by the file named filename
and save this for use as a reference structure. Currently the only action command to use
the reference structure is the rms command. Note that as the state is modified (for
example by strip or closestwaters), the reference coordinates are also modified
internally. If multiple reference commands are specified, the structure referenced is the
one loaded previous to the current rms command. For example, if you wanted to
calculate the rms deviation to two different pdb structures ([Link] and [Link]) you
could use the following script:
trajin mdcrd
reference [Link]
rms reference out [Link]
reference [Link]
rms reference out [Link]
Note that it is possible for the reference coordinate set to be incomplete (for example
an unsolvated protein). Although a warning is printed, as long as the RMS command
does not refer to the missing coordinates and there is still a 1-to-1 mapping between the
reference and actual coordinates loaded and the atoms to fit are within this set, the RMS
fit is valid.

trajout filename [ format ] [ nobox ] [ nowrap ] [ append ] [ remdtraj ] [ les split|average


] [ little | big ] \
[ dumpq| parse ] [ title title ] [ application application ] [ program program ]

105
6 ptraj

filename [ format ]: Specify the name of a file for output coordinates (filename) written
in a specific format (format). Currently supported formats are:
• trajectory – Amber ascii trajectory, the default
• restart – Amber restart
• binpos – Scripps binary format
• pdb – PDB, the traditional format (not the newer CIF files); if molecule information
is present, TER cards will be written between molecules.
• cdf | netcdf – Amber NetCDF binary trajectory
• charmm – CHARMM DCD binary trajectory
Note that the allowable formats include both trajectory files (i.e. a series of frames) and
files that traditionally include only a single coordinate set. In this latter case, the filename
will be appended with .N where N is the frame number (unless the optional keyword
append is specified).
• nobox: This keyword suppresses the output of box information in AMBER trajec-
tory and restart file formats. If you read in a trajectory with periodic box informa-
tion, the box information will automatically be printed in an output trajectory. This
is not always desirable. For example, if you are stripping solvent from the trajectory
(strip :WAT), you may want to specify the “nobox” option so that the trajectory
can be later processed with a corresponding non-periodic prmtop (or PDB) file. For
non-periodic trajectories, always specify nobox.
• nowrap: This option is only of relevance to PDB files and prevents automatically
wrapping the fourth character of the atom name to the first column (as is normally
done automatically per PDB guidelines).
• append: For single set coordinate file outputs (for example PDB), specification of
“append” will suppress creation of separate files and put each frame into the same
file (filename) with TER and ENDMDL cards between coordinate sets. Append
is not applicable to the restart format.
• remdtraj: This keyword, only applicable to Amber trajectory formats (trajectory
and netcdf), adds Amber specific temperature replica exchange MD temperature
information consistent with the current replica temperature. If the input trajectory
has no temperature information, a temperature of 0.0 will be written in the output
trajectory. A common use of this functionality is to convert Amber ascii trajectories
to NetCDF format. Note that the replica number, mdstep and exchange# fields of
the REMD section of the Amber ascii REMD trajectory are not preserved and will
be converted to 0, the frame number, and the frame number, respectively.
• les split | append: The les keyword is used for the merging or splitting of
Amber formatted locally enhanced sampling (LES) trajectories. The “split” key-
word will output N separate trajectories, one for each LES group (where N is the
copy number) whereas “average” will output a single averaged trajectory. Note
that to subsequently process the split or merged LES trajectories, the corresponding
non-LES prmtop (without extra copies) is required.

106
6.3 ptraj commands that override the molecular information specified

• little | big: These keywords can only be used with the CHARMM DCD output
to specify the byte ordering as “little” or “big” endian; by default the endian
order of the first CHARMM DCD trajectory read in is preserved.
• dumpq | parse: This option is only of relevance to PDB files and allows dumping
of charges and radii into the temperature and occupancy columns of the PDB file
(similar to a PQR file). With “dumpq” Amber charges and van der Waals radii (not
the generalized Born radii!) are output. With “parse” Amber charges and parse
radii are output. A current limitation of this implementation is that the implicit
solvent radii specified in the Amber prmtop file (%FLAG RADII) cannot be dumped
automatically at present.
• title, application, program: When comments are allowed in the output tra-
jectory, optional title, application and program names can be specified as text strings
(without any spaces).
Extra note on the CHARMM DCD trajectory output: If periodic box information is
present in the CHARMM trajectory file, the symmetric box information output in a new
CHARMM trajectory file (in versions > 22) will be *very* slightly different due to nu-
merical issues in the diagonalization procedure; this will not effect analysis but shows up
when diffing the binary files.
Limitations: Note that only a single trajout command is currently supported and it
outputs the coordinates after all action commands have been processed. In the future
look for the command trajout-action which will provide the same support but allow
multiple context dependent specifications.

6.3 ptraj commands that override the molecular information


specified
These commands change the state of the system, such as to define the solvent or alter the box
information.
box [ x value ] [ y value ] [ z value ] [ alpha value ] [ beta value ] [ gamma value ] \
[ fixx ] [ fixy ] [ fixz ] [ fixalpha ] [ fixbeta ] [ fixgamma ]
This command allows specification and optionally fixing of the periodic box (unit cell)
dimensions. This can be useful when reading PDB files that do not contain box
information, trajectory formats that do not support non-standard triclinic cells, or to
override the box information in the trajectory file. For example, if you wanted to process
the coordinates with average values rather than the instantaneous box coordinates for
each frame. The x, y, and z keywords change the box size (in Angstroms) and the
alpha, beta and gamma values change the angles of the triclinic unit cell. In the
standard usage, without the “fix” keywords, if the box information is not already present
in the input trajectory (such as the case with restart files or trajectory files) this
command can be used to set the default values that will be applied. If you want to force
a particular box size or shape, the fixx, fixy, etc commands can be used to override
any box information already present in the input coordinate files. For example, the

107
6 ptraj

following command will set the x-component of the box size to be 100.0 Angstroms and
fix its value throughout the trajectory:
box x 100.0 fixx

solvent [ byres | byname ] mask1 [ mask2 ] [ mask3 ] ...


This command can be used to override the solvent information specified in the Am-
ber prmtop file or that which is set by default (based on residue name) upon reading
a CHARMM psf. Applying this command overwrites any previously set solvent defi-
nitions. The solvent can be selected by residue with the "byres" modifier using all the
residues specified in the one or more atom masks listed. The byname option searches for
solvent by residue name (where the mask contains the name of the residue), searching
over all residues.
As an example, say you want to select the solvent to be all residues from 20-100, then
you would do
solvent byres :20-100
Note that if you don’t know the final residue number of your system offhand, yet you do
know that the solvent spans all residues starting at residue 20 until the end of the system,
just chose an upper bound and the program will reset accordingly, i.e.
solvent byres :20-999999
To select all residues named "WAT" and "TIP3" and "ST2":
solvent byname WAT TIP3 ST2
Note that if you just want to peruse what the current solvent information is (or more gen-
erally get some information about the current state), specify solvent with no arguments
and a summary of the current state will be printed.
Other commands which also modify the molecular information are strip and closest.
These commands are described in the next section since they also modify the coordinates.

6.4 ptraj action commands - short list

6.5 ptraj action commands - detailed discussion


The following are commands that involve an action performed on each coordinate set as it is
read in. The commands are listed in alphabetical order, and are summarized in Table 6.1. Note
that when ptraj processes the list of commands, they are applied in the order specified. Some of
these may change the overall state or molecular information (i.e. the list of active atoms; more
on this later). All of the actions can be applied repeatedly. Note that in general (except where
otherwise mentioned) implicit imaging in non-orthorhombic systems (for example of distances)
is supported.

108
6.5 ptraj action commands - detailed discussion

action description of the action


calculate summary properties for values accumulated during analysis, such
analyze
as distances, etc.
compute the angle in degrees between the center of mass of the three atom
angle
specifications listed
compute the atomic positional fluctuations (RMSF) or B-factors: Note this
atomicfluct
does not implicitly perform an RNA fit prior
compute the straight coordinate average of the coordinate sets read in: Note
average
this does not implicitly perform an RNA fit prior
center move all the coordinates to the origin or box center
look for atoms that are closer (and optionally further separated than) a
checkoverlap
specified distance
strip the trajectories such that only the closest N (chosen by the user)
closest
solvent molecules are retained
group configurations from the MD trajectory into distinct sets (and report
cluster
average, representative and trajectory) structures
find the number of atom interactions (and native contacts) within a given
contacts
distance
calculate the dihedral values from the center of mass of the four specified
dihedral
atom masks
diffusion calculate the mean-squared displacements vs. frame number
construct a grid of solvent dipoles (note: this command is obsolete and the
dipole
user should consult the code)
calculated the distance in Angstroms between the center of mass of the two
distance
atom specifications listed
create a grid in X-Plor density format that has a count of the number of
grid
selected atoms in each grid cell
described in a separate section, this command keeps track of distances and
hbond
angles between pairs of atoms
with periodic boundary conditions, bring molecules outside the periodic
image
box into the central unit cell
calculate 2D correlations and fluctuations; note that this is described in a
matrix
separate section of the manual
principal align to the principal coordinate axis
pucker compute the pucker for 5-membered rings
radial compute a radial distribution function
radgyr determine the radius of gyration for each frame
move single atom ion residues to new positions by swapping with random
randomizeions
water molecules
rms compute the RMSd to the first frame or a reference frame
secstruct determine the secondary structure of proteins
strip remove atoms from the trajectory
translate move the entire system in the x, y and/or z directions
trunctoct create an old style AMBER truncated octahedron; this is obsolete
watershell determine how many solvent models are within a given radius of the solute
vector calculate and analyze various different vectors

Table 6.1: Summary of ptraj action commands 109


6 ptraj

A number of the commands store derived data internally, such as per frame RMSd values or
angles. This data can be analyzed or processed later (see the information on the analyze com-
mand). To provide specification of the data for each data generating command, a unique name
is associated with the data. See the examples for the angle command below for clarification.

angle name mask1 mask2 mask3 [ out filename ] [ time interval ]


Calculate the angle between the three atoms listed, each specified in a separate mask,
mask1 through mask3. If more than one atom is listed in each mask, then the center of
mass of the atoms in that mask is used. Note that masks that include spaces must be
enclosed in quotation marks. The results are saved internally with the name name
(which must be unique) on the scalarStack for later processing (with the analyze
command). Data will be dumped to a file named filename if “out” is specified in two
columns (time and angle) with a time interval between configurations of interval if
“time” is listed (in picoseconds, default is 1.0); for example if the time between frames
is 5 ps, specify time 5.0). All the angles are stored in degrees. For example, two
angle commands are shown below. The first simply calculates the angles between three
atoms in residue #1, namely CA, C, and N. The second calculates the angle between the
center of mass of residues 1, 2 and 3. Each are referenced into an internal name space
(a1 and angle-name2). The second command also outputs the data to a file named
[Link] with the x-axis (time) scaled by 10, essentially meaning a spacing of 10 ps
per frame of data. See the command analyze statistics all to print averages and
standard deviations...
angle a1 :1@CA :1@C :1@N
angle angle-name2 :1 :2 :3 out [Link] time 10.0

atomicfluct [ out filename ] [ mask ] [ start start ] [ stop stop ] [ offset offset ] [ byres
| byatom | bymask ] [ bfactor ]
Compute the atomic positional fluctuations for all the atoms; output is performed only
for the atoms specified in the mask. If “byatom” is specified, dump the calculated fluc-
tuations by atom (default). If “byres” is specified, dump the average (mass-weighted)
for each residue. If “bymask” is specified, dump the average (mass-weighted) over all
the atoms in the original mask. If “out” is specified, the data will be dumped to filename
(otherwise the values will be dumped to the standard output). The optional “start”,
“stop”, and “offset” keywords are specified, they should follow with specification of a
value that respectively represents the first, last and offset for coordinate processing of the
coordinates read in. This paring down of snapshots acts on top of, or in addition to, any
offsets specified with “trajin”. If the keyword “bfactor” is specified, the data is output
as B-factors rather than atomic positional fluctuations (which simply means multiplying
the squared fluctuations by (8/3)pi**2). The data is dumped into two columns (n and
value) where n goes from 1 to the number of atoms or groups specified and the value is
the appropriate RMSF (Angstroms) or B-factor (Angstroms**2 * (8/3)pi).
So, to dump the mass-weighted B-factors for the protein backbone atoms C, CA, and N,
by residue use the command:
atomicfluct out [Link] @C,CA,N byres bfactor

110
6.5 ptraj action commands - detailed discussion

To dump the RMSF or atomic positional fluctuations of the same atoms, use the
command:
atomicfluct out [Link] @C,CA,N
Note that RMS fitting is not done implicitly. If you want fluctuations without rotations
or translations (for example to the average structure), perform an RMS fit to the average
structure (best) or the first structure (see rms) prior to this calculation.
average filename [ mask ] [ start start ] [ stop stop ] [ offset offset ] [ nobox ] \
[ pdb [ parse | dumpq ] [ nowrap ] | binpos | rest ] [ stddev ]
Compute the average structure over all the configurations read in (subject to values spec-
ified for start, stop and offset, if set, noting that the number is relative to the or-
der of frames read in and acts on top of, or in addition to, any such values specified
with trajin). The resulting structure is written (or appended if the optional keyword
“append” is provided) to a file named filename. The optional mask trims the output coor-
dinates (but does not change the state or alter the coordinates in the action stream as they
are processed). If you want to alter the coordinates on the action stream via averaging,
use the runningaverage command.
nobox: If specified, the box information is not written to file formats that accept box
information (i.e. AMBER trajectory, binpos or rest). This is very important if you are
processing non-periodic systems–or are generating solvent stripped trajectories– since
otherwise after each coordinate set the box coordinates are written. If you subsequently
try to process the newly written trajectory with a non-periodic prmtop file, only the first
frame will be read in correctly (due to the offsets).
File formats: At present only four output file types are supported, specifically the AM-
BER trajectory (the default), PDB (if pdb is specified), AMBER binpos (if binpos is
specified) or AMBER restart (if rest is specified). Additional options are supported for
the PDB format: nowrap prevents movement of the fourth character of the atom name to
the first column (as is normally done in the PDB standard format), parse will write parse
radii and AMBER charges to the temperature and occupancy columns, and dumpq will
write AMBER van der Waals radii (r*) and charges to the temperature and occupancy
columns. A current limitation in this command is that there is not an option to dump the
actual GB radii stored in the AMBER prmtop files.
stddev: Write out the standard deviations (fluctuations) instead of the average coordi-
nates.
An example below creates the file “average_1-[Link]” in PDB format, average over all
atoms named CA, and starts and ends with the 1000th and 2000th frames read in,
respectively:
angle average_1-[Link] @CA start 1000 stop 2000 pdb

center [ mask ] [ origin ] [ mass ]


This action moves all of the atoms in the system to the origin or box center. With the mass
keyword, the center of mass is moved to the periodic box center or origin, otherwise the
center of the coordinates is moved. If the optional mask is specified, all of the coordinates

111
6 ptraj

are translated to place the center of the selected coordinates at the origin or box center.
If origin is specified, periodic coordinates are moved to the zero of coordinates rather
than the box center. With non-periodic trajectories, the center is always at the origin or
zero of the coordinates. By default, for periodic trajectories the center is the center of the
periodic unit cell.
Note: Moving all of the coordinates to the center can hide systematic motion in a par-
ticular direction; in the mid-1990’s, we automatically centered and RMS fit all of our
trajectories after a long set of runs and looked at movies of these trajectories stripped
of solvent rather than the raw trajectories. This hid a problem resulting from a potential
energy drain and velocity scaling for temperature control that led to build-up of trans-
lational motion. The so-called “flying box of ice” is described in J. Comp. Chem. 19,
726-740 (1998) and later by another group in J. Comp. Chem. 21, 121-131 (2000). Many
MD trajectories were subsequently thrown away... This problem was fixed and AMBER
now conserves energy in routine use. Do remember that processed trajectories may not
be fully representative of, or may hide motions in, the raw data!
The following command will place the center of mass of all coordinates at the origin.
center mass origin
If you want the protein atoms at the origin (so you can subsequently image the
trajectory to put solvent around the protein using image origin center), use:
center @CA mass origin

checkoverlap [ mask ] [ min value ] [ max value ] [ noimage ] [ around mask ]


Look for pair distances in the mask selected atoms (all by default) that are less than the
specified minimum value (in angstroms, min 0.95 by default) apart or greater than the
maximum value (if specified with max). The “around” keyword can be used to limit
search of pair distances only around a selected set of atoms. This command is extremely
computationally demanding, particularly if imaging is turned on (by default; imaging can
be turned off with noimage), so expect to wait a while.
This command is extremely useful for diagnosing problems in input coordinates related
to poor model building, such as to find overlapping atoms that can lead to infinite van
der Waals or electrostatic energies. An example below looks for overlap of atoms in
residues named Na+ and K+:
checkoverlap @Na+,K+
To look over atoms with a distance less than 1.2 Angstroms between any atom in
residues 1-20 with any other atom:
checkoverlap min 1.2 around :1-20

closest total mask [ oxygen | first ] [ noimage ]


This command can be used to retain only the closest solvent molecules (based on the
number specified by the integer total) to the atoms specified in the mask. By default, this
means residues named “WAT”. The definition of solvent can be changed using the sol-
vent command (defined previously in section 5.3), for example to save only the closest

112
6.5 ptraj action commands - detailed discussion

set of total ions. If “oxygen” or “first” are specified, only the distance to the first atom
in the solvent molecule (to each atom in the mask) is measured. This command is rather
time consuming since many distances need to be measured. Note that imaging is implic-
itly performed on the distances and this gets extremely expensive in non-orthorhombic
systems due to the need to possibly check all the distances of the nearest images (up to
26!). Imaging can be disabled by specifying the “noimage” keyword.
Note that the solvent residue numbers are not preserved and are ordered at output such
that the closest solvent is first. This means that water 1000 is not always the same water
molecule and therefore you cannot use commands like diffusion that depend on unchang-
ing residue numbers for each solvent. Like the strip command, this modifies the current
state and changes the coordinates for subsequent actions. A restriction of this command
is that each of the solvent molecules must have the same number of atoms; this leads to
a fixed size “configuration” in each coordinate set output which is necessary for most of
the file formats and avoids really complicating the code.
Of course, say you have two solvents of differing sizes and you want to perform closest
for each of these, this can be done sequentially. For example, if we have both ethanol
“:ETH” and water “:WAT” solvent residues present in the system and you want to save
the closest 50 solvent molecules of each to residues :1-20, then the following commands
could be applied (noting that both closestwater and closest are recognized as the same
command):
solvent byres :WAT
closestwater 50 :1-20 first
solvent byres :ETH
closestwater 50 :1-20 first
Note that to further process the output coordinates later with ptraj or other programs,
you will need to generate a corresponding prmtop, PDB or PSF file. We have used this
command in practice to save only a small number of close waters or ions to nucleic acids
for explicit representation of these waters or ions in MM-PBSA calculations; see for
example J. Amer. Chem. Soc. 125, 1759-1769 (2003) for use with water around drugs in
the minor groove of DNA and Biophys. J. 85, 1787-1804 (2003) for use with ions around
DNA quadruplexes.
cluster out filename [ representative format ] [ average format ] [ all format ] algorithm
[ clusters n | epsilon critical_distance ]\
[ rms| dme ] [ sieve s [ start start_frame | random ]] [ verbose verb ] [ mass ] mask
Clustering refers to grouping together similar objects. In the context of ptraj, this means
grouping together coordinate frames from the trajectory into distinct sets. Several
different algorithms for clustering have been implemented. The most common similarity
metric is RMSd (specified by the rms keyword). Distance matrix error is also a potential
similarity metric (with keyword dme), however this is considerably more
computationally demanding. It is now also possible to cluster by attribute, i.e., the
values of time series measured, and will be discussed later. The ideas used here are
discussed in considerable detail in Ref. [93], and users should consult that paper for
background and details. A simple example is as follows:

113
6 ptraj

trajin [Link]
trajin [Link]
cluster out testcluster representative pdb \
average pdb average-linkage clusters 5 rms @CA
The above reads in two trajectory files and then clusters using the average-likjage algo-
rithm to produce 5 clusters using the pairwise RMSd between frames as a metric com-
paring the atoms named CA. PDB files are dumped for the average and representative
structures from the clusters and full trajectories (over ALL atoms) are dumped in AM-
BER format. If you only want to output only the CA atoms, the strip command could be
applied prior. The files output will be prefixed with “testcluster”.
Output information will be dumped to a series of files prefixed with filename. [Link]
contains the clustering results and statistics. “[Link]” contains the representative
structure of cluster i with its specified format (i = 0 to n – 1). “[Link]” contains
the average structure of cluster i with its specified format. “[Link]” contains all the
frames in the cluster i-1 with specified format. Available formats include “none”, “pdb”,
“rest”, “binpos”, or “amber”. The default format is the “amber” trajectory.
Algorithms implemented in the ptraj include averagelinkage, linkage, complete, edge,
centripetal, centripetalcomplete, hierarchical, means, SOM, COBWEB, and Bayesian.
Please see Ref. [93] for more details on the advantages and disadvantages of each algo-
rithm. For averagelinkage, linkage, complete, edge, centripetal, centripetalcomplete,
and hierarchical, the user can specify a critical distance so that the clustering will stop
when this distance is met. All algorithms will try to generate n clusters. However, some-
times SOM and Bayesian algorithms will generate less than n clusters and this may indi-
cate a more reasonable number of clusters of the trajectory.
The distance metric can be rms or dme (distance matrix error). Users are encouraged to
use rms since dme is significantly more computationally demanding yet returns similar
results. rms is the default value. The keyword mass indicates the rms or dme matrix will
be mass-weighted. The users are advised to always turn this “mass” option on. Mask is
the atom selection where the clustering method is focused.
The sieve keyword is useful when dealing with large trajectories. The command “sieve
s” tells ptraj to cluster every sth frame in the first pass. The default sieve size is 0 (equiv-
alent to sieve 1). The user can state where the first frame will be picked for the first pass
by specifying the parameter start_frame. The default value of start_frame is 1. To
avoid the potential problem of periodicity, frames can be picked randomly if the keyword
“random” is specified. Since the coordinates of unsampled frames are not saved during
the process, the DBI and pSF values can not be calculated for the whole trajectory, al-
though those values for the first pass will be saved in a file called “[Link]”. The
DBI and pSF values for a sieving algorithm can be calculated later by running the ptraj
clustering again, using “DBI” as the algorithm. This will read the clustering result from
the “[Link]” and appended the DBI and pSF values to the file “[Link]”.
The cluster facility will calculate a pairwise distance matrix between each pair of frames
and save the matrix in a file called “PairwiseDistances”. This file will be read in (and
checked) for clustering if it is found in the current directory. Although not all algorithms

114
6.5 ptraj action commands - detailed discussion

require this distance matrix, this matrix will be helpful for the calculation of DBI and pSF
in the post-clustering process. In the case of sieving, the file “PairwiseDistance” will be
generated for just those sampled frames in the first pass. A user provided “FullPairwise-
Matrix” containing a full pairwise matrix would further expedite the calculation of DBI
and pSF.
For the COBWEB algorithm, a special file “[Link]” will be saved for
the COBWEB tree structures. The first level of branches usually indicates the natural
clustering. Use “clusters -1” (minus one) will achieve this natural clustering. If the
specified number of clusters, n, is not equal to its natural number of clusters, branches
will be merged or split. COBWEB will read a pre-written [Link] if it
found in the current directory. Another special parameter for COBWEB is [acuity acu].
Acuity is set to be the minimal standard deviation of a cluster attribute. The default value
of acuity is 0.1.
For the agglomerative algorithms, specifically averagelinkage, linkage, complete, edge,
centripetal, and centripetalcomplete, every merging step will be saved in the file “Clus-
[Link]”. This file can be read in to generate other number of clusters by using
“ReadMerge” as the cluster algorithm in the ptraj command. For each line, the first field
is the newly formed cluster, which is followed by the two fields representing the sub-
clusters. The fourth field is the current critical distance, which is followed by (the DBI
and) pSF values. The DBI values are omitted if the number of clusters is greater than 50
because the time to calculate DBI is intractable as cluster number increases. Obviously,
this will not yield less clusters (i.e. more merging steps) than the clustering when the
[Link] file is generated. Therefore, the users can use “clusters 1” at first for
these algorithms, and then generate other number of clusters by ReadMerge.
Some parameters are designed for specific algorithms. The [iteration iter] parameter
is used in the means algorithm which specifies the maximum iteration for the refinement
steps. The default value of iteration is 100. There is a variation of means algorithm,
decoy. The “decoy” method allows the users to provide seed structures for the means
algorithm. Use “decoy decoy_structure” as the algorithm to provide the initial structures
in a trajectory file “decoy_structure”. If the users want the real decoy by providing the
well-defined structures, “iteration 1” can be used to prevent subsequent refinement.

contacts [ first|reference ] [ byresidue ] [ out filename ] [ time interval ] [ distance


cutoff ] [ mask ]
For each atom given in mask, calculate the number of other atoms (contacts) within the
distance cutoff. The default cutoff is 7.0 A. Only atoms in mask are potential interaction
partners (e.g., a mask @CA will evaluate only contacts between CA atoms). The results
are dumped to filename if the keyword “out” is specified. Thereby, the time between
snapshots is taken to be interval. In addition to the number of overall contacts, the number
of native contacts is also determined. Native contacts are those that have been found
either in the first snapshot of the trajectory (if the keyword “first” is specified) or in
a reference structure (if the keyword “reference” is specified). Finally, if the keyword
“byresidue” is provided, results are output on a per-residue basis for each snapshot,
whereby the number of native contacts is written to [Link] .

115
6 ptraj

dihedral name mask1 mask2 mask3 mask4 [ out filename ] [ time value ] [ type tag-name ]
Calculate the dihedral angle for the four atoms listed in mask1 through mask4 (represent-
ing rotation about the bond from mask2 to mask3). If more than one atom is listed in
each mask, treat the position of that atom as the center of mass of the atoms in the mask.
The results are saved internally with the name name (which must be unique) and the data
is stored on the scalarStack for later processing with the analyze command. Data will
be dumped to a file named filename if “out” is specified. All the angles are specified in
degrees, and the file will contain two columns: specifically, the frame number (multiplied
by the optional value specified with the time keyword) in the first column and the angle
in the second.
See the command analyze statistics all to print averages and standard deviations.
Note that there are some special types that can be specified to output summary
information for particular angles; at present this is limited to nucleic acid angles (alpha,
beta, gamma, delta, epsilon, zeta). Two examples are provided below. This first
calculates the dihedral values for residue 1 @CA,C,N and residue 2 @CA with data
stored internally referenced by the name “d1”. The second calculates the dihedral
between the center of mass of residues 1, 2, 3, and 4 respectively, stores the data
internally with reference “d2”, output to a file named “[Link]” with the frame number
column multiplied by 10.
dihedral d1 :1@CA :1@C :1@N :2@CA
dihedral d2 :1 :2 :3 :4 out [Link] time 10.0

dihedralcluster out filename cut clustersize_cutoff framefile filename clusterinfo file-


name\
[dihedralfile filename] | [phibins bins psibins bins mask]
Cluster frames in a trajectory using dihedral angles. To define which dihedral angles
will be used for clustering either an atom mask or an input file specified by the
dihedralfile keyword should be used. If dihedralfile is used, each line in the file should
contain a dihedral to be binned with format:
ATOM#1 ATOM#2 ATOM#3 ATOM#4 #BINS
where the ATOM arguments are the atom numbers defining the dihedral and #BINS is the
number of bins to be used (so if #BINS=10 the width of each bin will be 36º. If an atom
mask is specified, only protein backbone dihedrals (Phi and Psi defined using atom names
C-N-CA-C and N-CA-C-N) within the mask will be used, with the bin sizes specified by
the phibins and psibins keywords (default for each is 10 bins).
Output will either be written to the terminal or the file specified by the out keyword.
First information about which dihedrals were clustered will be printed. Then the number
of clusters will be printed, followed by detailed information of each cluster. The clusters
are sorted from most populated to least populated. Each cluster line has format

Cluster CLUSTERNUM CLUSTERPOP [ dihedral1bin, dihedral2bin ... dihedralNbin ]


followed by a list of frame numbers that belong to that cluster.

116
6.5 ptraj action commands - detailed discussion

If specified by the framefile keyword a file containing cluster information for each frame
will be written with format
Frame CLUSTERNUM CLUSTERSIZE DIHEDRALBINID
where DIHEDRALBINID is a number that identifies the unique combination of dihe-
dral bins this cluster belongs to (specifically it is a 3*number-of-dihedral-characters long
number composed of the individual dihedral bins).
If specified by the clusterinfo keyword a file containing information on each dihedral
and each cluster will be printed. This file can be read by SANDER for use with REMD
with a structure reservoir (-rremd=3). The file, which is essentially a simplified version
of the main output file, has the following format:
#DIHEDRALS
dihedral1_atom1 dihedral1_atom2 dihedral1_atom3 dihedral1_atom4
...
#CLUSTERS
CLUSTERNUM1 CLUSTERSIZE1 DIHEDRALBINID1
...
If a cutoff is specified by CUT only clusters with population greater than CUT will be
printed.

diffusion mask time_per_frame [ average ] [ filenameroot ]


Compute a mean square displacement plot for the atoms in the mask. The time between
frames in picoseconds is specified by time_per_frame. If "average" is specified, then
the average mean square displacement is calculated and dumped (only). If "average" is
not specified, then the average and individual mean squared displacements are dumped.
They are all dumped to a file in the format appropriate for xmgr (dumped in multicolumn
format if necessary, i.e. use xmgr -nxy). The units are displacements (in angstroms**2)
vs time (in ps). The filenameroot is used as the root of the filename to be dumped. The
average mean square displacements are dumped to "filenameroot_r.xmgr", the x, y and z
mean square displacements to "filenameroot_x.xmgr", etc and the total distance traveled
to "filenameroot_a.xmgr".
This will fail if a coordinate moves more than 1/2 the box in a single step. Also, this
command implicitly unfolds the trajectory (in periodic boundary simulations) hence will
currently only work with orthorhombic unit cells.
Note: this documentation is out of date.

dipole filename nx x_spacing ny y_spacing nz z_spacing mask1 origin | box [ max max_percent]
Same as grid (see below) except that dipoles of the solvent molecules are binned. Dump-
ing is to a grid in a format for Chris Bayly’s discern delegate program that comes with
Midas/Plus. Consult the code in actions.c, transformDipole() for more information and
note that this command is potentially obsolete.

distance name mask1 mask2 [ out filename ] [ noimage ] [ time interval ]

117
6 ptraj

This command will calculate a distance between the center of mass of the atoms in mask1
to the center of mass of the atoms in mask2 and store this information into an array
with name as the identifier (a name which must be unique and which is placed on the
scalarStack for later processing) for each frame in the trajectory. If the optional key-
word “out” is specified, then the data is dumped to a file named filename. The distance
is implicitly imaged (for both orthorhombic and non-orthorhombic unit cells) and the
shortest imaged distance will be saved (unless the “noimage” keyword is specified; this
is considerably faster, however imaging of the distance will not be performed).

grid filename nx x_spacing ny y_spacing nz z_spacing mask1 [ origin | box ] [ negative ] [


max fraction ]
Create a grid representing the histogram of atoms in mask1 on the 3D grid that is "nx
* x_spacing by ny * y_spacing by nz * z_spacing angstroms (cubed). Either “origin”
or “box” can be specified and this states whether the grid is centered on the origin or
half box. Note that to provide any meaningful representation of the density, the solute
of interest (about which the atomic densities are binned) should be rms fit, centered and
imaged prior to the grid call. If the optional keyword “negative” is also specified, then
these density will be stored as negative numbers. Output is in the format of a XPLOR
formatted contour file (which can be visualized by the density delegate to Midas/Plus
or Chimera or VMD or other programs). Upon dumping the file, pseudo-pdb HETATM
records are also dumped to standard out which have the most probable grid entries (those
that are 80% of the maximum by default which can be changed with the max keyword,
i.e. max .5 makes the dumping at 50% of the maximum).
Note that as currently implemented, since the XPLOR grids are integer based, the grid is
offset from the origin (towards the negative size) by half the grid spacing.

image [ origin ] [ center ] mask [ bymol | byres | byatom | bymask ] mask [ triclinic
| familiar [ com mask ] ]
Under periodic boundary conditions, which particular unit cell a given molecule is in
does not matter as long as, as a whole, all the molecules "image" into a single unit cell. In
an MD simulation, molecules drift over time and may span multiple periodic cells unless
"imaging" is enabled to shift molecules that leave back into the primary unit cell. In
sander, the IWRAP variable controls this, with IWRAP=1 implying turning on imaging.
This command, image allows post-processing of the imaging to force all the molecules
into the primary unit cell.
If the optional argument “origin” is specified, then imaging will occur to place the box
center at the coordinate origin (0.0, 0.0, 0.0) rather than the center of the box (as is the
Amber standard). By default all atoms are imaged by molecule based on the position of
the first atom (or the center of mass of the molecule if "center" is specified; the latter is
recommended). If the mask is specified, only the atoms in the mask will be imaged. It is
now possible to image by atom (byatom), by residue (byres), by molecule (bymol,
default) or by atom mask (where all the atoms in the mask are treated as belonging to a
single molecule). The behavior of the "by molecule" imaging is different in CHARMM
and Amber; with Amber the molecules are specified directly by the periodic box

118
6.5 ptraj action commands - detailed discussion

information whereas with the CHARMM parameter/topology, each segid is treated as a


different molecule. With this newer implementation of the imaging code, it is possible to
avoid breaking up double stranded DNA during imaging, i.e.:
image :1-20 bymask :1-20
image byres :WAT

[Of course this assumes that the coordinates of the two strands were not displaced during
the dynamics as well!] Imaging only makes sense if there is periodic box information
present.
Non-orthorhombic unit cells are supported. Use of the triclinic imaging can be forced
with the “triclinic” keyword. Note that this puts the box into the triclinic shape, not
the more familiar, more spherical shapes one might expect for some of the unit cells (i.e.
truncated octahedron). To get into the more familiar shape, specify the “familiar” key-
word. In this case, to specify atoms that imaged molecules should be closest to, specify
a center of the atoms in the mask specified with the “com” keyword. Note that imag-
ing “familiar” is more time consuming (but recommended) since each of the possible
imaged distances (27) are checked to see which is closest to the center.
The recommended usage is “image origin center familiar”.

principal mask [ dorotation ] [ mass ]


Principal axis transformation to align the atoms specified in mask. This is reasonably
functional as there are still issues with degenerate eigenvalues and unwanted coordinate
swapping. To align whole system along the principal axes specify “dorotation”.

pucker name mask1 mask2 mask3 mask4 mask5 [ out filename ] [ amplitude ] [ altona |
cremer ] [ offset offset ] [ time interval ]

Calculate the pucker for the five atoms specified in each of the mask’s, mask1 through
mask5, associating name (which must be unique) with the calculated values. If more than
one atom is specified in a given mask, the center of mass of all the atoms in that mask
is used to define the position. If the “out” keyword is specified the data is dumped to
filename. If the keyword “amplitude” is present, the amplitudes are saved rather than
the pseudorotation values. If the keyword “altona” is listed, use the Altona & Sun-
darlingam conventions/algorithm (for nucleic acids) (the default) [see Altona & Sundar-
alingam, JACS 94, 8205-8212 (1972) or Harvey & Prabhakaran, JACS 108, 6128-6136
(1986).] In this convention, both the pseudorotation phase and amplitude are in degrees.
If “cremer” is specified, use the Cremer & Pople conventions/algorithm [see Cremer &
Pople, JACS 97:6, 1354-1358 (1975).]
Note that to calculate nucleic acid puckers, specify C1’ first, followed by C2’, C3’, C4’
and finally O4’. Also note that the Cremer & Pople convention is offset from the Al-
tona & Sundarlingam convention (with nucleic acids) by 90.0; to add in an extra 90.0 to
“cremer” (offset -90.0) or subtract 90.0 from the “altona” (offset 90.0) specify an off-
set with the offset keyword; this value is subtracted from the calculated pseudorotation
value (or amplitude).

119
6 ptraj

radial root-filename spacing maximum solvent-mask [ solute-mask ] [ closest ] [ density


value ] [ noimage ]
Compute radial distribution functions and store the results into files with root-filename as
the root of the filename. Three files are currently produced, "root-filename_carnal.xmgr"
(which corresponds to a carnal style RDF), "root-filename_standard.xmgr" (which uses
the more traditional RDF with a density input by the user) and "root-filename_volume.xmgr"
(which uses the more traditional RDF and the average volume of the system). The total
number of bins for the histogram is determined by the spacing between bins (spacing)
and the range which runs from zero to maximum. If only a solvent-mask is listed (i.e. a
list of atoms) then the RDF will be calculated for the interaction of every solute-mask
atom with ALL the other solute-mask atoms.
If the optional solute-mask is specified, then the RDF will represent the interaction of
each solute-mask atom with ALL of the solvent-mask atoms. If the optional keyword
“closest” is specified, then the histogram will bin, over all the solvent-mask atoms,
the distance of the closest atom in the solute mask. If the solute-mask and solvent-
mask atoms are not mutually exclusive, zero distances will be binned (although this
should not break the code). If the optional keyword “density”, followed by the den-
sity value is specified, this will be used in the calculations. The default value is 0.033456
molecules/angstrom**3 which corresponds to a density of water equal to ~1.0 g/mL. To
convert a standard density in g/mL, multiply the density by "6.022 / (10 * weight)" where
"weight" is the mass of the molecule in atomic mass units. This will only effect the
"root-filename_standard.xmgr" file.
Note that although imaging of distances is performed (to find the shortest imaged distance
unless the “noimage” keyword is specified), minimum image conventions are applied.
Also note that when LES prmtop and trajectories is processed, the interaction between
atoms from different copy is ignored, which allows users to get the right RDF, but users
may still need to adjust the density to get the right answer.

radgyr [ out filename ] [ time interval ] [mask]


Calculate the radius of gyration and the maximal distance of an atom from the center of
geometry considering atoms in mask. The results are dumped to filename if the keyword
“out” is specified. Thereby, the time between snapshots is taken to be interval.

randomizeions mask [ around mask by distance ] [ overlap value ] [ noimage ] [ seed value
]
This can be used to randomly swap the positions of solvent and single atom ions. The
“overlap” specifies the minimum distance between ions, and the “around” keyword
can be used to specify a solute (or set of atoms) around which the ions can get no closer
than the distance specified. The optional keywords “noimage” disable imaging and
“seed” update the random number seed. An example usage is
randomizeions @Na+ around :1-20 by 5.0 overlap 3.0
The above will swap Na+ ions with water getting no closer than 5.0 angstroms from
residues 1-20 and no closer than 3.0 angstroms from any other Na+ ion.

120
6.5 ptraj action commands - detailed discussion

rms mode [ mass ] [ out filename ] [ time interval ] mask [ name name ] [ nofit ]
This will RMS fit all the atoms in the mask based on the current mode which is
previous: fit to previous frame
first: fit to the "start" frame of the first trajectory specified.
reference: fit to a reference structure (which must have been previously read in)
If the keyword “mass” is specified, then a mass-weighted RMSd will be performed. If
the keyword “out” is specified (followed immediately by a filename), the RMSd values
will be dumped to a file. If you want to specify an time interval between frames (used
only when dumping the RMSd vs time), this can be done with the “time” keyword. To
save the calculated values for later processing, associate a name with the “name” keyword
(where the chosen name must be unique and the data will be stored on the scalarStack
for later processing with the analyze command). If the keyword “nofit” is specified,
then the coordinates are not modified, just the RMSd values are calculated (and stored or
output if the name or out keywords were specified).

secstruct [ out filename ] [ time interval ] [ mask ]


Calculate the secondary structure information for residues of atoms contained in mask,
following the DSSP method by Kabsch & Sander.[94] The mask is primarily intended
to strip water molecules etc. Not providing contiguous protein sequences may result
in erroneous secondary structure assignments (even at residues that are included in the
mask!). The results are dumped to filename if the keyword “out” is specified. Thereby,
the time between snapshots is taken to be interval. For every snapshot and every residue,
an alpha-helix is indicated by "H", a 3-10-helix by "G", a pi-helix by "I", a parallel beta-
sheet by "b", and an antiparallel beta-sheet by "B". A summary providing the percentage
for each residue to adopt one of the above secondary structure types over the course of
the analyzed snapshots is given in [Link].

strip mask
Strip all atoms matching the atoms in mask. This changes the state of the system such that
all commands (actions) following the strip (including output of the coordinates which is
done last) are performed on the stripped coordinates (i.e., if you strip all the waters and
then on a later action try to do something with the waters, you will have trouble since
the waters are gone). Stripping is beneficial, beyond simply paring down a trajectory,
for data intensive commands that read entire sections of a trajectory into memory; with
stripping to retain only selected atoms, it is much less likely that the available memory
will be exceeded.

translate mask [ x x-value ] [ y y-value ] [ z z-value ]


Move the coordinates for the atoms in the mask in each direction by the offset(s) in
Angstroms specified.

truncoct mask distance [ prmtop filename ]


Note: This command is largely obsolete.

121
6 ptraj

Create a truncated octahedron box with solvent stripped to a distance distance away from
the atoms in the mask. Coordinates are output to the trajectory specified with the trajout
command. Note that this is a special command and will only really make sense if a single
coordinate set is processed (i.e. any prmtop written out will only correspond to the first
configuration!) and commands after the truncoct will have undefined behavior since the
state will not be consistent with the modified coordinates. It is intended only as an aid for
creating truncated octahedron restrt files for running in Amber.
The “prmtop” keyword can be used to specify the writing of a new prmtop (to a file
named filename; this prmtop is only consistent with the first set of coordinates written.
Moreover, this command will only work with Amber prmtop files and assumes an Amber
prmtop file has previously been read in (rather than a CHARMM PSF). This command
also assumes that all the solvent is located contiguously at the end of the file and that the
solvent information has previously been set (see the solvent command).

watershell mask filename [ lower lower upper upper ] [solvent-mask] [ noimage ]


This option will count the number of waters within a certain distance of the atoms in the
mask in order to represent the first and second solvation shells. The output is a file into
filename which has, on each line, the frame number, number of waters in the first shell and
number of waters in the second shell. If lower is specified, this represents the distance
from the mask which represents the first solvation shell; if this is absent 3.4 angstroms is
assumed. Likewise, upper represents the range of the second solvation shell and if absent
is assumed to be 5.0 angstroms. The optional solvent-mask can be used to consider other
atoms as the solvent; the default is “:WAT”. Imaging on the distances is done implicitly
unless the “noimage” keyword has been specified.

6.6 Correlation and fluctuation facility


The ptraj program now contains several related sets of commands to analyze correlations and
fluctuations, both from trajectories and from normal modes. These items replace the correlation
command in previous versions of ptraj, and also replace what used to be done in the nmanal
program. Some examples of command sequences are given at the end of this section.

vector name mask [ principal [ x|y|z ] | dipole | box | corrplane | ired mask2 | corr
mask2 | corrired mask2]\
[ out filename ] [ order order ] [ modes modesfile ] [ beg beg ] [ end end ] [ npair
npair ]
This command will keep track of a vector value (and its origin) over the trajectory; the
data can be referenced for later use based on the name (which must be unique among the
vector specifications). "Ired" vectors, however, may only be used in connection with the
command "matrix ired". If the optional keyword "out" is specified (not valid for "ired"
vectors), the data will be dumped to the file named filename. The format is frame number,
followed by the value of the vector, the reference point, and the reference point plus the
vector. What kind of vector is stored depends on the keyword chosen.

122
6.6 Correlation and fluctuation facility

principal: [x | y | z]: store one of the principal axis vectors determined by diagonaliza-
tion of the inertial matrix from the coordinates of the atoms specified by the mask.
If none of x or y or z are specified, then the principal axis (i.e. the eigenvector
associated with the largest eigenvalue) is stored. The eigenvector with the largest
eigenvalue is “x” (i.e. the hardest axis to rotate around) and the eigenvector with the
smallest eigenvalue is “z” and if one of x or y or z are specified, that eigenvector
will be dumped. The reference point for the vector is the center of mass of the mask
atoms.
dipole: store the dipole and center of mass of the atoms specified in the mask. The vector
is not converted to appropriate units, nor is the value well-defined if the atoms in
the mask are not overall charge neutral.
box: store the box coordinates of the trajectory. The reference point is the origin or (0.0,
0.0, 0.0).
ired mask2: This defines ired vectors necessary to compute an ired matrix (see matrix
command). The vectors must be defined prior to the matrix command.
corrplane: This defines a vector perpendicular to the (least-squares best) plane through
a series of atoms given in mask, for which a time correlation function can be calcu-
lated subsequently with the command “analyze timecorr ...”. order specifies the
order of the Legendre polynomial used (0 <= order <= 2). It defaults to 2.
corr mask2: This defines a vector between the center of mass of mask and the one of
mask2, for which a time correlation function can be calculated subsequently with
the command “analyze timecorr ...”. order specifies the order of the Legendre
polynomial used (0 <= order <= 2). It defaults to 2.
corrired mask2: This defines a vector between the center of mass of mask and the one
of mask2, for which a time correlation function according to the Isotropic Reori-
entational Eigenmode Dynamics (ired) approach [95] can be calculated. order
specifies the order of the Legendre polynomial used (0 <= order <= 2). It de-
faults to 2. To calculate this vector, ired modes need to be provided by modesfile.
They can be calculated by the commands “matrix ired ...”, followed by “analyze
matrix ...”. Only modes <beg> to <end> are considered. Default is beg = 1, end
= 50. To obtain meaningful results, it is important that the vector definition agrees
with the one used for calculation of the ired matrix (there is no internal check for
this). Along these lines, npair needs to be specified, which relates to the position of
this definition in the sequence of ired (not corrired!) vectors used to obtain the ired
matrix.

matrix dist | covar | mwcovar | distcovar | correl | idea | ired [ name name ] [ order
order ] [mask1] [mask2]\
[ out filename ] [ start start ] [ stop stop ] [ offset offset ] [ byatom | byres |
bymask ]
Compute distance (distance), covariance (covar), mass-weighted covariance (mwcovar),
correlation (correl), distance-covariance (distcovar), Isotropically Distributed En-
semble Analysis (idea),[96] or Isotropic Reorientational Eigenmode Dynamics (ired)

123
6 ptraj

[95] matrices. Results are output to filename if given. Be aware, matrix dimension will
be of the order of N x M for dist, correl, idea, and ired, 3N x 3M for covar and mwcovar,
and N(N-1) x N(N-1) / 4 for distcovar (with N being the number of atoms in mask1 and
M being the number of atoms either in mask1 or mask2).
“byatom” dumps the results by atom (default). This is the sole option for covar, mwcovar,
distcovar, idea, and ired. In the case of dist or correl, “byres” calculates an av-
erage for each residue and “bymask” dumps the average over all atoms in the mask(s).
With “mass”, mass-weighted averages will be computed.
In the case of ired, mask information must not be given. Instead, “ired vectors” need
to be defined prior to the matrix command by using the vector command. Otherwise,
if no mask is given, all atoms against all are used. If only mask1 is given, a symmetric
matrix is computed. In the case of distcovar and idea, only mask1 (or none) may be
given. In the case of distcovar, mwcovar, and correl, if mask1 and mask2 is given, on
output mask1 atoms are listed column-wise while mask2 atoms are listed row-wise. The
number of atoms covered by mask1 must be >= the number of atoms covered by mask2
(this is also checked in the function).
The matrix may be stored internally on the matrixStack with the name name for latter
processing (with the “analyze matrix” command). Since at the moment this only in-
volves diagonalization, storing is only available for (symmetric) matrices generated with
mask1 (or no mask or ired matrices).
The start, stop, and offset parameters can be used to specify the range of coordinates
processed (as a subset of all of those read in across all input files).
The order parameter chooses the order of the Legendre polynomial used to calculate the
ired matrix.

analyze matrix matrixname [out filename] [ thermo | order ] [ vecs vecs ] [ reduce ] [
orderparamfile orderparamfilename ]
Diagonalizes the matrix matrixname, which has been generated and stored before by
the matrix command. This is followed by Principal Component Analysis (in cartesian
coordinate space in the case of a covariance matrix or in distance space in the case of a
distance-covariance matrix), or Quasiharmonic Analysis (in the case of a mass-weighted
covariance matrix). Diagonalization of distance, correlation, idea, and ired matrices are
also possible. Eigenvalues are given in cm−1 in the case of a mass-weighted covariance
matrix and in the units of the matrix elements in all other cases. In the case of a mass-
weighted covariance matrix, the eigenvectors are mass-weighted.
Results [average coordinates (in the case of covar, mwcovar, correl), average distances
(in the case of distcovar), main diagonal elements (in the case of idea and ired), eigen-
values, eigenvectors] are output to filename. vecs determines, how many eigenvectors
and eigenvalues are calculated. The value must be >= 1, except if the “thermo” flag is
given (see below). In that case, setting vecs = 0 results in calculating all eigenvalues, but
no eigenvectors. This option is mainly intended for saving memory in the case of ther-
modynamic calculations. “reduce” (only possible for covar, mwcovar, and distcovar)
results in reduced eigenvectors [Abseher & Nilges, J. Mol. Biol. 279, 911, (1998)]. They

124
6.6 Correlation and fluctuation facility

may be used to compare results from PCA in distance space with those from PCA in
cartesian-coordinate space.
“thermo” calculates entropy, heat capacity, and internal energy from the structure of a
molecule (average coordinates, see above) and its vibrational frequencies using standard
statistical mechanical formulas for an ideal gas. This option is only available for mwcovar
matrices.
“order” calculates order parameters based on eigenvalues and eigenvectors with the
isotropic reorientational eigenmode dynamics (iRED) approach [Prompers & Brüschweiler,
J. Am. Chem. Soc. 124, 4522, (2002)] and outputs them to standard output. This option
is only available for ired matrices.
If orderparamfile is specified, the ired order parameters will be written to orderparam-
filename instead of standard output.

analyze modes fluct| displ | corr stack stackname | file filename [ beg beg ] [ end end
]\
[ bose ] [ factor factor ] [ out outfile ] [ maskp mask1 mask2 [...] ]
Calculates rms fluctuations (“fluct”), displacements of cartesian coordinates along mode
directions (“displ”), or dipole-dipole correlation functions (“corr”) for modes obtained
from principal component analyses (of covariance matrices) or quasiharmonic analyses
(of mass-weighted covariance matrices). Thus, a possible series of commands would be
“matrix covar | mwcovar ...” to generate the matrix, “analyze matrix ...” to calculate
the modes, and, finally, “analyze modes ...”.
Modes can be taken either from an internal stack, identified by their name on the stack,
stackname, or can be read from a file filename. Only modes beg to end are considered.
Default for beg is 7 (which skips the first 6 zero-frequency modes in the case of a normal
mode analysis); for end it is 50. If “bose” is given, quantum (Bose) statistics is used
in populating the modes. By default, classical (Boltzmann) statistics is used. factor is
used as multiplicative constant on the amplitude of displacement. Default is factor = 1.
Results are written to outfile, if specified, otherwise to stdout. In the case of “corr”, pairs
of atom masks (mask1, mask2; each pair preceded by “maskp” and each mask defining
only a single atom) have to be given that specify the atoms for which the correlation
functions are desired.

analyze timecorr vec1 vecname1 vec2 vecname2 [ relax ] [ NHdist nhdistance ] [ freq MHz
] [ tstep tstep ] [ tcorr tcorr ]\
[ drct ] [ dplr ] [ norm ] out filename [ noefile noefilename ]
Calculates time correlation functions for vectors vecname1 (vecname2) of type “corr”
or “corrired”, using a fast Fourier method. If two different vectors are specified for
“vec1” and “vec2”, a cross-correlation function is calculated; if the two vectors are the
same, the result is an autocorrelation function. If the drct keyword is given, a direct
approach is used instead of the FFT approach. Note that this is less efficient than the FFT
route. If dplr is given, in addition to the Pl correlation function, also correlation func-
tions Cl ≡< Pl /(r(0)3 r(τ)3 ) > and < 1/(r(0)3 r(τ)3 ) > are output. If norm is given, all

125
6 ptraj

correlation functions are normalized, i.e. Cl (t = 0) = Pl (t = 0) = 1.0. Results are writ-


ten to filename. tstep specifies the time between snapshots (default: 1.0), and tcorr
denotes the maximum time for which the correlations functions are to be computed (de-
fault: 10000.0).
relax can only be used when the vectors are of type “corrired” and when they rep-
resent an N-H bond. If relax is given, correlation times τm for each eigenmode and
relaxation rates and NOEs for each N-H vector will be calculated following the iRED
approach [Prompers & Brüschweiler, J. Am. Chem. Soc. 124, 4522, (2002)]. NHdist
and freq are only considered if relax is given. NHdist specifies the length of the NH
bond in Angstroms (default is 1.02). It is mandatory for the user to set freq, which is
the Lamor frequency of the measurement. Autocorrelation functions for each mode and
the corresponding correlation time τm will be written to [Link]. Autocorrelation
functions for each vector will be written to [Link]. Relaxation rates and NOEs for
each N-H vector will be added to the the end of the standard output. For the calculation
of τm the normalized correlation functions and only the first third of the analyzed time
steps will be used. For further information on the convergence of correlation functions
see [Schneider, Brünger, Nilges, J. Mol. Biol. 285, 727 (1999)].
If noefile is specified, the NOEs and relaxation rates will be written to noefilename
instead of standard output.

projection modes modesfile out outfile [ beg beg ] [ end end ] [ mask ] [ start start ] [ stop
stop ] [ offset offset ]
Projects snapshots onto modes obtained by diagonalizing covariance or mass-weighted
covariance matrices. The modes are read from modesfile. The results are written to
outfile. Only modes beg to end are considered. Default values are beg = 1, end = 2. mask
specifies the atoms that will be projected. The user has to make sure that these atoms
agree with the ones used to calculate the modes (i.e., if mask1 = @CA was used in the
“matrix” command, mask = @CA needs to be set here as well). The start, stop, and offset
parameters can be used to specify the range of coordinates processed (as a subset of all
of those read in across all input files).

6.7 Parallel ptraj


Ptraj has been modified to include parallel support using MPI. To take advantage of this
feature, run the configure script with the -mpi flag (e.g. configure -mpi gnu), then run make
with the parallel command (e.g. make -f Makefile_at parallel). This will produce an executable
in the $AMBERHOME/bin/ directory called [Link]. Note that currently [Link] only
performs well if run on a local disk (i.e. on a single multi-processor machine). Running on
network file systems such as NFS actually cause the performance of [Link] to be worse than
ptraj due to the generally poor performance of these file systems in parallel.
The same ptraj source files are used to build ptraj in both serial and parallel, using prepro-
cessor definitions where needed. There is no change to the syntax of the ptraj commands, so
previous ptraj command scripts should work and produce the same output. Currently not all

126
6.8 Examples

actions are supported; a list of the ones that currently run in parallel is included below. Com-
mands given to parallel ptraj which are not in the list below will be ignored by the program
(after a warning message is printed).
A large change to both the parallel and serial versions of ptraj is in the way AMBER trajectory
files are read in. In the old version, the whole file would be read in and checked for errors first,
then read in a second time to perform the actions. On small trajectory files this was not a
problem, but for larger files this could take significantly more time. Now the file is checked
while the actions are being performed, which eliminates the need to read the whole file twice.
Secondly, the way in which the coordinates are read has been optimized speeding up the read
time. Finally, seeking is used with the trajectory file in order to skip past the frames that do not
need to be processed. Before these frames would be read in regardless.
For example, if a trajectory file contains 10,000 frames, and we are only interested in frames
2000 to 5000, skipping every other frame (offset of 2), the old ptraj would read in all frames
from 1 to 5000. The new ptraj will now seek to the 2000th frame, and then only read in every
other frame by seeking to the new file position. So instead of reading in 5000 frames, it will
read in 1500 ((5000 - 2000) / 2). Compressed files are one limitation to this because of the
way they are decompressed by the program. Thus compressed AMBER trajectory files have
the benefit of being smaller, but have the downside of additional time needed to decompress the
files, plus the inability to skip past unprocessed frames.

Supported Actions:

angle, atomicfluct, average, center, checkoverlap, closest, contacts,


dihedrals, distance, image, principal, pucker, radgyr, randomizeions,
rms, strip, translate, watershell

Known Issues:

• You cannot use the previous option with the rms action because frames are divided
among processors and do not have previous frame information.

• randomizeions does not produce the same output trajectory as the serial version, even
when using same seed, because frames are not analyzed in the same order.

• [Link] does not perform well on network file systems such as NFS due to underlying
issues with the file system - [Link] should be run on the local disk of a multi-processor
machine for optimal performance.

6.8 Examples
Please note that in most cases the trajectory needs to be aligned against a reference structure
to obtain meaningful results. Use the “rms” command for this.

127
6 ptraj

6.8.1 Calculating and analyzing matrices and modes


As a simple example, a distance matrix of all CA atoms is generated and output to
[Link].
matrix dist @CA out [Link]

In the following, a mass-weighted covariance matrix of all atoms is generated and stored
internally with the name mwcvmat (as well as output). Subsequently, the matrix is analyzed by
performing a quasiharmonic analysis, whereby 5 eigenvectors and eigenvalues are calculated
and output to [Link].
matrix mwcovar name mwcvmat out [Link]
analyze matrix mwcvmat out [Link] vecs 5

Alternatively, the eigenvectors can be stored internally and used for calculating rms
fluctuations or displacements of cartesian coordinates.
analyze matrix mwcvmat name evecs vecs 5
analyze modes fluct out [Link] stack evecs beg 1 end 3
analyze modes displ out [Link] stack evecs beg 1 end 3

Finally, dipole-dipole correlation functions for modes obtained from principle component
analysis or quasiharmonic analysis can be computed.
analyze modes corr out [Link] stack evecs beg 1 end 3 ...
... maskp @1 @2 maskp @3 @4 maskp @5 @6

6.8.2 Projecting snapshots onto modes


After calculating modes, snapshots can be projected onto these in an additional "sweep"
through the trajectory. Here, snapshots are projected onto modes 1 and 2 read from [Link]
(which have been obtained by the "matrix mwcovar", "analyze matrix" commands from
above).
projection modes [Link] out [Link] beg 1 end 2

6.8.3 Calculating time correlation functions


Vectors between atoms 5 and 6 as well as 7 and 8 are calculated below, for which auto and
cross time correlation functions are obtained.
vector v0 @5 corr @6 order 2
vector v1 @7 corr @8 order 2
analyze timecorr vec1 v0 tstep 1.0 tcorr 100.0 out [Link]
analyze timecorr vec1 v1 tstep 1.0 tcorr 100.0 out [Link]
analyze timecorr vec1 v0 vec2 v1 tstep 1.0 tcorr 100.0 out v0_v1.out

Similarly, a vector perpendicular to the plane through atoms 18, 19, and 20 is obtained and
further analyzed.

128
6.9 Hydrogen bonding facility

vector v2 @18,@19,@20 corrplane order 2


analyze timecorr vec1 v3 tstep 1.0 tcorr 100.0 out [Link]

For obtaining time correlation functions according to the ired approach, two "sweeps" through
the trajectory are necessary. First, ired vectors are defined and an ired matrix is calculated and
analyzed. Ired eigenvectors are output to [Link]. If the parameter order is specified, order
parameters based on ired are calculated.

vector v0 @5 ired @6
vector v1 @7 ired @8
...
vector v5 @15 ired @16
vector v6 @17 ired @18
matrix ired name matired order 2
analyze matrix matired vecs 6 out [Link] order

In a subsequent ptraj run, ired time correlation functions are calculated by projecting the
snapshots onto the ired eigenvectors (read from [Link]), which results in corrired vectors.
Then, time correlation functions are computed. By specifying the relax parameter, relaxation
rates and NOEs can be obtained for each N-H vector. Please note that it is important that the
corrired vector definition agrees with the one used for calculation of the ired matrix.

vector v0 @5 corrired @6 order 2 modes [Link] beg 1 end 6 npair 1


vector v1 @7 corrired @8 order 2 modes [Link] beg 1 end 6 npair 2
...
vector v5 @15 corrired @16 order 2 modes [Link] beg 1 end 6 npair 6
vector v6 @17 corrired @18 order 2 modes [Link] beg 1 end 6 npair 7
analyze timecorr vec1 v0 relax NHdist 1.02 freq 500.0 tstep 1.0 tcorr 100.0 out v0.o

6.9 Hydrogen bonding facility


The ptraj program now contains a generic facility for keeping track of lists of pair interac-
tions (subject to a distance and angle cutoff) useful for calculation hydrogen bonding or other
interactions. It is designed to be able to track the interactions between a list of hydrogen bond
"donors" and hydrogen bond "acceptors" that the user specifies.

donor resname atomname | mask mask | clear | print


This command sets the list of hydrogen bond donors. It can be specified repeatedly to
add to the list of potential donors. The usage is either as a pair of residue and atom
names or as a specified atom mask. The former usage,
donor ADE N7
would set all atoms named N7 in residues named ADE to be potential donors.
donor mask :10@N7

129
6 ptraj

would set the atom named N7 in residue 10 to be a potential donor.


The keyword “clear” will clear the list of donors specified so far and the keyword
“print” will print the list of donors set so far.
The acceptor command is similar except that both the heavy atom and the hydrogen
atom are specified. If the same atom is specified twice (as might be the case to probe ion
interactions) then no angle is calculated between the donor and acceptor.

acceptor resname atomname atomnameH | mask mask maskH | clear | print

The donor and acceptor commands do not actually keep track of distances but instead
simply set of the list of potential interactions. To actually keep track of the distances, the
hbond command needs to be specified:

hbond [ distance value ] [ angle value ] [ solventneighbor value ]\


[ solventdonor donor-spec ] [ solventacceptor acceptor-spec ]\
[ nosort ] [ time value ] [ print value ] [ series name ]
The optional “distance” keyword specifies the cutoff distance for the pair interactions
and the optional “angle” keyword specifies the angle cutoff for the hydrogen bond. The
default is no angle cutoff and a distance of 3.5 angstroms. To keep track of potential
hydrogen bond interactions where we don’t care which molecule of a given type is inter-
action as long as one is (such as with water), the solvent keywords can be specified. An
example would be keeping track of water or ions interacting with a particular donor or
acceptor. The maximum number of possible interactions per a given donor or acceptor is
specified with the “solventneighbor” keyword. The list of potential solvent donors/ac-
ceptors is specified with the solventdonor and solventacceptor keywords (with a
format the same as the donor/acceptor keywords above).
As an example, if we want to keep track of water interactions with our list of
donors/acceptors:

hbond distance 3.5 angle 120.0 solventneighbor 6 solventdonor WAT O \

solventacceptor WAT O H1 solventacceptor WAT O H2

If you wanted to keep track of interactions with Na+ ions (assuming the atom name was
Na+ and residue name was also Na+):

hbond distance 3.5 angle 0.0 solventneighbor 6 solventdonor Na+ Na+ \

solventacceptor Na+ Na+ Na+

To print out information related to the time series, such as maximum occupancy and
lifetimes, specify the “series” keyword.

130
6.10 rdparm

6.10 rdparm
rdparm requires an Amber prmtop file for operation and is menu driven. Rudimentary online
help is available with the "?" command. The basic commands are summarized here.

angles mask
Print all the angles in the file. If the mask is present, only print angles involving these
atoms. For example, angles :CYT@C? will print all angles involving atoms which have
2-letter names beginning with “C” from “CYT” residues.

atoms mask
Print all the atoms in the file. If the mask is present, only print these atoms.

bonds mask
Print all the bonds in the file. If the mask is present, only print bonds involving these
atoms.

checkcoords Amber-trajectory
Perform a rudimentary check of the coordinates from the filename specified. This is to
look for obvious problems (such as overflow) and to count the number of frames.

dihedrals mask
Print all the dihedrals in the file. If the mask is present, only print dihedrals involving one
of these atoms.

delete [ bond | angle | dihedral ] number


This command will delete a given bond, angle or dihedral angle based on the number
specified from the current prmtop. The number specified should match that shown by the
corresponding print command. Note that a new prmtop file is not actually saved. To do
this, use the writeparm command. For example, “delete bond 5” will delete with 5th
bond from the parameter/topology file.

openparm filename
Open up the prmtop file specified.

writeparm filename
Write a new prmtop file to filename based on the current (and perhaps modified) param-
eter/topology file. Note that this command is obsolete and writes old style prmtop files.

system string
Execute the command string on the system.

mardi2sander constraint-file
A rudimentary conversion of Mardigras style restraints to sander NMR restraint format.

131
6 ptraj

rms Amber-trajectory
Create a 2D RMSd plot in postscript or PlotMTV format using the trajectory specified.
The user will be prompted for information. This command is rather slow... Use 2Drms
in ptraj instead.
stripwater
This command will remove or add three point waters to a prmtop file that already has
water. The user will be prompted for information. This is useful to take an existing
prmtop and create another with a different amount of water. Of course, corresponding
coordinates will also have to be built and this is not done by rdparm. To do this, ideally
construct a PDB file and convert to Amber coordinate format using ptraj. Note that this
command is obsolete and writes old style prmtop files.
ptraj script-file
This command reads a file or from standard input a series of commands to perform pro-
cessing of trajectory files. See the ptraj documentation.
translateBox Amber-coords
Translate the coordinates (only if they contain periodic box information) specified to
place the center either at the origin or at half the box (Amber format). This is obsolete
and the user is encouraged to use the center command of ptraj instead.
modifyBoxInfo
This is a command to modify the box information, such as to change the box size. The
changes are not saved until a writeparm command is issued.
modifyMolInfo
This command checks the molecule info (present with periodic box coordinates are spec-
ified) and points out problems if they exist. In particular, this is useful to overcome the
deficiency in edit which places all the “add” waters into a single molecule.
parmInfo Print out information about the current prmtop file.

printAngles Same as angles.

printAtoms Same as atoms.

printBonds Same as bonds.

printDihedrals Same as dihedrals.

printExcluded Print the excluded atom list.

printLennardJones Print out the Lennard-Jones parameters.

printTypes Print out the atom types.

quit Quit the program.

132
6.11 AMBER Trajectory NetCDF Format

6.11 AMBER Trajectory NetCDF Format


John Mongan (jmongan@[Link])
The file format described in this document was developed for storing data generated by
molecular dynamics simulations. It was introduced in version 9 of the AMBER suite of pro-
grams ([Link]
The primary design goals of this format are:
• Efficient input and output
• Compact, high-precision representation of data
• Portability of data files across different machine architectures
• Extensibility of the format (ability to add additional data without re-writing parsers)
• Compatibility with existing tools and formats
The file format is based on the NetCDF (Network Common Data Form) developed by Unidata
([Link] NetCDF is designed for representation of arbi-
trary array-based data. Unidata provides libraries with bindings in C, C++, Fortran (F77 and
F90), Java, Python, Perl, Ruby and MATLAB for reading and writing NetCDF files. The de-
sign goals above are largely met by NetCDF and the libraries that implement it. It is expected
that all I/O of the format described here will occur through these libraries; this specification
describes the file format at a high level in terms of the API implemented by version 3.6 of these
libraries. In NetCDF terms, this document is a “Convention,” describing the names, dimensions
and attributes of the arrays that may be present in the file.

6.11.1 Program behavior


Programs creating trajectory files (“creators”) shall adhere strictly to the requirements of this
document. Programs reading trajectory files (“readers”) shall be as permissive as possible in
applying the requirements of this document. Readers may emit warnings if out-of-spec files
are encountered; these warnings should include information about the program that originally
created the file (see Global attributes, section 6.11.3). Readers shall not fail to read a file
unless the required information cannot be located or interpreted. In particular, to ensure forward
compatibility with later extensions of the format, readers shall not fail or emit warnings if
elements not described in this document are present in the file.

6.11.2 NetCDF file encoding


• Trajectory files shall be encoded in the manner employed by NetCDF version 3.x.
Those using NetCDF versions 4 or later should take care to ensure that files are read and
written using this encoding, and not the HDF5 encoding.
• Trajectory files shall use 64 bit offsets
This can be accomplished by setting a flag during file creation; refer to API docs for
details.

133
6 ptraj

6.11.3 Global attributes


Global attributes shall have type character string. Spelling and capitalization of attribute
names shall be exactly as appears below. Creators shall include all attributes marked required
and may include attributes marked optional. Creators shall not write an attribute string having
a length greater than 80 characters. Readers may warn about missing required attributes, but
shall not fail, except in the case of a missing or unexpected Conventions or ConventionVersion
attributes.

• Conventions (required)
Contents of this attribute are a comma or space delimited list of tokens representing all
of the conventions to which the file conforms. Creators shall include the string AMBER
as one of the tokens in this list. In the usual case, where the file conforms only to this
convention, the value of the attribute will simply be “AMBER”. Readers may fail if this
attribute is not present or none of the tokens in the list are AMBER. Optionally, if the
reader does not expect NetCDF files other than those conforming to the AMBER con-
vention, it may emit a warning and attempt to read the file even when the Conventions
attribute is missing.

• ConventionVersion (required)
Contents are a string representation of the version number of this convention. Future
revisions of this convention having the same version number may include definitions of
additional variables, dimensions or attributes, but are guaranteed to have no incompatible
changes to variables, dimensions or attributes specified in previous revisions. Creators
shall set this attribute to “1.0”. If this attribute is present and has a value other than “1.0”,
readers may fail or may emit a warning and continue. It is expected that the version of
this convention will change rarely, if ever.

• application (optional)
If the creator is part of a suite of programs or modules, this attribute shall be set to the
name of the suite.

• program (required)
Creators shall set this attribute to the name of the creating program or module.

• programVersion (required)
Creators shall set this attribute to the preferred textual formatting of the current version
number of the creating program or module.

• title (optional)

Creators may set use this attribute to represent a user-defined title for the data represented in
the file. Absence of a title may be indicated by omitting the attribute or by including it with an
empty string value.

134
6.11 AMBER Trajectory NetCDF Format

6.11.4 Dimensions
• frame (required, length unlimited)
Coordinates along the frame dimension will generally represent data taken from different
time steps, but may represent arbitrary conformation numbers when the trajectory file
does not represent a true trajectory but rather a collection of conformations (e.g. from
clustering).

• spatial (required, length 3)


This dimension represents the three spatial dimensions (X,Y,Z), in that order.

• atom (required, length set as appropriate)


Coordinates along this dimension are the indices of particles for which data is stored in
the file. The length of this dimension may be different (generally smaller) than the actual
number of particles in the simulation if the user chooses to store data for only a subset of
particles.

• cell_spatial (optional, length 3)


This dimension represents the three lengths (a,b,c) that define the size of the unit cell.

• cell_angular (optional, length 3)


This dimension represents the three angles (alpha,beta,gamma) that define the shape of
the unit cell.

• label (optional, length set as appropriate)


This dimension is used for character strings in label variables where the label is longer
than a single character. The length of this dimension is equal to the length of the longest
label string.

6.11.5 Label variables


Label variables shall be written by creators whenever their corresponding dimension is present.
These variables are for self-description purposes, so readers may generally ignore them. Labels
requiring more than one character per coordinate shall use the label dimension. Individual co-
ordinate labels that are shorter than the length of the label dimension shall be space padded to
the length of the label dimension.

• char spatial(spatial)
Creators shall write the string “xyz” to this variable, indicating the labels for coordinates
along the spatial dimension.

• char cell_spatial(cell_spatial)
Creators shall write the string “abc” to this variable, indicating the labels for the three
lengths defining the size of the unit cell.

135
6 ptraj

• char cell_angular(cell_angular, label)


Creators shall write the strings “alpha”, “beta”, “gamma” to this variable, naming the
angles defining the shape of the unit cell.

6.11.6 Data variables


All data variables are optional. Some data variables have dependencies on other data vari-
ables, as described below. Creators shall define a units attribute of type character string for each
variable as described below. Creators may define a scale_factor attribute of type float for each
variable. Creators shall ensure that the units of data values, after being multiplied by the value
of scale_factor (if it exists) are equal to that described by the units attribute. If a scale_factor
attribute exists for a variable, readers shall multiply data values by the value of the scale_factor
attribute before interpreting the data. This scaling burden is placed on the reader rather than the
creator, as writing data is expected to be a more time-sensitive operation than reading it.
It is left as an implementation detail whether creators create a separate file for each variable
grouping (e.g. coordinates and velocities) or a single file containing all variables. Some creators
may allow the user to select the approach. Readers should support reading both styles, that is,
combining data from multiple files or reading it all from a single file.

• float time(frame) units = ”picosecond”


When coordinates on the frame dimension have a temporal sequence (e.g. they form a
molecular dynamics trajectory), creators shall define this dimension and write a float for
each frame coordinate representing the number of picoseconds of simulated time elapsed
since the start of the trajectory. When the file stores a collection of conformations having
no temporal sequence, creators shall omit this variable.

• float coordinates(frame, atom, spatial) units = ”angstrom”


This variable shall contain the Cartesian coordinates of the specified particle for the spec-
ified frame.

• float cell_lengths(frame, cell_spatial) units = ”angstrom”


When the coordinates variable is included and the data in the coordinates variable come
from a simulation with periodic boundaries, creators shall include this variable. This
variable shall represent the lengths (a,b,c) of the unit cell for each frame. When each of
the angles in cell_angles is 90, a, b and c are parallel to the x, y and z axes, respectively.
If the simulation has one or two dimensional periodicity, then the length(s) corresponding
to spatial dimensions in which there is no periodicity shall be set to zero.

• float cell_angles(frame, cell_angular) units = ”degree”


Creators shall include this variable if and only if they include the cell_lengths variable.
This variable shall represent the angles (α, β , γ) defining the unit cell for each frame. α
defines the angle between the a-b and a-c planes, β defines the angle between the a-b
and b-c planes and γ defines the angle between the a-c and b-c planes. Angles that are
undefined due to less than three dimensional periodicity shall be set to zero.

136
6.11 AMBER Trajectory NetCDF Format

• float velocities(frame, atom, spatial) units = ”angstrom/picosecond”


When the velocities variable is present, it shall represent the cartesian components of the
velocity for the specified particle and frame. It is recognized that due to the nature of
commonly used integrators in molecular dynamics, it may not be possible for the creator
to write a set of velocities corresponding to exactly the same point in time as defined by
the time variable and represented in the coordinates variable. In such cases, the creator
shall write a set of velocities from the nearest point in time to that represented by the
specified frame.

6.11.7 Example
The following is an example of the CDL for a trajectory file conforming to the preceding
specification and containing most of the elements described in this document. This CDL was
generated using ncdump -h <trajectory file>.

netcdf mdtrj {
dimensions:
frame = UNLIMITED ; // (10 currently)
spatial = 3 ;
atom = 28 ;
cell_spatial = 3 ;
cell_angular = 3 ;
label = 5 ;
variables:
char spatial(spatial) ;
char cell_spatial(cell_spatial) ;
char cell_angular(cell_angular, label) ;
float time(frame) ;
time:units = "picosecond" ;
float coordinates(frame, atom, spatial) ;
coordinates:units = "angstrom" ;
float cell_lengths(frame, cell_spatial) ;
cell_lengths:units = "angstrom" ;
float cell_angles(frame, cell_angular) ;
cell_angles:units = "degree" ;
float velocities(frame, atom, spatial) ;
velocities:units = "angstrom/picosecond" ;
velocities:scale_factor = 20.455f ;
// global attributes:
:title = "netCDF output test" ;
:application = "AMBER" ;
:program = "sander" ;
:programVersion = "9.0" ;
:Conventions = "AMBER" ;
:ConventionVersion = "1.0" ;

137
6 ptraj

138
7 PBSA
Several efficient finite-difference numerical solvers, both linear [97, 98] and nonlinear,[99]
are implemented in pbsa for various applications of the Poisson-Boltzmann (PB) method. In the
following, a brief introduction to the PB method, the numerical solvers, and numerical energy
and force calculations is given first. This is followed by a detailed description of the usage
and keywords. Finally example input files are explained for typical PB applications. For more
background information and how to use the PB method, please consult cited references and
online Amber tutorial pages.

7.1 Introduction
Solvation interactions, especially solvent-mediated dielectric screening and Debye-Hückel
screening, are essential determinants of the structure and function of proteins and nucleic
acids.[100] Ideally, one would like to provide a detailed description of solvation through ex-
plicit simulation of a large number of solvent molecules and ions. This approach is frequently
used in molecular dynamics simulations of solution systems. In many applications, however,
the solute is the focus of interest, and the detailed properties of the solvent are not of central
importance. In such cases, a simplified representation of solvation, based on an approximation
of the mean-force potential for the solvation interactions, can be employed to accelerate the
computation.
The mean-force potential averages out the degrees of freedom of solvent molecules, so that
they are often called implicit or continuum solvents. The formalism with which implicit sol-
vents can be applied in molecular mechanics simulations is based on a rigorous foundation in
statistical mechanics, at least for additive molecular mechanics force fields. Within the for-
malism, it is straightforward to understand how to decompose the total mean-field solvation
interaction into electrostatic and non-electrostatic components that scale quite differently and
must be modeled separately (see for example [101]).
The Poisson-Boltzmann (PB) solvents are a class of widely used implicit solvents to model
solvent-mediated electrostatic interactions.[100] They have been demonstrated to be reliable in
reproducing the energetics and conformations as compared with explicit solvent simulations
and experimental measurements for a wide range of systems.[100] In these models, a solute
is represented by an atomic-detail model as in a molecular mechanics force field, while the
solvent molecules and any dissolved electrolyte are treated as a structure-less continuum. The
continuum treatment represents the solute as a dielectric body whose shape is defined by atomic
coordinates and atomic cavity radii.[102] The solute contains a set of point charges at atomic
centers that produce an electrostatic field in the solute region and the solvent region. The elec-
trostatic field in such a system, including the solvent reaction field and the Coulombic field,
may be computed by solving the PB equation:[103, 104]

139
7 PBSA

∇  [ε(r)∇φ (r)] = −4πρ(r) − 4πλ (r) ∑ zi ci exp(−zi φ (r)/kB T ) (7.1)


i

where ε(r) is the dielectric constant, φ (r) is the electrostatic potential, ρ(r) is the solute charge,
λ (r) is the Stern layer masking function, zi is the charge of ion type i, ci is the bulk number
density of ion type i far from the solute, kB is the Boltzmann constant, and T is the temperature;
the summation is over all different ion types. The salt term in the PB equation can be linearized
when the Boltzmann factor is close to zero. However, the approximation apparently does not
hold in highly charged systems. Thus, it is recommended that the full nonlinear PB equation
solvers be used in such systems.
The non-electrostatic or non-polar solvation interactions are typically modeled with a term
proportional to the solvent accessible surface area (SASA).[105] An alternative and more accu-
rate method to model the non-polar solvation interactions is also implemented in this release.[106]
The new method separates the non-polar solvation interactions into two terms: the attractive
(dispersion) and repulsive (cavity) interactions. Doing so significantly improves the correlation
between the cavity free energies and solvent accessible surface areas for branched and cyclic
organic molecules.[107] This is in contrast to the commonly used strategy that correlates total
non-polar solvation energies with solvent accessible surface areas, which only correlates well
for linear aliphatic molecules.[105] In the new method, the attractive free energy is computed
by a numerical integration over the solvent accessible surface area that accounts for solvation
attractive interactions with an infinite cutoff.[108]

7.1.1 Numerical solutions of the PB equation

In this release, both the linear form and the full nonlinear form of the PB equation are sup-
ported. Many numerical methods may be used to solve the PB equation, but only the finite-
difference (FD) method [109–111] is supported in the current release for both the linear and
nonlinear PB equations. A FD method involves the following steps: mapping atomic charges
to the FD grid points (termed grid charges below); assigning non-periodic/periodic boundary
conditions, i.e. electrostatic potentials on the boundary surfaces of the FD grid; and applying a
dielectric model to define the high-dielectric (i.e. water) and low-dielectric (i.e. solute interior)
regions and mapping it to the FD grid edges.
These steps allow the partial differential equation to be converted into a linear or nonlinear
system with the electrostatic potential on grid points as unknowns, the charge distribution on the
grid points as the source, and the dielectric constant on the grid edges (and the salt-related term
for the linear case) wrapped into the coefficient matrix, which is a seven-banded symmetric
matrix. In this release, four common linear FD solvers are implemented: modified ICCG,
geometric multigrid, conjugate gradient, and successive over-relaxation (SOR).[98] In addition,
we have also implemented six nonlinear FD solvers: Inexact Newton(NT)/modified ICCG,
NT/geometric multigrid, conjugate gradient, and SOR and its improved versions - adaptive
SOR and damped SOR.[99]

140
7.1 Introduction

7.1.2 Numerical interpretation of energy and forces


PB solvents approximate the solvent-induced electrostatic mean-force potential by comput-
ing the reversible work in the process of charging the atomic charges in a solute molecule or
complex. The charging free energy is a function of the electrostatic potential φ , which can be
computed by solving the linear or nonlinear system.
It has been shown (see for example [101]) that the total electrostatic energy of a solute
molecule can be approximated through the FD approach by subtracting the self FD Coulombic
energy (GFD FD
coul,shel f ) and the short-range FD Coulombic energy (Gcoul,short ) from the total FD
electrostatic energy (GFD coul,total ), and adding back the analytical short-range Coulombic energy
(Gana
coul,short ). The self FD Coulombic energy is due to interactions of grid charges within one
single atom. The self energy exists even when the atomic charge is exactly positioned on one
grid point. It also exists in the absence of solvent and any other charges. It apparently is a pure
artifact of the FD approach and must be removed. The short-range FD Coulombic energy is
due to interactions between grid charges in two different atoms that are separated by a short
distance, usually less than 14 grid units. The short-range Coulombic energy is inaccurate be-
cause the atomic charges are mapped onto their eight nearest FD grids, thus causing deviation
from the analytical Coulomb energy. The correction of GFD FD
coul,shel f and Gcoul,short is made pos-
sible by the work of Luty and McCammon’s analytical approach to compute FD Coulombic
interactions.[112]
Therefore, the PB electrostatic interactions include both Coulombic interactions and reaction
field interactions for all atoms of the solute. The total electrostatic energy is given in the energy
component EEL in the output file. The term that is reserved for the reaction field energy, EPB,
is zero if this method is used. If you want to know how much of EEL is the reaction field energy,
you can set the BCOPT keyword (to be explained below) to compute the reaction field energy
only by using a Coulombic field (or singularity) free formulation.[113]
When the full nonlinear Poisson-Boltzmann equation is used, an additional energy term, the
ionic energy, should also be included. This energy term disappears in the symmetrical linear
system because the effects due to opposite ions cancel out. It is currently approximated by
calculation up to the space boundary of the FD grid. It should be noted that the NBUFFER
keyword may need increasing to obtain good precision in the ionic energy for small molecules
with a large FILLRATIO.
An alternative method of computing the electrostatic interactions is also implemented in this
release. In this method, the reaction field energy is computed directly after the induced surface
charges are first computed at the dielectric boundary (i.e. the surface that separates solute and
solvent). These surface charges are then used to compute the reaction field energy,[100] and is
given as the EPB term. It has been shown that doing so improves the convergence of reaction
field energy with respect to the FD grid spacing. However, a limitation of this method is that
the Coulombic energy has to be recomputed analytically with a pairwise summation procedure.
When this method is used, the EEL term only gives the Coulombic energy with a cutoff distance
provided in the input file. The two ways of computing electrostatic interactions are controlled
by the keywords ENEOPT and FRCOPT to be described below.
The non-polar solvation free energy is returned by the ECAVITY term, which is either the
total non-polar solvation free energy or the cavity solvation free energy in the two different
models described above. The EDISPER term returns the dispersion solvation free energy.

141
7 PBSA

Of course it is zero if the total non-polar solvation free energy has been returned by ECAV-
ITY. The word INP can be used to choose one of the two treatments of non-polar solvation
interactions.[106] Specifically, you can use SASA to correlate total non-polar solvation free
energy, i.e. Gnp = NP_TENSION * SASA + NP_OFFSET as in PARSE.[105] You can also use
SASA to correlate the cavity term only and use a surface-integration approach to compute the
dispersion term.[106] i.e. Gnp = Gdisp + Gcavity , with Gcavity = CAVITY_TENSION * SASA +
CAVITY_OFFSET. When this option is used, RADIOPT has to be set to 1, i.e. the radii set
optimized by Tan and Luo to mimic Gnp in the TIP3P explicit solvent.[106] Otherwise, there is
no guarantee of consistence between the implemented non-polar implicit solvent and the TIP3P
explicit solvent. In this release, more options are added in the second approach, i.e. when INP
= 2. See the discussion of keywords following INP below. These options are described in detail
in Ref. [106].

7.1.3 Numerical accuracy and related issues


Note that the accuracy of any numerical PB procedure is determined by the discretization
resolution specified in the input, i.e. the grid spacing. The convergence criterion for the it-
eration procedures also plays some role for the numerical PB solvers. Finally the accuracy is
highly dependent upon the methods used for computing total electrostatic interactions. In Lu
and Luo,[101] the accuracy of the first method for total electrostatic interactions is discussed
in detail. In Ye and Luo [Manuscript in preparation], the accuracy of the second method is
discussed.
It is recommended that the second method for total electrostatic interactions be used for most
calculations. Apparently the cutoff distance for charge-charge interactions strongly influences
the accuracy of electrostatic interactions. The default setting is infinity, i.e. no cutoff is used. In
this method, the convergence of the reaction field energy with respect to the grid spacing is much
better than that of the first method. Our experience shows that the reaction field energies con-
verge to within ~2% for tested proteins at the grid spacing of 0.5 when the weighted harmonic
average of dielectric constants is used at the solute/solvent interface (when SMOOTHOPT = 1,
see below).[114]
The reaction field energies computed with the second method (when SMOOTHOPT = 2)
are also in excellent agreement (differences in the order of 0.1%) with those computed with
the Delphi program which uses the same method for energy calculation. For example, see
the computational set up documented in test case pbsa_delphi in this release [Wang and Luo,
Manuscript in preparation].
The accuracy of non-polar solvation energy depends on the quality of SASA which is com-
puted numerically by representing each atomic surface by spherically distributed dots. Thus a
higher dot density gives more accurate atomic surface and molecular surface. However, it is
found that the default setting for the dot density is quite sufficient for typical applications.[106]
Numerical solvation calculations are memory intensive for macromolecules due to the fine
grid resolution required for sufficient accuracy. Thus, the efficiency of pbsa depends on how
much memory is allocated for it and the performance of the memory subsystem. The option
that is directly related to its memory allocation is the FD grid spacing for the PB equation and
the surface dot resolution for molecular surface.

142
7.2 Usage and keywords

7.2 Usage and keywords


7.2.1 File usage
pbsa has a very similar user interface as the Amber/sander program, though much simpler.

pbsa [-O] -i mdin -o mdout -p prmtop -c inpcrd

Here is a brief description of the files referred to above.

mdin input control data for the run.

mdout output user readable state info and diagnostics “-o stdout” will send output to stdout (to
the terminal) instead of to a file.

prmtop input molecular topology, force field, atom and residue names, and (optionally) peri-
odic box type.

inpcrd input initial coordinates and (optionally) velocities and periodic box size.

7.2.2 Basic input options


The layout of the input file is also in the same way as that of Amber/sander for backward
compatibility with previous releases in Amber. The keywords are put in the the namelist of
&cntrl for basic controls and &pb for more detailed manipulation of the numerical procedures.
This subsection discusses the basic keywords, either retained from sander or newly created to
invoke different energetic analyses. To reduce confusion most keywords from sander have been
removed from the namelist so they can no longer be read since the current implementation in
pbsa only performs single-structure calculations with the coordinates from inpcrd and exits.
However, the current release is compatible with the mdin file generated with the mmpbsa script
in previous releases in Amber. Users interested in energy minimization and molecular dynamics
with the PB implementation are referred to the coming release of Amber. Nevertheless, for
purposes of validation and development, the atomic forces can be dumped out in a file when
requested as described below.
The numerical electrostatic procedures can be turned on by setting IPB to either 1 or 2. The
backward compatible flag IGB = 10 is equivalent to IPB = 1 and will be phased out in future
releases. The numerical non-polar procedures can be turned on by setting INP to either 1 or 2.
The backward compatible flag NPOPT will be phased out in future releases.

imin Flag to run minimization. Both options give the same output energies though the
output formats are slightly different. This option is retained from previous releases
in the Amber package for backward compatibility. Note the current release of pbsa
does not support either minimization or dynamics.
= 0 No minimization. Default.
= 1 Same as 0, but with a slightly different output format

143
7 PBSA

ntx Option to read the coordinates from the “inpcrd” file. Only options 1 and 2 are
supported in this releases. Other options will cause pbsa to issue a warning though
it does not affect the energy calculation.
= 1 X is read formatted with no initial velocity information. Default.
= 2 X is read unformatted with no initial velocity information.

ipb Option to set up a dielectric model for all numerical PB procedures.


= 0 No electrostatic solvation free energy is computed.
= 1 The dielectric interface between solvent and solute is defined to be the numer-
ical solvent excluded surface. Default.
= 2 The dielectric interface is also the solvent excluded surface, but it is imple-
mented with the level set function, which is the signed distance from the
numerical solvent accessible surface. The solvent excluded surface is the
isosurface where the function value equals to negative solvent probe radius.
[Wang and Luo, Manuscript in preparation] Use of a level set function simpli-
fies the calculation of the intersection points of the solvent excluded surface
and grid edges (when SMOOTHOPT = 1, see below) and leads to more stable
numerical calculations.
igb When set to 10 (the only allowed value), it instructs pbsa to set up calculations,
equivalent to the IPB = 1 option. Other values will cause pbsa to issue a warning
and exit. It will be over written by IPB if inconsistency between the two is detected.
inp Option to select different methods to compute non-polar solvation free energy.
= 0 No non-polar solvation free energy is computed.
= 1 The total non-polar solvation free energy is modeled as a single term linearly
proportional to the solvent accessible surface area, as in the PARSE parameter
set. See Introduction. Default for backword-compatibility.
= 2 The total non-polar solvation free energy is modeled as two terms: the cav-
ity term and the dispersion term. The dispersion term is computed with a
surface-based integration method [106] closely related to the PCM solvent
for quantum chemical programs.[108] Under this framework, the cavity term
is still computed as a term linearly proportional to the molecular solvent-
accessible-surface area (SASA) or the molecular volume enclosed by SASA.
With this option, please do not use RADIOPT = 0, i.e. the radii in the prmtop
file. Otherwise, a warning will be issued in the output file.
Once the above basic options are specified, pbsa can proceed with the default options to com-
pute the solvation free energies with the input coordinates. Of course, this means that you only
want to use default options for default applications.
More PB options described below can be defined in the &pb namelist, which is read imme-
diately after the &cntrl namelist. We have tried hard to make the defaults for these parameters
appropriate for calculations of solvated molecular systems. Please use caution when changing
any default options.

144
7.2 Usage and keywords

7.2.3 Options to define the physical constants


epsin Sets the dielectric constant of the solute region, default to 1.0. The solute region is
defined to be the solvent excluded volume.

epsout Sets the implicit solvent dielectric constant, default to 80. The solvent region is
defined to be the space not occupied the solute region. i.e. only two dielectric
regions are allowed in the current release.

smoothopt instructs PB how to set up dielectric values for finite-difference grid edges that are
located across the solute/solvent dielectric boundary.
= 0 The dielectric constants of the boundary grid edges are always set to the equal-
weight harmonic average of EPSIN and EPSOUT. Default.
= 1 A weighted harmonic average of EPSIN and EPSOUT is used for boundary
grid edges. The weights for EPSIN and EPSOUT are fractions of the bound-
ary grid edges that are inside or outside the solute surface.[115]
= 2 The dielectric constants of the boundary grid edges are set to either EPSIN or
EPSOUT depending on whether the midpoints of the grid edges are inside or
outside the solute surface.

istrng Sets the ionic strength (in mM) for the PB equation. Default is 0 mM. Note the
unit is different from that (in M) in the generalized Born methods implemented in
Amber. Note also that we are only dealing with symmetrical solution, so the ionic
strength should be equal to the square of the valence of the symmetrical ions times
the ion concentration (in mM).

pbtemp Temperature used for the PB equation, needed to compute the Boltzmann factor
for salt effects; default is 300 K.

radiopt Option to set up atomic radii.


= 0 Use radii from the prmtop file for both the PB calculation and for the NP
calculation (see INP).
= 1 Use atom-type/charge-based radii by Tan and Luo [116] for the PB calculation.
Note that the radii are optimized for Amber atom types as in standard residues
from the Amber database. If a residue is build by antechamber, i.e. if GAFF
atom types are used, radii from the prmtop file will be used. Please see [116]
on how these radii are optimized. The procedure in [116] can also be used to
optimize radii for non-standard residues. These optimized radii can be read
in if they are incorporated into the radii section of the prmtop file (of course
via RADIOPT=0). This option also instructs pbsa to use van der Waals radii
from the prmtop file for non-polar solvation energy calculations. These van
der Waals radii are really the half sigma/rmin values for pairs of atoms of the
same types. So they are computed from the van der Waals coefficients in the
prmtop file. (see INP and USE_RMIN). Default.

145
7 PBSA

dprob Solvent probe radius for molecular surface used to define the dielectric boundary
between solute and solvent. To be backward compatible with previous releases in
Amber, DPROB = SPROB = 1.6 by default, i.e. it is set to be equal to SPROB if
DPROB is not specified in the input file. In this release, SPROB has been reserved
for the calculation of non-polar solvation energy. See below.
iprob Mobile ion probe radius for ion accessible surface used to define the Stern layer.
Default to 2.0 Å.
arcres pbsa uses a numerical method to compute solvent accessible arcs,[Wang and Luo,
Manuscript in preparation]. The ARCRES keyword gives the resolution (in the
unit of Å) of dots used to represent these arcs, default to 0.0625 Å. These dots are
first checked against nearby atoms to see whether any of the dots are buried. The
exposed dots represent the solvent accessible portion of the arcs and are used to
define the dielectric constants on the grid edges.

7.2.4 Options to select numerical procedures


npbopt Option to select the linear or the full nonlinear PB equation.
= 0 Linear PB equation is solved. Default.
= 1 Nonlinear PB equation is solved.

solvopt Option to select iterative solvers.


= 1 Modified ICCG. Default.
= 2 Geometric multigrid. A four-level v-cycle implementation is applied. Each
dimension of the finite-difference grid is 2^4*n-1.
= 3 Conjugate gradient. This option requires a large MAXITN to converge.
= 4 SOR. This option requires a large MAXITN to converge.
= 5 Adaptive SOR. This is only compatible with NPBOPT = 1. This option re-
quires a large MAXITN converge.
= 6 Damped SOR. This is only compatible with NPBOPT = 1. This option requires
a large MAXITN to converge.
accept Sets the iteration convergence criterion (relative to the initial residue). Default to
0.001.
maxitn Sets the maximum number of iterations for the finite difference solvers, default to
100. Note that MAXITN has to be set to a much larger value, like 10,000, for the
less efficient solvers, such as conjugate gradient and SOR, to converge.
fillratio The ratio between the longest dimension of the rectangular finite-difference grid
and that of the solute. Default is 2.0. It is suggested that a larger FILLRATIO,
for example 4.0, be used for a small solute, such as a ligand molecule. Otherwise,
part of the small solute may lie outside of the finite-difference grid, causing the
finite-difference solvers to fail.

146
7.2 Usage and keywords

space Sets the grid spacing for the finite difference solver; default is 0.5 .
nbuffer Sets how far away (in grid units) the boundary of the finite difference grid is away
from the solute surface; default is 0 grids, i.e. automatically set to be at least a
solvent probe or ion probe (diameter) away from the solute surface.
nfocus Set how many successive FD calculations will be used to perform an electrostatic
focussing calculation on a molecule. Default to 2, the maximum. When NFOCUS
= 1, no focusing is used. It is recommented that NFOCUS = 1 when the multigrid
solver is used.
fscale Set the ratio between the coarse and fine grid spacings in an electrostatic focussing
calculation. Default to 8.
npbgrid Sets how often the finite-difference grid is regenerated; default is 1 step. For molec-
ular dynamics simulations, it is recommended to be set to at least 100. Note that
the PB solver effectively takes advantage of the fact that the electrostatic poten-
tial distribution varies very slowly during dynamics simulations. This requires that
the finite-difference grid be fixed in space for the code to be efficient. However,
molecules do move freely in simulations. Thus, it is necessary to set up the finite-
difference grid once in a while to make sure a molecule is well within the grid.

7.2.5 Options to compute energy and forces


bcopt Boundary condition options.
= 1 Boundary grid potentials are set as zero. Total electrostatic potentials and
energy are computed.
= 5 Computation of boundary grid potentials using all grid charges. Total electro-
static potentials and energy are computed. Default.
= 6 Computation of boundary grid potentials using all grid charges. Reaction
field potentials and energy are computed with the charge singularity free
formulism.[113]
eneopt Option to compute total electrostatic energy and forces.
= 1 Compute total electrostatic energy and forces with the particle-particle particle-
mesh procedure outlined in Lu and Luo.[101] In doing so, energy term EPB
in the output file is set to zero, while EEL includes both the reaction field en-
ergy and the Coulombic energy. The van der Waals energy is computed along
with the particle-particle portion of the Coulombic energy. The electrostatic
forces and dielectric boundary forces can also be computed.[101] This option
requires a non-zero CUTNB and BCOPT = 5.
= 2 Use dielectric boundary surface charges to compute the reaction field energy.
Default. Both the Coulombic energy and the van der Waals energy are com-
puted via summation of pairwise atomic interactions. Energy term EPB in
the output file is the reaction field energy. EEL is the Coulombic energy.

147
7 PBSA

frcopt Option to compute and output electrostatic forces to a file named [Link] in the
working directory.
= 0 Do not compute or output atomic and total electrostatic forces. This is default.
= 1 Reaction field forces are computed by trilinear interpolation. Dielectric bound-
rary forces are computed using the electric field on dielectric boundary. The
forces are output in the unit of kcal/mol − .
= 2 Use dielectric boundary surface polarized charges to compute the electrostatic
forces and dielectric boundary forces [Ye et al. Manuscript submitted]. The
forces are output in the unit of kcal/mol − .
= 3 Reaction field forces are computed using dielectric boundary polarized charge.
Dielectric boundrary forces are computed using the electric field on dielectric
boundary [Ye et al. Manuscript submitted]. The forces are output in the unit
of kcal/mol − .
dbfopt This keyword is equivalent to ENEOPT, and will be phased out in future releases.
= 0 equivalent to ENEOPT = 1.
= 1 equivalent to ENEOPT = 2.

scalec Option to compute reaction field energy and forces.


= 0 Do not scale dielectric boundary surface charges before computing reaction
field energy and forces. Default.
= 1 Scale dielectric boundary surface charges using Gauss’s law before computing
reaction field energy and forces.
cutres Residue-based cutoff distance; default is 24 Å. The residue-based non-bonded list
is used to make the generation of the atom-based pair list efficient. A value longer
than the largest residue in the system is recommended for correct nonbonded list
generation.
cutfd Atom-based cutoff distance to remove short-range finite-difference Coulombic in-
teractions, and to add pairwise Coulombic interactions, default is 5 Å. See Eqn (20)
in Lu and Luo.[101]
cutnb Atom-based cutoff distance for van der Waals interactions, and pairwise Coulom-
bic interactions when ENEOPT = 2. Default to 0. When CUTNB is set to the
default value of 0, no cutoff will be used for van der Waals and Coulombic inter-
actions, i.e. all pairwise interactions will be included. When ENEOPT = 1, this is
the cutoff distance used for van der Waals interactions only. The particle-particle
portion of the Coulombic interactions is computed with the cutoff of CUTFD.
nsnbr Sets how often residue-based pairlist is generated; default is 1 step. For molecular
dynamics simulations, a value of 25 is recommended.
nsnba Sets how often atom-based pairlist is generated; default is 1 step. For molecular
dynamics simulations, a value of 5 is recommended.

148
7.2 Usage and keywords

7.2.6 Options for visualization and output


phiout pbsa can be used to output spatial distribution of electrostatic potential for visual-
ization.
= 0 No potential file is printed out. Default.
= 1 Electrostatic potential is printed out in a file named [Link] in the working
directory. Please refer to examples in the next section on how to display
electrostatic potential on molecular surface.
phiform Controls the format of the electrostatic potential file.
= 0 The electrostatic potential (kT /mol · e) is printed in the Delphi binary format.
Default.
= 1 The electrostatic potential (kcal/mol · e) is printed in the Amber ASCII format.

npbverb When set to 1, turns on verbose mode in pbsa; default is 0.

7.2.7 Options to select a non-polar solvation treatment


npopt This keyword is equivalent to INP, and will be phased out in future releases. It will
be over written by INP if inconsistency between the two is detected.
decompopt Option to select different decomposition schemes when INP = 2. See [106] for
a detailed discussion of the different schemes. The default is 1, to be backward
compatible with previous releases in Amber. However, the recommended option
is DECOMPOPT = 2, the σ decomposition scheme, which is the best of the three
schemes studied.[106] As discussed in Ref. [106], DECOMPOPT = 1 is not a very
accurate approach even if it is more straightforward to understand the decomposi-
tion.
= 1 The 6/12 decomposition scheme. Default.
= 2 The σ decomposition scheme.
= 3 The WCA decomposition scheme.

use_rmin The option to set up van der Waals radii for INP = 2. The default is not to use rmin
to be backward compatible with previous releases in Amber. However, use of rmin
improves the agreement with TIP3P [106], so it is recommended.
= 0 Use atomic van der Waals σ values. Default.
= 1 Use atomic van der Waals rmin values.

sprob Solvent probe radius for solvent accessible surface area (SASA) used to compute
the dispersion term, default to 1.600 Å, the sigma value of the TIP3P OW atom.
The recommended value is 0.557 Å in the σ decomposition scheme as optimized
in Ref. [106] with respect to the TIP3P solvent and the PME treatment. Recom-
mended values for other decomposition schemes can be found in Table 4 of [106].
If USE_SAV = 0 (see below), SPROB can be used to compute SASA for the cavity

149
7 PBSA

term as well. Unfortunately, the recommended value is different from that used
in the dispersion term calculation as documented in Ref. [106] Thus two separate
pbsa calculations are needed when USE_SAV = 0, one for the dispersion term and
one for the cavity term. Therefore, please carefully read Ref. [106] before proceed-
ing with the option of USE_SAV = 0. Note that SPROB was used for ALL three
terms of solvation free energies, i.e. electrostatic, attractive, and repulsive terms in
previous releases in Amber. However, it was found in the more recent study [106]
that it was impossible to use the same probe radii for all three terms after each term
was calibrated and validated with respect to the TIP3P solvent. [106, 116]

vprob Solvent probe radius for molecular volume (the volume enclosed by SASA) used
to compute non-polar cavity solvation free energy, default to 1.300 Å, the value op-
timized in [106] with respect to the TIP3P solvent. Recommended values for other
decomposition schemes can be found in Tables 1-3 of [106]. See the discussion in
SPROB above.

rhow_effect Effective water density used in the non-polar dispersion term calculation, default
to 1.000. The recommended value is 1.129 for DECOMPOPT = 2, the σ scheme.
This was optimized in [106] with respect to the TIP3P solvent in PME. Optimized
values for other decomposition schemes can be found in Table 4 of [106].

use_sav The option to use molecular volume (the volume enclosed by SASA) or to use
molecular surface (SASA) for cavity term calculation. The default is to use SASA
to be backward compatible with previous releases in Amber. Recent study shows
that the molecular volume approach transfers better from small training molecules
to biomacromolecules (Tan and Luo, In Preparation).
= 0 Use SASA to estimate cavity free energy. Default.
= 1 Use the molecular volume enclosed by SASA.

cavity_surften The regression coefficient for the linear relation between the total non-polar sol-
vation free energy (INP = 1) or the cavity free energy (INP = 2) and SASA/volume
enclosed by SASA. The default value is for INP = 2 and set to be backward com-
patible with previous releases in Amber, but not for INP = 1. The recommended
value is 0.0378 when DECOMPOPT = 2, USE_RMIN = 1, and USE_SAV = 1.
See recommended values in Tables 1-3 for other combinations of options.

cavity_offset The regression offset for the linear relation between the total non-polar solva-
tion free energy (INP = 1) or the cavity free energy (INP = 2) and SASA/volume
enclosed by SASA. The default value is for INP = 2 and set to be backward compat-
ible with with previous releases in Amber, but not for INP = 1. The recommended
value is -0.5692 when DECOMPOPT = 2, USE_RMIN = 1, and USE_SAV = 1.
See recommended values in Tables 1-3 for other combinations of options.

maxsph pbsa uses a numerical method to compute solvent accessible surface area.[106]
MAXSPH variable gives the approximate number of dots to represent the maxi-
mum atomic solvent accessible surface, default to 400. These dots are first checked

150
7.3 Example inputs

against covalently bonded atoms to see whether any of the dots are buried. The ex-
posed dots from the first step are then checked against a non-bonded pair list with
a cutoff distance of 9 to see whether any of the exposed dots from the first step are
buried. The exposed dots of each atom after the second step then represent the sol-
vent accessible portion of the atom and are used to compute the SASA of the atom.
The molecular SASA is simply a summation of the atomic SASA’s. A molecular
SASA is used for both PB dielectric map assignment and for NP calculations.

7.3 Example inputs


7.3.1 Single-point calculation of solvation free energies
Here is a sample input file that might be used to perform single structure calculations.

Sample single point PB calculation


&cntrl
ntx=1,
imin=1,
igb=10,
inp=2
/
&pb
npbverb=1, istrng=0, epsout=80.0, epsin=1.0,
radiopt=1, dprob=1.6
space=0.5, nbuffer=0, fillratio=4.0,
accept=0.001,
cutnb=0, eneopt=2,
decompopt=2, use_rmin=1, sprob=0.557, vprob=1.300,
rhow_effect=1.129, use_sav=1,
cavity_surften=0.0378, cavity_offset=-0.5692
/

Note that NPBVERB = 1 above. This generates much detailed information in the output file
for the PB and NP calculations. A useful printout is atomic SASA data for both PB and NP
calculations which may or may not use the same atomic radius definition. Since the FD solver
for PB is called twice to perform electrostatic focus calculations, two PB printouts are shown for
each single point calculation. For the PB calculation, a common error message can be generated
when FILLRATIO is set to the default value of 2.0 for small molecules. This may cause a solute
to lie outside of the focusing finite-difference grid.
In this example INP is set to the default value of 2, which calls for non-polar solvation
calculation with the new method that separates cavity and dispersion interactions. The EDIS-
PER term gives the dispersion solvation free energy, and the ECAVITY term gives the cavity
solvation free energy. The sample input options above for the NP calculation are set to the
recommended values for the σ decomposition scheme and to use molecular volume to correlate
with cavity free energy. You can find recommended values for other decomposition schemes

151
7 PBSA

and other options in Tables 1-4 of [106]. If INP is set to 1, the ECAVITY term would give the
total non-polar solvation free energy.

7.3.2 Visualization of electrostatic potentials


You can also use pbsa to produce an electrostatic potential map for visualization in PyMol
when setting PHIOUT = 1. By default, pbsa outputs a file [Link] in the Delphi binary
format. The sample input file is listed below:

Sample PB visualization input


&cntrl
ntx=1,
imin=1,
ipb=1,
inp=0
/
&pb
npbverb=1, istrng=0, epsout=80.0, epsin=1.0,
space=1., accept=0.001,
sprob=1.4, cutnb=9,
phiout=1, phiform=0
/

To be consistent with the surface routine of PyMol, the option PHIOUT = 1 instructs pbsa to
use the radii as defined in PyMol. The FD grid is also set to be cubic as in Delphi. The SPROB
value should be set to that used in PyMol, 1.4 Å. A large grid spacing, e.g. 1 Å or higher, is
recommended for visualization purposes. Otherwise, the potential file would be very large.
Here is an example of loading the potential map in PyMol. First load the molecule in the
form of prmtop and inpcrd. In our case we need to rename our prmtop file to [Link] and
inpcrd file to [Link] and load the molecule with commands

PyMol> load [Link]


PyMol> load [Link]

The molecule will appear as an object “molecule”. Next display the surface of the molecule in
the PyMol menu by clicking “S” and then select surface. Now import the potential map
generated by pbsa with the command in PyMol

PyMol> load [Link]

to create a value map object called “pbsa”. After this, create a value ramp called e_lvl from the
potential map with the command

PyMol> ramp_new e_lvl, pbsa, [-7, 0, 7]

You can assign surface_color to the e_lvl ramp with the command

PyMol> set surface_color, e_lvl, molecule

152
7.3 Example inputs

This will display the surface with the color scale according to the potential. You can adjust the
value scale, such as [-5, 0, 5], to change the color scale and use “rebuild” command to redraw
the surface.
In principle, it is possible to visualize the potential file in VMD, but we have not validated
this program. More detailed information on static single-point PB calculations can be found on
online Amber tutorial pages.

7.3.3 Single point calculation of forces


Since pbsa is released for single point calculations in AmberTools, no energy minimization
or molecular dynamics is supported. However, the PB procedure can be invoked to print out
the numerical electrostatic forces for developmental purposes. Here is a sample input:

Sample PB force computation


&cntrl
imin=1,
ntx=1,
ipb=2,
inp=0
/
&pb
npbverb=1,
istrng=0, epsout=80.0, epsin=1.0, sprob=0.6, radiopt=1,
space=0.5, fillratio=2.0,accept=0.001,
eneopt=2, cut=0, frcopt=2
/

Note that INP is set to 0 to turn off non-polar solvation interactions. The molecular surface
computed with the level set function is used. ENEOPT and FRCOPT are both set to 2, i.e.
induced surface charges are used to compute the electrostatic energy and forces. Since CUTNB
is set to the default value of zero, an infinite cutoff distance is used for both Coulombic and van
der Waals interactions.

7.3.4 Comparing with Delphi results


Under identical condition, PBSA is highly consistent with Delphi in term of computed re-
action field energies. In this subsection, we briefly go over the details on how you can obtain
comparable energies from both program. Apparently, you need coordinates, atomic charges,
and atomic radii that have exactly the same numerical values but in both the Amber format and
the Delphi format, i.e. the pqr format.
For a Delphi computation with the following input parameters:

salt=0.150
ionrad=2.0
exdi=80.0
indi=1.0

153
7 PBSA

scale=2.0
prbrad=1.5
perfil=50
bndcon=4
linit=1000

a comparable computation in PBSA can be obtained by using the following input file:
Sample PB for delphi comparison
&cntrl ntx=1, imin=1, ipb=1, inp=0
/
&pb npbverb=0, istrng=150, epsout=80.0, epsin=1.0,
ivalence=1, iprob=2.0, space=0.5, accept=1e-3,
dprob=1.5, radiopt=0, fillratio=2, bcopt=6,
smoothopt=2, nfocus=1, dbfopt=1, cutnb=0,
maxitn=10000
/

The above sample input files are also provided in the current release under $AMBERHOME-
/test/pbsa_delphi. Note that the values of exdi, indi, prbrad, and ionrad in Delphi should be
consistent with the values of epsout, epsin, dprob, and iprob in PBSA, respectively. In Delphi
salt=0.150 is set in the unit of M, while in PBSA istrng=150 is in the unit of mM. In Delphi the
grid spacing is set as the number of grids per Angstrom, i.e. scale=2.0, while in PBSA the grid
spacing is set straight as space=0.5 in Angstrom. In Delphi the grid dimension is set as percent-
age of the solute dimension over the grid dimension, i.e. perfil=50, which is equivalent to the
ratio of solute dimension over grid dimension set as fillratio = 2 in PBSA. Finally, Delphi sets
the boundary condition by bndcnd=4 and PBSA sets the boundary condition as bcopt=6; both
programs mean to use the Debye-Huckel limitation behavior for each atomic charged sphere.
There are additional options in PBSA that do not have corresponding counterparts in Delphi.
For example, smoothopt is used to instruct the program to use a specific dielectric boundary
smoothing option, which is equivalent to that used in Delphi when set to 2. (see Section 7.1.3);
arcres is used to set the resolution of numerical dot representation of the solvent accessible arcs,
the default is 1/16 Å, which is similar to the numerical resolution of solvent accessible arc dots
used in Delphi.

7.4 PBSA in SANDER


All PBSA functionalities are available in SANDER and all input options are exactly the same
as in the standalone PBSA. Apparent exceptions are ipb and inp: you need to really set ipb/inp
to nonzero in order to invoke PBSA functionalities.

7.5 PBSA in NAB


PBSA functionalities are available in NAB as a part of the standard build. However the avail-
able input options are limited, please refer to the table in Section 14.1 for the list of available

154
7.5 PBSA in NAB

PBSA input options. The structures and parameters are supplied by NAB’s facility. An extra
feature for PBSA in NAB is the availability of electrostatic forces or gradients. We describe
special consideration in its applications in the following section.

7.5.1 Electrostatic Forces/Gradients in PBSA


Force calculation in the finite-difference Poisson-Boltzmann method is straightforward, though
not a trivial issue. It can be shown, by using the variation of the electrostatic free energy, that
the electrostatic force density consists of three components, viz., the reaction field force, the
dielectric boundary force, and the ionic force. [117] Since the ionic force is much smaller in
absolute value than the other two components, we only include the reaction field force and the
dielectric boundary force in this release.
The reaction field force only exists where there are atomic charges, so that it is straightfor-
ward to be mapped onto atoms. In contrast, the dielectric boundary force exists on the molecular
surface where the dielectric constant changes. The surface force, or pressure, cannot be easily
mapped onto atoms. This is because a force-mapping procedure from the molecular surface to
atoms apparently needs the derivatives of molecular surface with respect to atomic positions.
However such derivatives do not exist for the widely used molecular surface definition, i.e. the
solvent excluded surface (SES). We are actively developing an analytical molecular surface def-
inition that is consistent with the widely used SES definition for the numerical PB methods so
that this difficulty will be overcome in future releases.
Temporarily, there is a partial solution in the mapping of dielectric boundary force as de-
scribed by Gilson et al[117] when the SES definition is used. This is currently adopted in the
PBSA module. Note that the method is rigorously correct only for two overlapping atoms.
On solvent-exposed surface with well-packed and highly charged atoms, such as nucleic acid
backbones, the error in the force-mapping procedure can be very large. Our tests show that the
deviations from the numerical finite-difference forces can be in the orders of several tenths of
kcal/mol-Å. In other situations, the errors are in the orders of several hundredths of kcal/mol-Å.

7.5.2 Example
Here is a sample of calls in a NAB program to the mm_options() routine, in order to run
pbsa:
mm_options("ntpr=1, cut=99.0"); // No solute-solute cutoff
mm_options("ipb=1"); // Use PBSA
mm_options("accept=0.000001"); // Convergence criterion
mm_options("sprob=1.6"); // Solvent probe radius for SASA
mm_options("radiopt=1"); // Useatom-type/charge-based radii
mm_options("fillratio=4"); // Coarse/Fine ratio of electrostatic focusing

155
8 Reference Interaction Site Model of
Molecular Solvation

In addition to explicit and implicit solvation models, Amber also has a third class of solva-
tion model for molecular mechanics simulations, the reference interaction site model (RISM)
of molecular solvation[118–131]. RISM is available in AmberTools as rism1d (1D-RISM)
and an option in NAB (3D-RISM). In Amber, 3D-RISM is an option in [Link] and
[Link]. Details specific to using [Link] and [Link] can be found
in the Amber manual.

8.1 Introduction

RISM is an inherently microscopic approach, calculating the equilibrium distribution of the


solvent, from which all thermodynamic properties are then arrived at. Specifically, RISM is an
approximate solution to the Ornstein-Zernike (OZ) equation[119, 128, 129, 132, 133]

Z
h(r12 , Ω1 , Ω2 ) = c(r12 , Ω1 , Ω2 ) + ρ dr3 dΩ3 c(r13 , Ω1 , Ω3 ) h(r32 , Ω3 , Ω2 ), (8.1)

where r12 is the separation between particles 1 and 2 while Ω1 and Ω2 are their orientations
relative to the vector r12 . The two functions in this relation are h, the total correlation function,
and c, the direct correlation function. The total correlation function is defined as

hab (rab , Ωa , Ωb ) ≡ gab (rab , Ωa , Ωb ) − 1,

where gab is the pair-distribution function, which gives the conditional density distribution of
species b about a. Orientationally averaging over site α of species a and site γ of species b,
gives the familiar one dimensional site-site radial distribution function, gαγ (rαγ ).
For real mixtures, it is often convenient to speak in terms of a solvent, V, of high concentration
and a solute, U, of low concentration. A generic case of solvation is infinite dilution of the
solute, i.e. ρ U → 0. We can rewrite Equation (8.1), in the limit of infinite dilution, as a set of

157
8 Reference Interaction Site Model of Molecular Solvation

three equations:
Z
hVV (r12 , Ω1 , Ω2 ) = cVV (r12 , Ω1 , Ω2 ) + ρ V dr3 dΩ3 cVV (r13 , Ω1 , Ω3 ) hVV (r32 , Ω3 , Ω2 ),
(8.2)
Z
hUV (r12 , Ω1 , Ω2 ) = cUV (r12 , Ω1 , Ω2 ) + ρ V dr3 dΩ3 cUV (r13 , Ω1 , Ω3 ) hVV (r32 , Ω3 , Ω2 ),
(8.3)
Z
hUU (r12 , Ω1 , Ω2 ) = cUU (r12 , Ω1 , Ω2 ) + ρ V dr3 dΩ3 cUV (r13 , Ω1 , Ω3 ) hUV (r32 , Ω3 , Ω2 ).
(8.4)
Equation (8.3) is directly relevant for biomolecular simulations where we are often interested
in the properties of a single, arbitrarily complex solute in the solution phase. Solutions to
Equation (8.3) can be obtained using 3D-RISM. However, a solution to Equation (8.2) for pure
solvent is a necessary prerequisite and is readily obtained from 1D-RISM.
To obtain a solution to the OZ equations it is necessary to have a second equation that relates
h and c or uniquely defines one of these functions. The general closure relation is[132]
g(r12 , Ω1 , Ω2 ) = exp [−β u(r12 , Ω1 , Ω2 ) + h(r12 , Ω1 , Ω2 ) − c(r12 , Ω1 , Ω2 ) + b(r12 , Ω1 , Ω2 )]
(8.5)
u is the potential energy function for the two particles and b is known as the bridge function
(a non-local functional representable as infinite diagrammatic series in terms of h [132]). It
should be noted that u is the only point at which the interaction potential enters the equations.
Depending on the method used to solve the OZ equations, u is generally an explicit potential.
In principle, it should now be possible to solve our two equations. For example, we may wish
to use SPC/E as a water model. Inputting the relevant aspects of the SPC/E model into u,
1D-RISM can be used to calculate the equilibrium properties of the SPC/E model. A different
explicit water model will yield different properties.
A fundamental problem for all OZ-like integral equation theories is the bridge function,
which contains multiple integrals that are readily solved only in special circumstances. In prac-
tice, an approximate closure relation must be used. While many closures have been developed,
at this time only two are implemented in 3D-RISM: hypernetted-chain approximation (HNC)
and Kovalenko-Hirata (KH).
In the case of HNC b = 0, giving[132]
g(r12 , Ω1 , Ω2 ) = exp [−β u(r12 , Ω1 , Ω2 ) + h(r12 , Ω1 , Ω2 ) − c(r12 , Ω1 , Ω2 )] (8.6)
HNC works well in many situations, including charged particles, but has difficulties when the
size ratios of particles in the system are highly varied and may not always converge on a solution
when one should exist. Also, as the bridge term is generally repulsive, HNC allows particles to
approach too closely, overestimating non-Coulombic interactions[129].
KH is a combination of HNC and the mean spherical approximation (MSA), the former being
applied to the spatial regions of solvent density depletion (g < 1), including the repulsive core,
and the latter to those of solvent density enrichment (g > 1), such as association peaks[128, 129]
(  
exp −β u(r12 , Ω1 , Ω2 ) + h(r12 , Ω1 , Ω2 ) − c(r12 , Ω1 , Ω2 ) for g(r12 , Ω1 , Ω2 ) ≤ 1
g(r12 , Ω1 , Ω2 ) = .
1 − β u(r12 , Ω1 , Ω2 ) + h(r12 , Ω1 , Ω2 ) − c(r12 , Ω1 , Ω2 ) for g(r12 , Ω1 , Ω2 ) > 1
(8.7)

158
8.1 Introduction

Like HNC, KH handles Coulombic systems well but overestimates non-Coulombic interac-
tions. Unlike HNC, it does not have difficulties with highly asymmetric particle sizes and does
converge to stable solutions for all stable parts of the phase diagram. The reliability of the KH
closure makes it particularly suitable for molecular mechanics calculations.

8.1.1 1D-RISM
1D-RISM is used to calculate bulk properties of the solvent and is a prerequisite for 3D-
RISM, where the primary result is the bulk solvent site-site susceptibility in reciprocal space,
χ VV (k). As its name would suggest, 1D-RISM is a one-dimensional calculation. The six-
dimensional OZ equations are reduced to one dimension via the fundamental RISM approximation[119–
122, 132, 133], which produces the intramolecular pair correlation matrix,

ωαγ (k) = sin(krαγ )/(krαγ ) (8.8)

where α and γ label the different atom types in the model. Note that atoms of the same type
in RISM theory have the same Lennard-Jones and Coulomb parameters. For example, most
three site water models have two RISM types, oxygen and hydrogen. Depending on the model,
propane, C3 H8 , may have two carbon types and two hydrogen types. Equation (8.2) then be-
comes
Z
hαγ (r) = ∑ dr0 dr00 ωα µ ( r − r0 )cµν ( r0 − r00 ) ωνγ (r00 ) + ρν hνγ (r00 )
 
µν
1
Z h i
= eik·r dk ωc [1 − ρωc]−1 ω
(2π)3 αγ

= ∑ ω(k)c(k)ω(k) [ρc(k)ω(k)]n . (8.9)
0

Equation (8.9) is complemented with either the 1D-HNC closure, a one-dimensional, site-site
version of Equation (8.6),
 
gαγ (r) = exp −β uαγ (r) + hαγ (r) − cαγ (r) , (8.10)
or the 1D-KH closure, a one-dimensional version of Equation (8.7) [129],
(  
exp −β uαγ (r) + hαγ (r) − cαγ (r) for gαγ (r) ≤ 1
gαγ (r) = . (8.11)
1 − β uαγ (r) + hαγ (r) − cαγ (r) for gαγ (r) > 1
Equations (8.9)-(8.11) are readily applicable to liquid mixtures, with site indices of the site-
site correlation functions enumerating interaction sites on all (different) species in the solution
and the intramolecular matrix (8.8) set equal to zero for sites α, γ belonging to different species.
A dielectrically consistent version of 1D-RISM theory (DRISM) enforces the proper dielec-
tric asymptotics of the site-site correlation functions, and so provides the self-consistent dielec-
tric properties of electrolyte solution with polar solvent and salt in a range of concentrations,
including the given dielectric constant of the solution [134].
The 1D-RISM integral equations are then solved for the site-site direct correlation function
in an iterative manner, accelerated by the modified direct inversion of the iterative subspace

159
8 Reference Interaction Site Model of Molecular Solvation

(MDIIS) [129, 135]. All correlation functions are represented as one-dimensional grids and the
convolution integrals in Equation (8.9) are performed in reciprocal space by making use of a fast
Fourier transform applied to the short-range parts of all the correlations, while the electrostatic
asymptotics are separated out and Fourier transformed analytically [129–131].

8.1.2 3D-RISM
With the results from 1D-RISM, a 3D-RISM calculation for a specific solute can be carried
out. For 3D-RISM calculations, only the solvent orientational degrees of freedom are averaged
over and Equation (8.3) becomes[127, 128]
Z
dr0 cUV r − r0 χαγ
 VV 0
hUV
γ (r) = ∑ α (r ), (8.12)
α
VV (R) is the site-site susceptibility of the solvent, obtained from 1D-RISM and given
whereχαγ
by
VV VV
χαγ (r) = ωαγ (r) + ρα hVV
αγ (r).
The 3D-KH closure is constructed using the same KH approximation but for the 3D site
correlation functions [128, 129],
(  
UV exp −β uUV UV UV
γ (r) + hγ (r) − cγ (r) for gUV
γ (r) ≤ 1
gγ (r) = . (8.13)
UV UV UV
1 − β uγ (r) + hγ (r) − cγ (r) UV
for gγ (r) > 1
As with 1D-RISM, correlation functions are represented on (3D) grids, convolution integrals
are performed in reciprocal space and a self-consistent solution is iteratively converged upon
using the MDIIS accelerated solver. There is one 3D grid for each solvent type for each corre-
lation function. For example, for a solute in SPC/E water there will be both gUV UV
H (r) and gO (r)
UV
grids. Each point on the gH (r) will give the fractional density of water hydrogen a that location
of real-space.
To properly treat electrostatic forces in electrolyte solution with polar molecular solvent and
ionic species, the electrostatic asymptotics of all the correlation functions (both the 3D and
radial ones) are treated analytically [129, 130, 136]. The non-periodic electrostatic asymptotics
are separated out in the direct and reciprocal space and the remaining short-range terms of the
correlation functions are discretized on a 3D grid in a non-periodic box large enough to ensure
decay of the short-range terms at the box boundaries [136]. The convolution of the short-range
terms in the integral equation (8.12) is calculated using 3D fast Fourier transform [137, 138].
Accordingly, the electrostatic asymptotics terms in the thermodynamics integral (8.14) below
are handled analytically and reduced to one-dimensional integrals easy to compute [136].
With a converged 3D-RISM solution for hUV and cUV it is straightforward to calculate sol-
vation thermodynamics. From the perspective of molecular simulations, the most important
thermodynamic values are the excess chemical potential of solvation (solvation free energy),
∆µ ex and the mean solvation force, fUVi (Ri ), on each solute atom, i. For both the HNC and KH
closures, the thermodynamic integration of solvation free energy can be performed analytically.
The KH closure gives
 
1 UV 2 1 UV
Z
ex V UV
 UV UV
∆µ = kB T ∑ ρα dr h (r) Θ −hα (r) − cα (r) − hα (r)cα (r) (8.14)
α 2 α 2

160
8.2 Practical Considerations

while for HNC the Heaviside function is replaced with 1 for all r [128, 129]. The force equation

∂ ∆µ ex ∂ uUV
α (r − Ri )
Z
fUV
i (Ri ) = − = − ∑ ρα drgUV
α (r)
∂ Ri α ∂ Ri

is valid for both the HNC and KH closure [118, 139, 140].
Equation(8.14) gives the total solvation free energy, ∆Gsol , but it is often useful to decompose
this into electrostatic (solvent polarization), ∆Gpol , and non-electrostatic (dispersion and cavity
formation), (∆Gcav + ∆Gdis ), terms. Conceptually, we can divide the path of the thermodynamic
integration into two steps: first the solute without partial charges is inserted into the solvent
(dispersion and cavity formation) and then partial charges are introduced, which polarize the
solvent,
∆µ ex = ∆Gsol = ∆Gpol + ∆Gcav + ∆Gdis .
∆Gsol is produced by a 3D-RISM calculation on the charged solute. ∆Gpol is then the difference
of the two calculations. Note that GB and PB methods calculate only ∆Gpol .

8.2 Practical Considerations


8.2.1 Computational Requirements and Parallel Scaling
Calculating a 3D-RISM solution for a single solute conformation typically requires about
100 times more computer time than the same calculation with explicit solvent or PB. While
there are other factors to consider, such as sampling confined solvent or overall efficiency of
sampling in the whole statistical ensemble at once, this can be prohibitive for many applications.
Memory is also an issue as the 3D correlation grids require anywhere from a few megabytes for
the smallest solutes to gigabytes for large complexes. The memory required can be estimated
as   

 

V
Total memory ≈ Nbox  |{z} 4 +N 2NMDIIS + |{z}
2  × 8 bytes (8.15)
 
| {z } 
asymptotics g,h
 
c,residual

where Nbox = Nx × Ny × Nz is the total number of grid points, N V is the number of solvent atom
species and NMDIIS is the number of MDIIS vectors used to accelerate convergence. A full grid
for g and h is required for each solvent species and four grids are required to compute the long
range asymptotics. Memory, therefore, scales linearly with Nbox while computation time scales
as O(Nbox log(Nbox )) due to the requirements of calculating the 3D fast Fourier transform (3D-
FFT). To overcome these requirements, two options are available beyond optimizations already
in place. Multiple time step methods (see the Amber manual) are applicable to molecular
dynamics only while parallelization is limited by system size and computational resources.
Both [Link] and NAB have MPI implementations of 3D-RISM (see Section 8.5.4
for NAB compiling instructions) that distribute both memory requirements and computational
load. As memory is distributed, the aggregate memory of many computers can be used to
perform calculations on very large systems. Memory distribution is handled by the FFTW
2.1.5 library so decomposition is done along the z-axis. If a variable solvation box size is
used, the only consideration is to avoid specifying a large, prime number of processes (≥ 7).

161
8 Reference Interaction Site Model of Molecular Solvation

For fixed box sizes, the number of grids points in each dimension must be divisible by two
(a general requirement) and the number of grid points in the z-axis must be divisible by the
number of processes. [Link] also has the additional consideration that the number
of processes cannot be larger than the number of solute residues; NAB does not suffer from this
limitation.

8.2.2 Output
gUV , hUV and cUV files can be output for 3D-RISM calculations and are useful for visual-
ization and calculation of thermodynamic quantities. These use the ASCII OpenDX file format
(Section 8.6.3) so there is
 one file for each solvent atom type for each requested frame. Each
file is 348 + Nbox × 16 13 bytes, which can quickly fill disk space. Also, very few visualization
programs capable of displaying both molecular and volumetric trajectories.

8.2.3 Numerical Accuracy


Numerical accuracy depends on the specified residual tolerance for the solution and the sol-
vation box physical size and grid spacing. Almost all applications should use a grid spacing
of 0.5 Å. A larger grid spacing quickly leads to severe errors in thermodynamic quantities.
Smaller grid spacing may be necessary for some applications (e.g., mapping potentials of mean
force) but this is rare and computationally expensive. A buffer distance between the solute
and the edges of the solvent box should typically be 14 Å for water or larger for ionic solu-
tions. Molecular dynamics[118], minimization and trajectory post-processing[141] have dif-
ferent requirements for the maximum residual tolerance. Molecular dynamics does well with
a tolerance of 10−5 and npropagate=5. Minimization requires tolerances of 10−11 or lower
and drms ≥ 10−4 . Trajectory post-processing for MM/RISM type calculations typically have
high statistical noise from the trajectory itself and it is possible to use a tolerance of 10−3 and
npropagate=1. However, this should be compared against a tolerance of 10−5 on a subset of
the data before committing to this level of accuracy.

8.3 Work Flow


Using 3D-RISM with SANDER or NAB for molecular dynamics, minimization or snapshot
analysis is very similar to using implicit solvent models like GBSA or PBSA. However, some
additional preliminary setup is required, the extent of which depends on the solvent to be used.
3D-RISM requires detailed information of the bulk solvent in the form of the site-site sus-
ceptibility, χ VV , and properties such as the temperature and partial charges. This is read in as a
.xvv file, which is produced by a 1D-RISM calculation. If another 3D-RISM calculation is to
be preformed with any details of the bulk solvent changed (e.g., temperature or pressure) a new
.xvv file must be produced. Examples of precomputed .xvv files for SPC/E and TIP3P water
can be found in $AMBERHOME/AmberTools/test/rism1d.
1D-RISM calculations require details of the some bulk properties of the solvent, such as tem-
perature and dielectric constant, and an explicit model of the molecular components. These are
read in from one or more .mdl files, depending on the composition of the solvent. Several .mdl

162
8.4 rism1d

files are included in the Amber11 distribution and can be found in $AMBERHOME/dat/rism1d/mdl.
These include many of the explicit models for solvent and ions used with the Amber force fields.
Other solvents models may be used by creating appropriate MDL files. See Section 8.6.1 for
format details.

8.4 rism1d
1D-RISM calculations are carried out with rism1d, and require only one input file with an
.inp suffix. The input file is listed on the command line without this suffix.

rism1d inputfile

Parameters for the calculation are read in from parameters name list.

8.4.1 Parameters keywords


There are no default parameters for rism1d. All of the following parameters should be spec-
ified in the input file.

[Link] Theory

theory [] The 1D-RISM theory to use.

DRISM Dielectrically consistent RISM (recommended).

XRISM Extended RISM.

closur [] The type of closure to use.

KH Kovalenko-Hirata (recommended).

HNC Hyper-netted chain equation.

PY Percus-Yevick.

VM Verlet modified.

VM0 Verlet modified.

[Link] Grid Size

dr [] Grid spacing in real space. 0.025 Å is recommended.

nr [] Number of grid points. Should be a product of small prime factors (2, 3 and 5).
16384 is recommended.

163
8 Reference Interaction Site Model of Molecular Solvation

[Link] Output

outlst [] Indicates what output files to produce. This is a list of any combination of the
following characters in any order, upper or lower case.
U U VV (r) Solvent site-site potential in real space.
X χ VV (k) Solvent site-site susceptibility in reciprocal space. Required input for
3D-RISM.
G GVV (r) Solvent site-site pair distribution function in real-space.
B BVV (r) Solvent site-site bridge correction in real space for VM and VM0 clo-
sures.
T Thermodynamic properties of the solvent.
E exN VV (r) Solvent site-site running excess coordination numbers in real space.
N N VV (r) Solvent site-site excess coordination numbers in real space.
S SVV (k) Solvent site-site structure factor in reciprocal space.

routup [] Largest real space separation in Å for output files. If 0 then all grid points will
be output.
−1
toutup [] Largest reciprocal space separation in Å for output files. If 0 then all grid
points will be output.
ksave [] Output an intermediate solution every ksave steps. If ksave <= 0 then no in-
termediate restart files are written. If any restart files are present at run time (.sav
suffix) they are automatically used. However, such files are non-portable binary
files.
kshow [] Write the current residue to standard output every kshow iteration. If kshow <=
0 then residue is not reported.

[Link] Species keywords

For each molecular species in the solvent mixture, a species name list should be provided.
There are only two parameters for this name list and no default values.
density [] Density of the species in M.
model [] Relative or absolute path to and name of the .mdl file with the parameters for this
solvent molecule.

[Link] Solution Convergence

nis [] Number of MDIIS vectors to use. 20 is recommended.


delvv [] MDIIS step size. 0.3 is recommended.
tolvv [] Target residual tolerance for the self-consistent solution. 10−12 is recommended.
maxste [] Maximum number of iterations to converge to a solution. 10000 is reasonable.

164
8.4 rism1d

[Link] Solvent Description

temper [] Temperature in Kelvin.

dieps [] Dielectric constant of the solvent.

nsp [] Number of species (molecules) in the solutions. Also indicates the number of
species name lists to follow.

[Link] Other

smear [] Electrostatic smear parameter. 1.0 is recommended.

adbcor [] 0.5 is recommended.

8.4.2 Example
Mixed ionic solvent.

&PARAMETERS
THEORY=’DRISM’, CLOSUR=’KH’, !Theory
NR=16384, DR=0.025, !Grid size and spacing
OUTLST=’x’, routup=384, toutup=0, !Output
NIS=20, DELVV=0.3, TOLVV=1.e-12, !MDIIS
KSAVE=-1, !Check pointing
KSHOW=1, !Output frequency
maxste=10000, !Maximum iterations
SMEAR=1, ADBCOR=0.5, !Electrostatics
TEMPER=310, DIEps=78.497, NSP=3 !bulk solvent properties
/
&SPECIES
!SPC/E water
DENSITY=55.296d0, !very close to 0.0333 1/A3
MODEL="../../../dat/rism1d/model/[Link]"
/
&SPECIES
!Sodium
DENSITY=.1d0,
MODEL="../../../dat/rism1d/model/Na+.mdl"
/
&SPECIES
!Chloride
DENSITY=.1d0,
MODEL="../../../dat/rism1d/model/[Link]"
/

165
8 Reference Interaction Site Model of Molecular Solvation

8.5 3D-RISM in NAB


3D-RISM functionality is available in NAB and is built as part of the standard install proce-
dure. MPI functionality for 3D-RISM in NAB requires some additional information at compile
time, described in Section 8.5.4. At this time, standard molecular dynamics and minimization
with non-polarizable force fields is supported.

8.5.1 Solvation Box Size


The non-periodic solvation box super-cell can be defined as variable or fixed in size. When a
variable box size is used, the box size will be adjusted to maintain a minimum buffer distance
between the atoms of the solute and the box boundary. This has the advantage of maintaining
the smallest possible box size while adapting to changes of solute shape and orientation. Alter-
natively, the box size can be specified at run-time. This box size will be used for the duration
of the molecular dynamics or minimization calculation.

8.5.2 I/O
All 3D-RISM options, including input and output files, are specified using mm_options()
(see Section 14.1). Generated output files can be quite large and numerous. For each type of
correlation, a separate file is produced for each solvent atom type. The frequency that files are
produced is controlled by the ntwrism parameter. Every time step that output is produced, a
new set of files is written with the time step number in the file name. For example, a molecular
dynamics calculation using an SPC/E water model with ntwrism=2 and guvfile=guv will
produce two files on time step ten: [Link] and [Link].

8.5.3 Examples
[Link] Molecular Dynamics
.
.
.
mm_options("ntpr=100, ntpr_md=100");
mm_options("dt=0.002"); //Large time step
mm_options("rattle=1"); //Use RATTLE
mm_options("cut=999.0"); //No solute-solute
//cut off
mm_options("rism=1"); //Use 3D-RISM-KH
mm_options("xvvfile=../rism1d/spc/[Link]"); //1D-RISM input
.
.
.

[Link] Minimization
.
.
.
mm_options("ntpr=1, cut=999.0"); //No solute-solute

166
8.6 File Formats

//cut off
mm_options("rism=1"); //Use 3D-RISM-KH
mm_options("xvvfile=../rism1d/spc/[Link]"); //1D-RISM input
mm_options("tolerance=1e-11"); //Low tolerance
mm_options("solvcut=999.0"); //No solute-solvent
//cut off
mm_options("centering=2"); //Center solute
//using center-
//of-geometry
.
.
.

8.5.4 Compiling MPI 3D-RISM


Executables compiled with MPI NAB and 3D-RISM must link to both C and Fortran MPI
libraries, which is not the default behaviour of most MPI compilers. As there are a wide va-
riety of MPI implementations and no standards for naming Fortran libraries, 3D-RISM is not
included by default when compiling NAB. The procedure to include 3D-RISM in MPI NAB is
a simple two step process.

1. Identify the Fortran 77 libraries corresponding to your MPI implementation. These will
be found in the lib directory for your MPI implementation and will likely contain “f”
or “f77” in the file name. For OpenMPI and MPICH2 these files are libmpi_f77.a
and libfmpich.a respectively (the suffix may vary). Set the XTRA_FLIBS environment
variable to contain the compiler directive to link the library. For example:
OpenMPI export XTRA_FLIBS=-lmpi_f77
MPICH2 export XTRA_FLIBS=-lfmpich

2. Run configure and specify both -mpi and -rismmpi. For example:

./configure -mpi -rismmpi gnu

8.6 File Formats


8.6.1 MDL
Solvent MoDeL (MDL) files use the prmtop specification. Each of the following sections
may appear in the file in any order. The Fortran string format specifications can be different
from the recommend values below.

%VERSION VERSION_STAMP = [Link] DATE = mm:dd:yy hh:mm:ss

The current version of the format is 0001.000. Date should be the date and time the file is created.

167
8 Reference Interaction Site Model of Molecular Solvation

%FLAG TITLE
%FORMAT(20a4)

Optional description of the file.

%FLAG POINTERS
%FORMAT(10I8)

Defines the lengths of arrays in the file.

NATOM Number of physical atoms in the model.

NSITE Number of unique solvent sites (share common Lennard-Jones parameters and partial charges).

%FLAG ATMNAME
%FORMAT(20a4)

CHARACTER(len=4)(NSITE) Four character name of each solvent site.

%FLAG MASS
%FORMAT(5e16.8)

REAL*8(NSITE) Mass of each solvent site (amu).

%FLAG CHG
%FORMAT(5e16.8)

REAL*8(NSITE) Partial charge for each solvent site (e).

%FLAG LJEPSILON
%FORMAT(5e16.8)

REAL*8(NSITE) Lennard-Jones ε for each solvent site (kcal/mol).

%FLAG LJSIGMA
%FORMAT(5e16.8)

REAL*8(NSITE) Lennard-Jones rmin (σ ∗ ) for each solvent site (Å). Note that this is not σ .

%FLAG MULTI
%FORMAT(10I8)

INTEGER*4(NSITE) Multiplicity of each solvent site. This should sum to NATOM.

168
8.6 File Formats

%FLAG COORD
%FORMAT(5e16.8)

REAL*8(3*NATOM) xyz-coordinates of each atom (Å).

8.6.2 XVV
Solvent site-site susceptibility, χ VV , files use the prmtop specification. Each of the following
sections may appear in the file in any order. The format specifications can be different from the
recommend values below.

%VERSION VERSION_STAMP = [Link] DATE = mm:dd:yy hh:mm:ss

The current version of the format is 0000.001. Date should be the date and time the file is created.

%FLAG POINTERS
%FORMAT(10I8)

Defines the lengths of arrays in the file.

NR VV (k).
Number of 1D grid points in χab

NSITE Number of solvent sites.

NSPECIES Number of solvent species (molecules).

%FLAG ATOM_NAME
%FORMAT(20a4)

CHARACTER(len=4)(NSITE) Four character name of each solvent site.

%FLAG MTV
%FORMAT(10I8)

INTEGER*4(NSITE) Multiplicity of each solvent site.

%FLAG RHOV
%FORMAT(5E16.8)

REAL*8(NSITE) Number density of each solvent site (Å−3 ).

%FLAG QV
%FORMAT(5E16.8)

REAL*8(NSITE) Partial charge for each solvent site (e).

169
8 Reference Interaction Site Model of Molecular Solvation

%FLAG QSPV
%FORMAT(5E16.8)

REAL*8(NSPECIES) Net charge for each solvent species (e).

%FLAG EPSV
%FORMAT(5E16.8)

REAL*8(NSITE) Lennard-Jones ε for each solvent site (kcal/mol).

%FLAG SIGV
%FORMAT(5E16.8)

REAL*8(NSITE) Lennard-Jones rmin (σ ∗ ) for each solvent site (Å). Note that this is not σ .

%FLAG DELHV0
%FORMAT(5E16.8)

REAL*8(NSITE) Long range Coulomb correction for each solvent site.

%FLAG XVV
%FORMAT(5E16.8)

VV (k). This array is stored in column major order. I.e., the NR index varies fastest.
REAL*8(NR,NSITE,NSITE) χab

8.6.3 OpenDX
3D correlation functions from 3D-RISM calculations use the ASCII version of the OpenDX
file format for volumetric data on regular grids as defined in the OpenDX user manual: http:
//[Link]/docs/html/pages/[Link]#HDREDF.

Header

object 1 class gridpositions counts Nx Ny Nz

Nx INTEGER*4. Number of grid points in the x dimension.

Ny INTEGER*4. Number of grid points in the y dimension.

Nz INTEGER*4. Number of grid points in the z dimension.

origin Ox Oy Oz

Ox REAL*8. x coordinate of grid origin in Cartesian space.

Oy REAL*8. y coordinate of grid origin in Cartesian space.

Oz REAL*8. z coordinate of grid origin in Cartesian space.

170
8.6 File Formats

delta dx 0 0
delta 0 dy 0
delta 0 0 dz

dx REAL*8. Linear grid size between in the x dimension.

dy REAL*8. Linear grid size between in the y dimension.

dz REAL*8. Linear grid size between in the z dimension.

object 2 class gridconnections counts Nx Ny Nz


object 3 class array type double rank 0 items N

N INTEGER*4. N = Nx × Ny × Nz.

Data

data(i,j,k) data(i,j,k+1) data(i,j,k+2)

data(i,j,k) REAL*8. Three data values per line with the last (z) index varying fastest for a total of N values.

Footer

object "Untitled" call field

171
9 Miscellaneous utilities

9.1 ambpdb
NAME ambpdb - convert amber-format coordinate files to pdb format

SYNOPSIS

ambpdb [ -p prmtop-file ][ -tit title ] [ -pqr|-bnd|-atm]


[ -aatm ] [-bres ] [-noter] [-ext] [-offset #] [-bin] [-first]

ambpdb is a filter to take a coordinate "restart" file from an AMBER dynamics or minimization
run (on STDIN) and prepare a pdb-format file (on STDOUT). The program assumes that a
prmtop file is available, from which it gets atom and residue names.
OPTIONS

-help Print a usage summary to the screen.


-tit The title, if given, will be output as a REMARK at the top of the file. It should be
protected by quotes or double quotes if it contains spaces or special characters.
-pqr If -pqr is set, output will be in the format needed for the electrostatics programs
that need charge and radius information.
-atm creates files used by Mike Connolly’s surface area/volume programs.
-bnd creates a file that lists the bonds in the molecule, one per line.
-aatm This switch controls whether the output atom names follow Amber or Brookhaven
(PDB) formats. With the default (when this switch is not set), atom names will
be placed into four columns following the rules used by the Protein Data Base in
Version 3.
-bin If -bin is set, an unformatted (binary) "restart" file is read instead of a formatted
one (default). Please note that no detection of the byte ordering happens, so binary
files should be read on the machine they were created on.
-bres If -bres (Brookhaven-residue-names) is not set (the default), Amber-specific atom
names (like CYX, HIE, RG5, etc.) will be kept in the pdb file; otherwise, these will
be converted to PDB-standard names (CYS, HIS, G, in the above example). Note

173
9 Miscellaneous utilities

that setting -bres creates a naming ambiguity between protonated and unprotonated
forms of amino acids.
If you plan to re-read the pdb file back into Amber programs, you should use the
default behavior; for programs that demand stricter conformance to Brookhaven
standards, set -bres.

-first If -first is set, a pdb file augmented by additional information about hydrogen
bonds, salt bridges, and hydrophobic tethers is generated, which can serve as in-
put to the stand alone version of the FIRST software by D. J. Jacobs, L. A. Kuhn,
and M. F. Thorpe to analyze the rigidity / flexibility of protein and nucleic acid
structures.[142, 143] The criteria to include hydrophobic tethers differ for protein
and nucleic acid structures. Note that currently not all modified RNA nucleosides
are explicitly considered and that DNA structures are treated according to a param-
eterization derived for RNA structures. Details about the RNA parameterization
can be found in ref.[144] .

-noter If -noter is set, the output PDB file not include TER cards between molecules.
Otherwise, TER cards will be added whenever there is not bond between adja-
cent residues. Note that this means there will be a TER card between each water
molecule, for example, unless -noter is set. The PDB is idiosyncratic about TER
cards: they are generally present between separate protein chains, but generally not
present between cofactors or solvent molecules. This behavior is not mimicked by
ambpdb.

-ext Use the “extended” pdb information in the prmtop file to recover the chain ID’s and
residue numbers that were present in the original pdb file used to make the prmtop
file.

-offset If a number is given here, it will be added to all residue numbers in the output
pdb file. This is useful if you want the first residue (which is always "1" in an
Amber prmtop file, to be a larger number, (say to more closely match a file from
Brookhaven, where initial residues may be missing). Note that the number you
provide is one less than what you want the first residue to have.
Residue numbers greater than 9999 will not "fit" into the Brookhaven format;
ambpdb actually prints mod(resno,10000); that is, after 9999, the residue number
re-cycles to 0.

FILES Assumes that a prmtop file (with that name, or the one given in the −p option) exists
in the current directory; reads AMBER coordinates from STDIN, and writes pdb-file to
STDOUT.

BUGS Inevitably, various niceties of the Brookhaven format are not as well supported as they
should be. The protonate program can be used to fix up hydrogen atom names, but that
functionality should really be integrated here. There is no good solution to the PDB
problem of using the same residue name for different chemical species; depending on
how the output file is to be used, the two options supported (setting or not setting -bres)

174
9.2 reduce

may or may not suffice. Radii used for the -pqr option are hard-wired into the code,
requiring a re-compilation if they are to be changed. Atom name output may be incorrect
for atoms with two-character atomic symbols, like calcium or iron. The -offset flag is
a very limited start toward more flexible handling of residue numbers; in the future (we
hope!) Amber prmtop files will keep track of the "original" residue identifiers from input
pdb files, so that this information would be available on output.

9.2 reduce
Reduce is aprogram for adding hydrogens to a Protein DataBank (PDB) molecular structure
file. It was developed by J. Michael Word at Duke University in the lab of David and Jane
Richardson. Reduce is described in: Word, et. al. (1999) Asparagine and Glutamine: Using
Hydrogen Atom Contacts in the Choice of Side-chain Amide Orientation, J. Mol. Biol. 285,
1733-1747.
Both proteins and nucleic acids can have hydrogens added. HET groups can also be pro-
cessed as long as the atom connectivity is provided. A slightly modified version of the con-
nectivity table provided by the PDB is included. The latest version of reduce is available at
[Link] The version bundled with AmberTools 1.4 is re-
duce.3.14.080821. See the files in $AMBERHOME/AmberTools/src/reduce for more informa-
tion. The information below is taken from the [Link] file.

9.2.1 Running reduce


In most circumstances, the recommended command when using reduce to add hydrogens to
a PDB file and standardize the bond lengths of existing hydrogens is

reduce -build [Link] > [Link]

which includes the optimization of adjustable groups (OH, SH, NH3+, Met-CH3, and Asn, Gln
and His sidechain orientation). When speed is important, the -build option can be dropped;
hydrogens will still be added, but not His side-chain NH hydrogens, and side-chains will not be
flipped. For even greater speed, but even less accuracy, adding -nooh and -noadj will skip the
OH and SH hydrogens and eliminate optimization altogether. Input is from the specified PDB
format coordinate file and the new, updated PDB coordinates are written to "standard output",
here redirected to a file with the ’>’ symbol.
Disulfides, covalent modifications, and connection of the ribose-phosphate nucleic acid back-
bone, are recognized and any hydrogens eliminated by bonding are skipped. When an amino
acid main-chain nitrogen is not connected to the preceeding residue or some other group, re-
duce treats it as the N-terminus and constructs an NH3+ only if the residue number is less
than or equal to an ajustable limit (1, by default). Otherwise, it considers the residue to be
the observable beginning of an actually-connected fragment and does not protonate the nitro-
gen. Reduce does not protonate carboxylates (including the C-terminus) bacause it does not
specifically consider pH, instead modeling a neutral environment.
Hydrogens are positioned with respect to the covalently bonded neighbors and these are
identified by name. Non-standard atom names are the primary cause of missing or misplaced

175
9 Miscellaneous utilities

hydrogens. If reduce tries to process a file which contains hydrogens with non-standard names,
the existing hydrogens may not be recognized and may interfere with the generation of new
hydrogens. The solution may be to remove existing hydrogens before further processing.
Hydrogens can be removed from a pdb format file with reduce.

reduce -trim 1abcH > 1abc

This can be used, for example, to update the orientation of Asn/Gln/His side chains where the
H atoms are not wanted; first build the hydrogens and then trim them back out. Trimming
can occasionally be fooled if a hydrogen has been given a non-standard name. The most com-
mon example of this comes from left-justified atom names: gamma hydrogens masquerade as
mercury atoms! In this case, manual editing may be required.

9.2.2 General input flags


The following brief description of the command line flags is displayed with the -h flag:

$ reduce -h
reduce: version 2.20 6/03/03, Copyright 1997-2003, J. Michael Word
arguments: [-flags] filename or -
Adds hydrogens to a PDB format file and writes to standard output.
(note: By default, HIS sidechain NH protons are not added. See -BUILD)
Flags:
-Trim remove (rather than add) hydrogens
-NOOH remove hydrogens on OH and SH groups
-OH add hydrogens on OH and SH groups (default)
-HIS create NH hydrogens on HIS rings
-FLIPs allow complete ASN, GLN and HIS sidechains to flip
(usually used with -HIS)
-NOHETh do not attempt to add NH proton on Het groups
-ROTNH3 allow lysine NH3 to rotate (default)
-NOROTNH3 do not allow lysine NH3 to rotate
-ROTEXist allow existing rotatable groups (OH, SH, Met-CH3) to rotate
-ROTEXOH allow existing OH & SH groups to rotate
-ALLMEthyls allow all methyl groups to rotate
-ONLYA only adjust ’A’ conformations (default)
-ALLALT process adjustments for all conformations
-NOROTMET do not rotate methionine methyl groups
-NOADJust do not process any rot or flip adjustments
-BUILD add H, including His sc NH, then rotate and flip groups
(except for pre-existing methionine methyl hydrogens)
(same as: -OH -ROTEXOH -HIS -FLIP)
-Keep keep bond lengths as found
-NBonds# remove dots if cause within n bonds (default=3)
-Model# which model to process (default=1)
-Nterm# max number of nterm residue (default=1)

176
9.2 reduce

-DENSity#.# dot density (in dots/A^2) for VDW calculations (Real)


-RADius#.# probe radius (in A) for VDW calculations (Real, default=0)
-OCCcutoff#.# occupancy cutoff for adjustments (default=0.01)
-H2OOCCcutoff#.# occupancy cutoff for water atoms (default=0.66)
-H2OBcutoff# B-factor cutoff for water atoms (Integer, default=40)
-PENalty#.# fraction of std. bias towards original orientation
-HBREGcutoff#.# over this gap regular HBonds bump (default=0.6)
-HBCHargedcut#.# over this gap charged HBonds bump (default=0.8)
-BADBumpcut#.# at this gap a bump is ’bad’ (default=0.4)
-METALBump#.# H ’bumps’ metals at radius plus this (default=0.865)
-NONMETALBump#.# ’bumps’ nonmetal at radius plus this (default=0.125)
-SEGIDmap "seg,c..." assign chainID based on segment identifier field
-Xplor use Xplor conventions for naming polar hydrogens
-NOCon drop conect records
-LIMIT# max num iter. for exhaustive search (default=100000)
-NOTICKs do not display the set orientation ticker during processing
-SHOWSCore display scores for each orientation considered during proce
-FIX "filename" if given, file specifies orientations for adjustable groups
-DB "filename" file to search for het info
note: can also redirect with unix environment variable: REDUCE_HET_DICT
-Quiet do not write extra info to the console
-REFerence display citation reference
-Help more extensive description of command line arguments

9.2.3 Fixing an orientation

At times it is useful to control the flip state or rotation angle of an adjustable group when
adding hydrogens, either because the correct orientation has already been established, allowing
the optimization time to be reduced, or because a non-optimal orientation is sought.
One of the command line flags (-fix [Link]) takes a file containing information about
which conformation to set for one or more adjustable groups. The colon delimited format is
similar to the orientation data that reduce prints in the header file

action:residueID:comment

(one line for each group to be fixed) and because spacing matters in the residue identifier string,
the easiest way to produce this file is to copy and edit USER MOD records from reduce output.
The action can be one of three kinds, depending on residue type: O to leave in the original
orientation, F to flip the orientation, and R# to rotate a dihedral to an angle of #deg. Using
either O or F with His sidechains allows the protonation state to vary; to specify a particular
orientation and protonation state use F# where # is the number of the state (1, 2 or 3 for the
original orientation with H (1) only on NE2, (2) only on ND1, or (3) doubly protonated; 4-6 for
the corresponding three flipped states).

177
9 Miscellaneous utilities

9.2.4 Cliques
The current version of reduce uses brute-force enumeration to optimize the conformations
of ajustable groups. If a ’clique’ of adjustble groups is too large (> ~7) this sort of search
technique is inadequate–the enumeration will be abandoned and these groups will be left in
their original conformations. The cuttoff point is based on the total number of permutations,
which the user can control with the -limit# option. Although we are considering more pwerful
search techniques for these situations, some work-around strategies have been developed.
First check to see if distinct chainIDs are provided for each chain. Reduce does not support
files which specify chain information only in the segID field and can get confused.
Examination of the clique may reveal that the orientations of one or more groups are obvi-
ous; for instance, they may interact with obligate H-bond donors or acceptors. By fixing the
orientation of these groups (as described above), the total number of permutations is reduced.
This is especially effective if it breaks the clique into smaller sum-cliques or singletons.
An alternative way to break up cliques is to rotate all the methionine CH3s and
lysine/N-terminus NH3+s in an initial pass, then keep them fixed in a second pass.

reduce -nooh inputfile | reduce -build -norotmet -norotnh3 - > outputfileH

The single dash towards the end of the command line tells reduce to read data piped (’|’) from
the first pass rather than from a file. A fiew NH3+ H-bonds may have inferior geometry with
this two pass approach but the result is otherwise comparable to using -build alone and can
be combined with the previous approach, if neccessary. With this technique, unusual cliques
requiring many hours to process have been converted into several smaller problems which wer
all solved in a matter of minutes.

9.2.5 Contact
If you use reduce, I would appreciate any comments you send my way.
J. Michael Word
e-mail: [Link]@[Link] voice: (919)483-3522
Richardson Lab, Biochemistry Department, Duke University ,Durham, NC USA 27710

9.3 elsize
NAME

elsize - Given the structure, estimates its effective electrostatic size


(parameter Arad ) need by the ALPB model.

SYNOPSIS

Usage: elsize input-pqr-file [-options]


-det an estimate based on structural invariants. DEFAULT.

178
9.3 elsize

-ell an estimate via elliptic integral (numerical).


-elf same as above, but via elementary functions.
-abc prints semi-axes of the effective ellipsoid.
-tab prints all of the above into a table without header.
-hea prints same table as -tab but with a header.
-deb prints same as -tab with some debugging information.
-xyz uses a file containing only XYZ coordinates.

DESCRIPTION

elsize is a program originally written by G. Sigalov to estimate the effective electrostatic size
of a structure via a quick, analytical method. The algorithm is presented in detail in Ref. .[145]
You will need your structure in a pqr format as input, which can be easily obtained from the
prmtop and inpcrd files using ambpdb utility described above:
ambpdb -p prmtop -pqr < inpcrd > input-file-pqr

After that you can simply do: elsize input-file-pqr , the value of electrostatic size in Angstroms
will be output on stdout. The source code is in the src/etc/ directory, its comments contain
more extensive description of the options and give an outline of the algorithm. A somewhat
less accurate estimate uses just the XYZ coordinates of the molecule and assumes the default
radius size of for all atoms:
elsize input-file-xyz

This option is not recommended for very small compounds. The code should not be used on
structures made up of two or more completely disjoint" compounds – while the code will still
produce a finite value of Arad , it is not very meaningful. Instead, one should obtain estimates
for each compound separately.

179
10 NAB: Introduction
Nucleic acid builder (nab) is a high-level language that facilitates manipulations of macro-
molecules and their fragments. nab uses a C-like syntax for variables, expressions and control
structures (if, for, while) and has extensions for operating on molecules (new types and a large
number of builtins for providing the necessary operations). We expect nab to be useful in model
building and coordinate manipulation of proteins and nucleic acids, ranging in size from fairly
small systems to the largest systems for which an atomic level of description makes good com-
putational sense. As a programming language, it is not a solution or program in itself, but
rather provides an environment that eases many of the bookkeeping tasks involved in writing
programs that manipulate three-dimensional structural models.
The current implementation is version 6.0, and incorporates the following main features:
1. Objects such as points, atoms, residues, strands and molecules can be referenced and
manipulated as named objects. The internal manipulations involved in operations like
merging several strands into a single molecule are carried out automatically; in most
cases the programmer need not be concerned about the internal data structures involved.
2. Rigid body transformations of molecules or parts of molecules can be specified with a
fairly high-level set of routines. This functionality includes rotations and translations
about particular axis systems, least-squares atomic superposition, and manipulations of
coordinate frames that can be attached to particular atomic fragments.
3. Additional coordinate manipulation is achieved by a tight interface to distance geome-
try methods. This allows allows relationships that can be defined in terms of internal
distance constraints to be realized in three-dimensional structural models. nab includes
subroutines to manipulate distance bounds in a convenient fashion, in order to carry out
tasks such as working with fragments within a molecule or establishing bounds based on
model structures.
4. Force field calculations (e.g. molecular dynamics and minimization) can be carried out
with an implementation of the AMBER force field. This works in both three and four
dimensions, but periodic simulations are not (yet) supported. However, the generalized
Born models implemented in Amber are also implemented here, which allows many in-
teresting simulations to be carried out without requiring periodic boundary conditions.
The force field can be used to carry out minimization, molecular dynamics, or normal
mode calculations. Conformational searching and docking can be carried out using a
"low-mode" (LMOD) procedure that performs sampling exploring the potential energy
surface along low-frequency vibrational directions.
5. nab also implements a form of regular expressions that we call atom regular expressions,
which provide a uniform and convenient method for working on parts of molecules.

181
10 NAB: Introduction

6. Many of the general programming features of the awk language have been incorporated
in nab. These include regular expression pattern matching, hashedarrays (i.e. arrays with
strings as indices), the splitting of strings into fields, and simplified string manipulations.

7. There are built-in procedures for linking nab routines to other routines written in C or
Fortran, including access to most library routines normally available in system math li-
braries.

Our hope is that nab will serve to formalize the step-by-step process that is used to build com-
plex model structures, and will facilitate the management and use of higher level symbolic
constraints. Writing a program to create a structure forces more of the model’s assumptions to
be explicit in the program itself. And an nab description can serve as a way to show a model’s
salient features, much like helical parameters are used to characterize duplexes.
The first three chapters of this document both introduces the language through a series of
sample programs, and illustrates the programming interfaces provided. The examples are cho-
sen not only to show the syntax of the language, but also to illustrate potential approaches to the
construction of some unusual nucleic acids, including DNA double- and triple-helices, RNA
pseudoknots, four-arm junctions, and DNA-protein interactions. A separate reference manual
(in Chapter 4) gives a more formal and careful description of the requirements of the language
itself.
The basic literature reference for the code is T. Macke and D.A. Case. Modeling unusual
nucleic acid structures. In Molecular Modeling of Nucleic Acids, N.B. Leontes and J. SantaLu-
cia, Jr., eds. (Washington, DC: American Chemical Society, 1998), pp. 379-393. Users are
requested to include this citation in papers that make use of NAB.
The authors thank Jarrod Smith, Garry Gippert, Paul Beroza, Walter Chazin, Doree Sitkoff
and Vickie Tsui for advice and encouragement. Special thanks to Neill White (who helped in
updating documentation, in preparing the distance geometry database, and in testing and porting
portions of the code), and to Will Briggs (who wrote the fiber-diffraction routines). Thanks also
to Chris Putnam and M.L. Dodson for bug reports.

10.1 Background
Using a computer language to model polynucleotides follows logically from the fundamental
nature of nucleic acids, which can be described as “conflicted” or “contradictory” molecules.
Each repeating unit contains seven rotatable bonds (creating a very flexible backbone), but
also contains a rigid, planar base which can participate in a limited number of regular interac-
tions, such as base pairing and stacking. The result of these opposing tendencies is a family of
molecules that have the potential to adopt a virtually unlimited number of conformations, yet
have very strong preferences for regular helical structures and for certain types of loops.
The controlled flexibility of nucleic acids makes them difficult to model. On one hand, the
limited range of regular interactions for the bases permits the use of simplified and more abstract
geometric representations. The most common of these is the replacement of each base by a
plane, reducing the representation of a molecule to the set of transformations that relate the
planes to each other. On the other hand, the flexible backbone makes it likely that there are
entire families of nucleic acid structures that satisfy the constraints of any particular modeling

182
10.1 Background

problem. Families of structures must be created and compared to the model’s constraints. From
this we can see that modeling nucleic acids involves not just chemical knowledge but also three
processes-abstraction, iteration and testing-that are the basis of programming.
Molecular computation languages are not a new idea. Here we briefly describe some past
approaches to nucleic acid modeling, to provide a context for nab.

10.1.1 Conformation build-up procedures


MC-SYM[146–148] is a high level molecular description language used to describe single
stranded RNA molecules in terms of functional constraints. It then uses those constraints to
generate structures that are consistent with that description. MC-SYM structures are created
from a small library of conformers for each of the four nucleotides, along with transformation
matrices for each base. Building up conformers from these starting blocks can quickly generate
a very large tree of structures. The key to MC-SYM’s success is its ability to prune this tree,
and the user has considerable flexibility in designing this pruning process.
In a related approach, Erie et al.[149] used a Monte-Carlo build-up procedure based on sets
of low energy dinucleotide conformers to construct longer low energy single stranded sequences
that would be suitable for incorporation into larger structures. Sets of low energy dinucleotide
conformers were created by selecting one value from each of the sterically allowed ranges
for the six backbone torsion angles and χ. Instead of an exhaustive build- up search over a
small set of conformers, this method samples a much larger region of conformational space
by randomly combining members of a larger set of initial conformers. Unlike strict build-up
procedures, any member of the initial set is allowed to follow any other member, even if their
corresponding torsion angles do not exactly match, a concession to the extreme flexibility of
the nucleic acid backbone. A key feature determined the probabilities of the initial conformers
so that the probability of each created structure accurately reflected its energy.
Tung and Carter[150, 151] have used a reduced coordinate system in the NAMOT (nucleic
acid modeling tool) program to rotation matrices that build up nucleic acids from simplified
descriptions. Special procedures allow base-pairs to be preserved during deformations. This
procedure allows simple algorithmic descriptions to be constructed for non-regular structures
like intercalation sites, hairpins, pseudoknots and bent helices.

10.1.2 Base-first strategies


An alternative approach that works well for some problems is the "base-first" strategy, which
lays out the bases in desired locations, and attempts to find conformations of the sugar-phosphate
backbone to connect them. Rigid-body transformations often provide a good way to place the
bases. One solution to the backbone problem would be to determine the relationship between
the helicoidal parameters of the bases and the associated backbone/sugar torsions. Work along
these lines suggests that the relationship is complicated and non-linear.[152] However, con-
siderable simplification can be achieved if instead of using the complete relationship between
all the helicoidal parameters and the entire backbone, the problem is limited to describing the
relationship between the helicoidal parameters and the backbone/sugar torsion angles of sin-
gle nucleotides and then using this information to drive a constraint minimizer that tries to
connect adjacent nucleotides. This is the approach used in JUMNA,[153] which decomposes

183
10 NAB: Introduction

the problem of building a model nucleic acid structure into the constraint satisfaction problem
of connecting adjacent flexible nucleotides. The sequence is decomposed into 3’-nucleotide
monophosphates. Each nucleotide has as independent variables its six helicoidal parameters,
its glycosidic torsion angle, three sugar angles, two sugar torsions and two backbone torsions.
JUMNA seeks to adjust these independent variables to satisfy the constraints involving sugar
ring and backbone closure.
Even constructing the base locations can be a non-trivial modeling task, especially for non-
standard structures. Recognizing that coordinate frames should be chosen to provide a simple
description of the transformations to be used, Gabarro-Arpa et al.[154] devised “Object Com-
mand Language” (OCL), a small computer language that is used to associate parts of molecules
called objects, with arbitrary coordinate frames defined by sets of their atoms or numerical
points. OCL can “link” objects, allowing other objects’ positions and orientations to be de-
scribed in the frame of some reference object. Information describing these frames and links is
written out and used by the program MORCAD[155] which does the actual object transforma-
tions.
OCL contains several elements of a molecular modeling language. Users can create and
operate on sets of atoms called objects. Objects are built by naming their component atoms
and to simplify creation of larger objects, expressions, IF statements, an iterated FOR loop and
limited I/O are provided. Another nice feature is the equivalence between a literal 3-D point and
the position represented by an atom’s name. OCL includes numerous built-in functions on 3-
vectors like the dot and cross products as well as specialized molecular modeling functions like
creating a vector that is normal to an object. However, OCL is limited because these language
elements can only be assembled into functions that define coordinate frames for molecules that
will be operated on by MORCAD. Functions producing values of other data types and stand-
alone OCL programs are not possible.

10.2 Methods for structure creation


As a structure-generating tool, nab provides three methods for building models. They are
rigid-body transformations, metric matrix distance geometry, and molecular mechanics. The
first two methods are good initial methods, but almost always create structures with some dis-
tortion that must be removed. On the other hand, molecular mechanics is a poor initial method
but very good at refinement. Thus the three methods work well together.

10.2.1 Rigid-body transformations


Rigid-body transformations create model structures by applying coordinate transformations
to members of a set of standard residues to move them to new positions and orientations where
they are incorporated into the growing model structure. The method is especially suited to
helical nucleic acid molecules with their highly regular structures. It is less satisfactory for
more irregular structures where internal rearrangement is required to remove bad covalent or
non-bonded geometry, or where it may not be obvious how to place the bases.
nab uses the matrix type to hold a 4×4 transformation matrix. Transformations are applied to
residues and molecules to move them into new orientations or positions. nab does not require

184
10.2 Methods for structure creation

that transformations applied to parts of residues or molecules be chemically valid. It simply


transforms the coordinates of the selected atoms leaving it to the user to correct (or ignore) any
chemically incorrect geometry caused by the transformation.
Every nab molecule includes a frame, or “handle” that can be used to position two molecules
in a generalization of superimposition. Traditionally, when a molecule is superimposed on a
reference molecule, the user first forms a correspondence between a set of atoms in the first
molecule and another set of atoms in the reference molecule. The superimposition algorithm
then determines the transformation that will minimize the rmsd between corresponding atoms.
Because superimposition is based on actual atom positions, it requires that the two molecules
have a common substructure, and it can only place one molecule on top of another and not at
an arbitrary point in space.
The nab frame is a way around these limitations. A frame is composed of three orthonormal
vectors originally aligned along the axes of a right handed coordinate frame centered on the
origin. nab provides two builtin functions setframe() and setframep() that are used to reposition
this frame based on vectors defined by atom expressions or arbitrary 3-D points, respectively.
To position two molecules via their frames, the user moves the frames so that when they are
superimposed via the nab builtin alignframe(), the two molecules have the desired orientation.
This is a generalization of the methods described above for OCL.

10.2.2 Distance geometry


nab’s second initial structure-creation method is metric matrix distance geometry,[156, 157]
which can be a very powerful method of creating initial structures. It has two main strengths.
First, since it uses internal coordinates, the initial position of atoms about which nothing is
known may be left unspecified. This has the effect that distance geometry models use only the
information the modeler considers valid. No assumptions are required concerning the positions
of unspecified atoms. The second advantage is that much structural information is in the form
of distances. These include constraints from NMR or fluorescence energy transfer experiments,
implied propinquities from chemical probing and footprinting, and tertiary interactions inferred
from sequence analysis. Distance geometry provides a way to formally incorporate this infor-
mation, or other assumptions, into the model-building process.
Distance geometry converts a molecule represented as a set of interatomic distances into a
3-D structure. nab has several builtin functions that are used together to provide metric matrix
distance geometry. A bounds object contains the molecule’s interatomic distance bounds matrix
and a list of its chiral centers and their volumes. The function newbounds() creates a bounds
object containing a distance bounds matrix containing initial upper and lower bounds for every
pair of atoms, and a list of the molecule’s chiral centers and their volumes. Distance bounds
for pairs of atoms involving only a single residue are derived from that residue’s coordinates.
The 1,2 and 1,3 distance bounds are set to the actual distance between the atoms. The 1,4
distance lower bound is set to the larger of the sum of the two atoms Van der Waals radii or
their syn (torsion angle = 0o) distance, and the upper bound is set to their anti (torsion angle
= 180o) distance. newbounds() also initializes the list of the molecule’s chiral centers. Each
chiral center is an ordered list of four atoms and the volume of the tetrahedron those four atoms
enclose. Each entry in a nab residue library contains a list of the chiral centers composed
entirely of atoms in that residue.

185
10 NAB: Introduction

Once a bounds object has been initialized, the modeler can use functions to tighten, loosen or
set other distance bounds and chiralities that correspond to experimental measurements or parts
of the model’s hypothesis. The functions andbounds() and orbounds() allow logical manipula-
tion of bounds. setbounds_from_db() Allows distance information from a model structure or
a database to be incorporated into a part of the current molecule’s bounds object, facilitating
transfer of information between partially-built structures.
These primitive functions can be incorporated into higher-level routines. For example the
functions stack() and watsoncrick() set the bounds between the two specified bases to what they
would be if they were stacked in a strand or base-paired in a standard Watson/Crick duplex,
with ranges of allowed distances derived from an analysis of structures in the Nucleic Acid
Database.
After all experimental and model constraints have been entered into the bounds object, the
function tsmooth() applies “triangle smoothing” to pull in the large upper bounds, since the
maximum distance between two atoms can not exceed the sum of the upper bounds of the
shortest path between them. Random pairwise metrization[158] can also be used to help ensure
consistency of the bounds and to improve the sampling of conformational space. The function
embed() finally takes the smoothed bounds and converts them into a 3-D object. The newly
embedded coordinates are subject to conjugate gradient refinement against the distance and
chirality information contained in bounds. The call to embed() is usually placed in a loop to
explore the diversity of the structures the bounds represent.

10.2.3 Molecular mechanics

The final structure creation method that nab offers is molecular mechanics. This includes
both energy minimization and molecular dynamics - simulated annealing. Since this method
requires a good estimate of the initial position of every atom in a structure, it is not suitable for
creating initial structures. However, given a reasonable initial structure, it can be used to remove
bad initial geometry and to explore the conformational space around the initial structure. This
makes it a good method for refining structures created either by rigid body transformations or
distance geometry. nab has its own 3-D/4-D molecular mechanics package that implements
several AMBER force fields and reads AMBER parameter and topology files. Solvation effects
can also be modelled with generalized Born continuum models.
Our hope is that nab will serve to formalize the step-by-step process that is used to build
complex model structures. It will facilitate the management and use of higher level symbolic
constraints. Writing a program to create a structure forces one to make explicit more of the
model’s assumptions in the program itself. And an nab description can serve as a way to
exhibit a model’s salient features, much like helical parameters are used to characterize du-
plexes. So far, nab has been used to construct models for synthetic Holliday junctions,[159]
calcyclin dimers,[160] HMG-protein/DNA complexes,[161] active sites of Rieske iron-sulfur
proteins,[162] and supercoiled DNA.[163] The Examples chapter below provides a number of
other sample applications.

186
10.3 Compiling nab Programs

10.3 Compiling nab Programs


Compiling nab programs is very similar to compiling other high-level language programs,
such as C and Fortran. The command line syntax is
nab [-O] [-c] [-v] [-noassert] [-nodebug] [-o file] [-Dstring] file(s)

where
-O optimizes the object code
-c suppresses the linking stage with ld and produces a .o file
-v verbosely reports on the compile process
-noassert causes the compiler to ignore assert statements
-nodebug causes the compiler to ignore debug statements
-o file names the output file
-Dstring defines string to the C preprocessor

Linking Fortran and C object code with nab is accomplished simply by including the source
files on the command line with the nab file. For instance, if a nab program [Link] uses a C
function defined in the file foo.c, compiling and linking optimized nab code would be
accomplished by
nab -O [Link] foo.c

The result is an executable [Link] file.

10.4 Parallel Execution


The generalized Born energy routines (for both first and second derivatives) include directives
that will allow for parallel execution on machines that support this option. Once you have some
level of comfort and experience with the single-CPU version, you can enable parallel execution
by supplying one of several parallelization options (-openmp, -mpi or -scalapack) to configure,
by re-building the NAB compiler and by recompiling your NAB program.
The -openmp option enables parallel execution under OpenMP on shared- memory machines.
To enable OpenMP execution, add the -openmp option to configure, re-build the NAB compiler
and re-compile your NAB program. Then, if you set the OMP_NUM_THREADS environment
variable to the number of threads that you wish to perform parallel execution, the Born energy
computation will execute in parallel.
The -mpi option enables parallel execution under MPI on either clusters or shared-memory
machines. To enable MPI execution, add the -mpi option to configure and re-build the NAB
compiler. You will not need to modify your NAB programs; just execute them with an mpirun
command.
The -scalapack option enables parallel execution under MPI on either clusters or shared-
memory machines, and in addition uses the Scalable LAPACK (ScaLAPACK) library for par-
allel linear algebra computation that is required to calculate the second derivatives of the gen-
eralized Born energy, to perform Newton-Raphson minimization or to perform normal mode
analysis. For computations that do not involve linear algebra (such as conjugate gradients min-
imization or molecular dynamics) the -scalapack option functions in the same manner as the

187
10 NAB: Introduction

-mpi option. Do not use the -mpi and -scalapack options simultaneously. Use the -scalapack
option only when ScaLAPACK has been installed on your cluster or shared-memory machine.
In order that the -mpi or -scalapack options result in a correct build of the NAB compiler, the
configure script must specify linking of the MPI library, or ScaLAPACK and BLACS libraries,
as part of that build. These libraries are specified for Sun machines in the solaris_cc section
of the configure script. If you want to use MPI or ScaLAPACK on a machine other than a
Sun machine, you will need to modify the configure script to link these libraries in a manner
analogous to what occurs in the solaris_cc section of the script.
There are three options to specify the manner in which NAB supports linear algebra com-
putation. The -scalapack option discussed above specifies ScaLAPACK. The -perflib option
specifies Sun TM Performance Library TM , a multi-threaded implementation of LAPACK. If
neither -scalapack nor -perflib is specified, then linear algebra computation will be performed
by a single CPU using LAPACK. In this last case, the Intel MKL library will be used if the
MKL_HOME environment variable is set at configure time. Absent that, if a GOTO environment
variable is found, the GotoBLAS libraries will be used.
The parallel execution capability of NAB was developed primarily on Sun machines, and has
also been tested on the SGI Altix platform. But it has been much less widely-used than have
other parts of NAB, so you should certainly run some tests with your system to ensure that
single-CPU and parallel runs give the same results.
The $AMBERHOME/benchmarks/nab directory has a series of timing benchmarks that can
be helpful in assessing performance. See the README file there for more information.

10.5 First Examples


This section introduces nab via three simple examples. All nab programs in this user manual
are set in Courier, a typewriter style font. The line numbers at the beginning of each line are
not parts of the programs but have been added to make it easier to refer to specific program
sections.

10.5.1 B-form DNA duplex


One of the goals of nab was that simple models should require simple programs. Here is an
nab program that creates a model of a B-form DNA duplex and saves it as a PDB file.
 
1 // Program 1 - Average B-form DNA duplex
2 molecule m;
3

4 m = bdna( "gcgttaacgc" );
5 putpdb( "[Link]", m );
 
Line 2 is a declaration used to tell the nab compiler that the name m is a molecule variable,
something nab programs use to hold structures. Line 4 creates the actual model using the
predefined function bdna(). This function’s argument is a literal string which represents the
sequence of the duplex that is to be created. Here’s how bdna() converts this string into a
molecule. Each letter stands for one of the four standard bases: a for adenine, c for cytosine, g

188
10.5 First Examples

for guanine and t for thymine. In a standard DNA duplex every adenine is paired with thymine
and every cytosine with guanine in an antiparallel double helix. Thus only one strand of the
double helix has to be specified. As bdna() reads the string from left to right, it creates one
strand from 5’ to 3’ (5’-gcgttaacgc -3’), automatically creating the other antiparallel strand
using Watson/Crick pairing. It uses a uniform helical step of 3.38 Å rise and 36.0o twist.
Naturally, nab has other ways to create helical molecules with arbitrary helical parameters and
even mismatched base pairs, but if you need some “average” DNA, you should be able to get it
without having to specify every detail. The last line uses the nab builtin putpdb() to write the
newly created duplex to the file [Link].
Program 1 is about the smallest nab program that does any real work. Even so, it contains
several elements common to almost all nab programs. The two consecutive forward slashes in
line 1 introduce a comment which tells the nab compiler to ignore all characters between them
and the end of the line. This particular comment begins in column 1, but that is not required as
comments may begin in any column. Line 3 is blank. It serves no purpose other than to visually
separate the declaration part from the action part. nab input is free format. Runs of white space
characters—spaces, tabs, blank lines and page breaks—act like a single space which is required
only to separate reserved words like molecule from identifiers like m. Thus white space can be
used to increase readability.

10.5.2 Superimpose two molecules


Here is another simple nab program. It reads two DNA molecules and superimposes them
using a rotation matrix made from a correspondence between their C1’ atoms.
 
1 // Program 2 - Superimpose two DNA duplexes
2 molecule m, mr;
3 float r;
4

5 m = getpdb( "[Link]" );
6 mr = getpdb( "[Link]" );
7 superimpose( m, "::C1’", mr, "::C1’" );
8 putpdb( "[Link]", m );
9 rmsd( m, "::C1’", mr, "::C1’", r );
10 printf( "rmsd = %8.3fn", r );
 
This program uses three variables—two molecules, m and mr and one float, r. An nab dec-
laration can include any number of variables of the same type, but variables of different types
must be in separate declarations. The builtin function getpdb() reads two molecules in PDB
format from the files [Link] and [Link] into the variables m and mr. The superimposi-
tion is done with the builtin function superimpose(). The arguments to superimpose() are two
molecules and two “atom expressions”. nab uses atom expressions as a compact way of speci-
fying sets of atoms. Atom expressions and atom names are discussed in more detail below but
for now an atom expression is a pattern that selects one or more of the atoms in a molecule. In
this example, they select all atoms with names C1’.
superimpose() uses the two atom expressions to associate the corresponding C1’ carbons in
the two molecules. It uses these correspondences to create a rotation matrix that when applied

189
10 NAB: Introduction

to m will minimize the root mean square deviation between the pairs. It applies this matrix to
m, “moving” it on to mr. The transformed molecule m is written out to the file [Link]
in PDB format using the builtin function putpdb(). Finally the builtin function rmsd() is used
to compute the actual root mean square deviation between corresponding atoms in the two
superimposed molecules. It returns the result in r, which is written out using the C-like I/O
function printf(). rmsd() also uses two atom expressions to select the corresponding pairs. In
this example, they are the same pairs that were used in the superimposition, but any set of pairs
would have been acceptable. An example of how this might be used would be to use different
subsets of corresponding atoms to compute trial superimpositions and then use rmsd() over all
atoms of both molecules to determine which subset did the best job.

10.5.3 Place residues in a standard orientation


This is the last of the introductory examples. It places nucleic acid monomers in an orien-
tation that is useful for building Watson/Crick base pairs. It uses several atom expressions to
create a frame or handle attached to an nab molecule that permits easy movement along impor-
tant “molecular directions”. In a standard Watson/Crick base pair the C4 and N1 atoms of the
purine base and the H3, N3 and C6 atoms of the pyrimidine base are colinear. Such a line is
obviously an important molecular direction and would make a good coordinate axis. Program
3 aligns these monomers so that this hydrogen bond is along the Y-axis.
 
1 // Program 3 - orient nucleic acid monomers
2 molecule m;
3

4 m = getpdb( "[Link]" );
5 setframe( 2, m, // also for GUA
6 "::C4",
7 "::C5", "::N3",
8 "::C4", "::N1" );
9 alignframe( m, NULL );
10 1putpdb( "[Link]", m );
11

12 m = getpdb( "[Link]" );
13 setframe( 2, m, // also for CYT & URA
14 "::C6",
15 "::C5", "::N1",
16 "::C6", "::N3" );
17 alignframe( m, NULL );
18 putpdb( "[Link]", m );
 
This program uses only one variable, the molecule m. Execution begins on line 4 where the
builtin getpdb() is used to read in the coordinates of an adenine (created elsewhere) from the file
[Link]. The nab builtin setframe() creates a coordinate frame for this molecule using vectors
defined by some of its atoms as shown in Figure 10.1. The first atom expression (line 6) sets the
origin of this coordinate frame to be the coordinates of the C4 atom. The two atom expressions
on line 7 set the X direction from the coordinates of the C5 to the coordinates of the N3. The
last two atom expressions set the Y direction from the C4 to the N1. The Z-axis is created by

190
10.6 Molecules, Residues and Atoms

Y H3 Y
ADE N1
THY N3

C5 C5 N1
N3 X X
C4
C6

Figure 10.1: ADE and THY after execution of Program 3.

the cross product X×Y. Frames are thus like sets of local coordinates that can be attached to
molecules and used to facilitate defining transformations; a more complete discussion is given
in the section Frames below.
nab requires that the coordinate axes of all frames be orthogonal, and while the X and Y axes
as specified here are close, they are not quite exact. setframe() uses its first parameter to specify
which of the original two axes is to be used as a formal axis. If this parameter is 1, then the
specified X axis becomes the formal X axis and Y is recreated from Z×X; if the value is 2, then
the specified Y axis becomes the formal Y axis and X is recreated from Y×Z. In this example
the specified Y axis is used and X is recreated. The builtin alignframe() transforms the molecule
so that the X, Y and Z axes of the newly created coordinate frame point along the standard X,
Y and Z directions and that the origin is at (0,0,0). The transformed molecule is written to the
file [Link]. A similar procedure is performed on a thymine residue with the result that the
hydrogen bond between the H3 of thymine and the N1 of adenine in a Watson Crick pair is now
along the Y axis of these two residues.

10.6 Molecules, Residues and Atoms


We now turn to a discussion of ways of describing and manipulating molecules. In addition to
the general-purpose variable types like float, int and string, nab has three types for working with
molecules: molecule, residue and atom. Like their chemical counterparts, nab molecules are
composed of residues which are in turn composed of atoms. The residues in an nab molecule
are organized into one or more named, ordered lists called strands. Residues in a strand are
usually bonded so that the “exiting” atom of residue i is connected to the “entering” atom of
residue i + 1. The residues in a strand need not be bonded; however, only residues in the same
strand can be bonded.
Each of the three molecular types has a complex internal structure, only some of which is
directly accessible at the nab level. Simple elements of these types, like the number of atoms
in a molecule or the X coordinate of an atom are accessed via attributes—a suffix attached to a

191
10 NAB: Introduction

molecule, residue or atom variable. Attributes behave almost like int, float and string variables;
the only exception being that some attributes are read only with values that can t be changed.
More complex operations on these types such as adding a residue to a molecule or merging two
strands into one are handled with builtin functions. A complete list of nab builtin functions and
molecule attributes can be found in the nab Language Reference.

10.7 Creating Molecules


The following functions are used to create molecules. Only an overview is given here; more
details are in chapter 3.
molecule newmolecule();
int addstrand( molecule m, string str );
residue getresidue( string rname, string rlib );
residue transformres( matrix mat, residue res, string aex );
int addresidue( molecule m, string str, residue res );
int connectres( molecule m, string str,
int rn1, string atm1, int rn2, string atm2 );
int mergestr( molecule m1, string str1, string end1,
molecule m2, string str2, string end2 );

The general strategy for creating molecules with nab is to create a new (empty) molecule then
build it one residue at a time. Each residue is fetched from a residue library, transformed
to properly position it and added to a growing strand. A template showing this strategy is
shown below. mat, m and res are respectively a matrix, molecule and residue variable declared
elsewhere. Words in italics indicate general instances of things that would be filled in according
to actual application.
 
1 ...
2 m = newmolecule();
3 addstrand( m, \fIstr-1\fC );
4 ...
5 for( ... ){
6 ...
7 res = getresidue( \fIres-name\fC, \fIres-lib\fC );
8 res = transformres( mat, res, NULL );
9 addresidue( m, \fIstr-name\fC, res );
10 ...
11 }
12 ...
 
In line 2, the function newmolecule() creates a molecule and stores it in m. The new molecule
is empty—no strands, residues or atoms. Next addstrand() is used to add a strand named str-1.
Strand names may be up to 255 characters in length and can include any characters except white
space. Each strand in a molecule must have a unique name. There is no limit on the number of
strands a molecule may have.
The actual structure would be created in the loop on lines 5-11. Each time around the loop,
the function getresidue() is used to extract the next residue with the name res-name from some

192
10.8 Residues and Residue Libraries

residue library res-lib and stores it in the residue variable res. Next the function transformres()
applies a transformation matrix, held in the matrix variable mat to the residue in res, which
places it in the orientation and position it will have in the new molecule. Finally, the function
addresidue() appends the transformed residue to the end of the chain of residues in the strand
str-name of the new molecule.
Residues in each strand are numbered from 1 to N, where N is the number of residues in that
strand. The residue order is the order in which they were inserted with addresidue(). While
nab does not require it, nucleic acid chains are usually numbered from 5’ to 3’ and proteins
chains from the N-terminus to the C-terminus. The residues in nucleic acid strands and protein
chains are usually bonded with the outgoing end of residue i bonded to the incoming end of
residue i+1. However, as this is not always the case, nab requires the user to explicitly make all
interresidue bonds with the builtin connectres().
connectres() makes bonds between two atoms in different residues of the same strand of a
molecule. Only residues in the same strand can be bonded. connectres() takes six arguments.
They are a molecule, the name of the strand containing the residues to be bonded, and two
pairs each of a residue number and the name of an atom in that residue. As an example, this
call to connectres(),
connectres( m, "sense", i, "O3’", i+1, "P" );

connects an atom named "O3’" in residue i to an atom named "P" in residue i+1, creating the
phosphate bond that joins two nucleic acid monomers.
The function mergestr() is used to either move or copy the residues in one strand into another
strand. Details are provided in chapter 3.

10.8 Residues and Residue Libraries


nab programs build molecules from residues that are parts of residue libraries, which are ex-
actly those distributed with the Amber molecular mechanics programs (see [Link]
nab provides several functions for working with residues. All return a valid residue on
success and NULL on failure. The function getres() is written in nab and it source is shown
below. transformres() which applies a coordinate transformation to a residue and is discussed
under the section Matrices and Transformations.
residue getresidue( string resname, string reslib );
residue getres( string resname, string reslib );
residue transformres( matrix mat, residue res, string aexp );

getresidue() extracts the residue with name resname from the residue library reslib. reslib is
the name of a file that either contains the residue information or contains names of other files
that contain it. reslib is assumed to be in the directory $NABHOME/reslib unless it begins with
a slash (/)
A common task of many nab programs is the translation of a string of characters into a
structure where each letter in the string represents a residue. Generally, some mapping of one
or two character names into actual residue names is required. nab supplies the function getres()
that maps the single character names a, c, g, t and u and their 5’ and 3’ terminal analogues into
the residues ADE, CYT, GUA, THY and URA. Here is its source:

193
10 NAB: Introduction

 
1 // getres() - map 1 letter names into 3 letter names
2 residue getres( string rname, string rlib )
3 {
4 residue res;
5 string map1to3[ hashed ]; // convert residue names
6

7 map1to3["A"] = "ADE"; map1to3["C"] = "CYT";


8 map1to3["G"] = "GUA"; map1to3["T"] = "THY";
9 map1to3["U"] = "URA";
10

11 map1to3["a"] = "ADE"; map1to3["c"] = "CYT";


12 map1to3["g"] = "GUA"; map1to3["t"] = "THY";
13 map1to3["u"] = "URA";
14

15 if( r in map1to3 ) {
16 res = getresidue( map1to3[ r ], rlib );
17 }else{
18 fprintf( stderr, "undefined residue %s\\n", r );
19 exit( 1 );
20 }
21 return( res );
22 };
 
getres() is the first of several nab functions that are discussed in this User Manual. The
following explanation will cover not just getres() but will serve as an introduction to user defined
nab functions in general.
An nab function is a named group of declarations and statements that is executed as a unit
by using the function’s name in an expression. nab functions can have special variables called
parameters that allow the same function to operate on different data. A function definition
begins with a header that describes the function, followed by the function body which is a list
of statements and declarations enclosed in braces ({}) and ends with a semicolon. The header to
getres() is on line 2 and the body is on lines 3 to 22.
Every nab function header begins with the reserved word that specifies its type, followed by
the function’s name followed by its parameters (if any) enclosed in parentheses. The
parentheses are always required, even if the function does not have parameters. nab functions
may return a single value of any of the 10 nab types. nab functions can not return arrays. In
symbolic terms every nab function header uses this template:
type name( parameters? )

The parameters (if present) to an nab function are a comma separated list of type variable
pairs:
type1 variable1, type2 variable2, ...

An nab function may have any number of parameters, including none. Parameters may of any
of the 10 nab types, but unlike function values, parameters can be arrays, including hashed
arrays. The function getres() has two parameters, the two string variables resname and reslib.

194
10.9 Atom Names and Atom Expressions

Parameters to nab functions are “called by reference” which means that they contain the ac-
tual data—not copies of it—that the function was called with. When an nab function parameter
is assigned, the actual data in the calling function is changed. The only exception is when an
expression is passed as a parameter to an nab function. In this case, the nab compiler evalu-
ates the expression into a temporary (and invisible to the nab programmer) variable and then
operates on its contents.
Immediately following the function header is the function body. It is a list of declarations
followed by a list of statements enclosed in braces. The list of declarations, the list of statements
or both may be empty. getres() has several statements, and a single declaration, the variable res.
This variable is a local variables. Local variables are defined only when the function is active.
If a local variable has the same name as variable defined outside of a it the local variable hides
the global one. Local variables can not be parameters.
The statement part of getres() begins on line 6. It consists of several if statements organized
into a decision tree. The action of this tree is to translate one of the strings A, , , T, etc., or
their lower case equivalents into the corresponding three letter standard nucleic acid residue
name and then extract that residue from reslib using the low level residue library function ge-
tresidue(). The value returned by getresidue() is stored in the local variable res, except when
the input string is not one of those listed above. In that case, getres() writes a message to stderr
indicating that it can not translate the input string and sets res to the value NULL. nab uses NULL
to represent non-existent values of the types string, file, atom, residue, molecule and bounds.
A value of NULL generally means that a variable is uninitialized or that an error occurred in
creating it.
A function returns a value by executing a return statement, which is the reserved word return
followed by an expression. The return statement evaluates the expression, sets the function
value to it and returns control to the point just after the call. The expression is optional but if
present the type of the expression must be the same as the type of the function or both must
be numeric (int, float). If the expression is missing, the function still returns, but its value is
undefined. getres() includes one return statements on line 20. A function also returns with an
undefined value when it "runs off the bottom", i.e. executes the last statement before the closing
brace and that statement is not a return.

10.9 Atom Names and Atom Expressions


Every atom in an nab molecule has a name. This name is composed of the strand name, the
residue number and the atom name. As both PDB and off formats require that all atoms in a
residue have distinct names, the combination of strand name, residue number and atom name is
unique for each atom in a single molecule. Atoms in different molecules, however, may have
the same name.
Many nab builtins require the user to specify exactly which atoms are to be covered by the
operation. nab does this with special strings called atom expressions. An atom expression is
a pattern that matches one or more atom names in the specified molecule or residue. An atom
expression consists of three parts—a strand part, a residue part and an atom part. The parts are
separated by colons (:). Not all three parts are required. An atom expression with no colons
consists of only a strand part; it selects all atoms in the selected strands. An atom expression

195
10 NAB: Introduction

with one colon consists of a strand part and a residue part; it selects all atoms in the selected
residues in the selected strands. An empty part selects all strands, residues or atoms depending
on which parts are empty.
nab patterns specify the entire string to be matched. For example, the atom pattern C matches
only atoms named C , and not those named CA, HC, etc. To match any name that begins with C,
use C*, to match any name ending with C, use *C and to match a C in any position use *C*. An
atom expression is first parsed into its parts. The strand part is evaluated selecting one or more
strands in a molecule. Next the residue part is evaluated. Only residues in selected strands can
be selected. Finally the atom part is evaluated and only atoms in selected residues are selected.
Here are some typical atom expressions and the atoms they match.

:ADE: Select all atoms in any residue named ADE. All three parts are
present but both the strand and atom parts are empty. The atom
expression :ADE selects the same set of atoms.
::C,CA,N select all atoms with names C, CA or N in all residues in all
strands—typically the peptide backbone.
A:1-10,13,URA:C1’ Select atoms named C1’ (the glycosyl-carbons) in residues 1 to
10 and 13 and in any residues named URA in the strand named
A.
::C*[^’] Select all non-sugar carbons. The [^’] is an example of a
negated character class. It matches any character in the last
position except ’.
::P,O?P,C[3-5]?,O[35]? The nucleic acid backbone. This P selects phosphorous atoms.
The O?P matches phosphate oxygens that have various second
letters O1P, O2P or OAP or OBP. The C[3-5]? matches the
backbone carbons, C3’, C4’, C5’ or C3*, C4*, C5*. And the
O[35]? matches the backbone oxygens O3’, O5’ or O3*, O5*.
:: or : Select all atoms in the molecule.

An important property of nab atom expressions is that the order in which the strands,
residues, and atoms are listed is unimportant. i.e., the atom expression "2,1:5,2,3:N1,C1’" is the
exact same atom expression as "1,2:3,2,5:C1’,N1". All atom expressions are reordered, internal
to nab, in increasing atom number. So, in the above example, the selected atoms will be
selected in the following sequence:

1:2:N1, 1:2:C1’, 1:3:N1, 1:3:C1’, 1:5:N1, 1:5:C1’, 2:2:N1, 2:2:C1’,


2:3:N1, 2:3:C1’, 2:5:N1, 2:5:C1’

The order in which atoms are selected internal to a specific residue are the order in which they
appear in a nab PDB file. As seen in the above example, N1 appears before C1’ in all nab
nucleic acid residues and PDB files.

196
10.10 Looping over atoms in molecules

10.10 Looping over atoms in molecules


Another thing that many nab programs have to do is visit every atom of a molecule. nab
provides a special form of its for-loop for accomplishing this task. These loops have this form:

for( a in m ) stmt;

a and m represent an atom and a molecule variable. The action of the loop is to set a to each
atom in m in this order. The first atom is the first atom of the first residue of the first strand.
This is followed by the rest of the atoms of this residue, followed by the atoms of the second
residue, etc until all the atoms in the first strand have been visited. The process is then repeated
on the second and subsequent strands in m until a has been set to every atom in m. The order of
the strands in a molecule is the order in which they were created with addstrand(), the order of
the residues in a strand is the order in which they were added with addresidue() and the order
of the atoms in a residue is the order in which they are listed in the residue library entry that the
residue is based on.
The following program uses two nested for-in loops to compute all the proton-proton dis-
tances in a molecule. Distances less than cutoff are written to stdout. The program uses the
second argument on the command to hold the cutoff value. The program also uses the =∼ oper-
ator to compare a character string , in this case an atom name to pattern, specified as a regular
expression.
 
1 // Program 4 - compute H-H distances <= cutoff
2 molecule m;
3 atom ai, aj;
4 float d, cutoff;
5

6 cutoff = atof( argv[ 2 ] );


7 m = getpdb( "[Link]" );
8

9 for( ai in m ){
10 if( [Link] !~ "H" )continue;
11 for( aj in m ){
12 if( [Link] <= [Link] )continue;
13 if( [Link] !~ "H" )continue;
14 if(( d=distp([Link],[Link]))<=cutoff){
15 printf(
16 "%3d %-4s %-4s %3d %-4s %-4s %8.3f\\n",
17 [Link], [Link], [Link],
18 [Link], [Link], [Link],
19 d );
20 }
21 }
22 }
 
The molecule is read into m using getpdb(). Two atom variables ai and aj are used to hold
the pairs of atoms. The outer loop in lines 9-22 sets ai to each atom in m in the order discussed

197
10 NAB: Introduction

above. Since this program is only interested in proton-proton distances, if ai is not a proton, all
calculations involving that atom can be skipped. The if in line 10 tests to see if ai is a proton.
It does so by testing to see if ai’s name, available via the atomname attribute doesn’t match the
regular expression "H". If it doesn’t match then the program executes the continue statement
also on line 10, which has the effect of advancing the outer loop to its next atom.
>From the section on attributes, [Link] behaves like a character string. It can be com-
pared against other character strings or tested to see if it matches a pattern or regular expression.
The two operators, =∼ and !∼ stand for match and doesn’t-match They also inform the nab
compiler that the string on their right hand sides is to be treated like a regular expression. In
this case, the regular expression "H" matches any name that contains the letter H, or any proton
which is just what is required.
If ai is a proton, then the inner loop from 11-21 is executed. This sets aj to each atom in the
same order as the loop in 9. Since distance is reflexive (dist i, j = dist j, i ), and the distance
between an atom and itself is 0, the inner loop uses the if on line 12 to skip the calculation on
aj unless it follows ai in the molecule’s atom order. Next the if on line 13 checks to see if aj is
a proton, skipping to the next atom if it is not. Finally, the if on line 14 computes the distance
between the two protons ai and aj and if it is <= cutoff writes the information out using the
C-like I/O function printf().

10.11 Points, Transformations and Frames


nab provides three kinds of geometric objects. They are the types point and matrix and the
frame component of a molecule.

10.11.1 Points and Vectors


The nab type point is an object that holds three float values. These values can represent the
X, Y and Z coordinates of a point or the components of 3-vector. The individual elements of
a point variable are accessed via attributes or suffixes added to the variable name. The three
point attributes are "x", "y" and "z". Many nab builtin functions use, return or create point values.
Details of operations on points are given in chapter 3.

10.11.2 Matrices and Transformations


nab uses the matrix type to hold a 4×4 transformation matrix. Transformations are applied
to residues and molecules to move them into new orientations and/or positions. Unlike a
general coordinate transformation, nab transformations can not alter the scale (size) of an
object. However, transformations can be applied to a subset of the atoms of a residue or
molecule changing its shape. For example, nab would use a transformation to rotate a group of
atoms about a bond. nab does not require that transformations applied to parts of residues or
molecules be chemically valid. It simply transforms the coordinates of the selected atoms
leaving it to the user to correct (or ignore) any chemically incorrect geometry caused by the
transformation. nab uses the following builtin functions to create and use transformations.
matrix newtransform( float dx, float dy, float dz,

198
10.11 Points, Transformations and Frames

float rx, float ry, float rz );


matrix rot4( molecule m, string tail, string head, float angle );
matrix rot4p( point tail, point head, float angle );
matrix trans4( molecule m, string tail, string head, float distance );
matrix trans4p( point tail, point head, float distance );
residue transformres( matrix mat, residue r, string aex );
int transformmol( matrix mat, molecule m, string aex );

nab provides three ways to create a new transformation matrix. The function newtransform()
creates a transformation matrix from 3 translations and 3 rotations. It is intended to position
objects with respect to the standard X, Y, and Z axes located at (0,0,0). Here is how it works.
Imagine two coordinate systems, X, Y, Z and X’, Y’, Z’ that are initially superimposed. new-
transform() first rotates the the primed coordinate system about Z by rz degrees, then about Y
by ry degrees, then about X by rx degrees. Finally the reoriented primed coordinate system is
translated to the point (dx,dy,dz) in the unprimed system. The functions rot4() and rot4p() create
a transformation matrix that effects a clockwise rotation by an angle (in degrees) about an axis
defined by two points. The points can be specified implicitly by atom expressions applied to
a molecule in rot4() or explicitly as points in rot4p(). If an atom expression in rot4() selects
more that one atom, the average coordinate of all selected atoms is used as the point’s value.
(Note that a positive rotation angle here is defined to be clockwise, which is in accord with the
IUPAC rules for defining torsional angles in molecules, but is opposite to the convention found
in many other branches of mathematics.) Similarly, the functions trans4() and trans4p() create
a transformation that effects a translation by a distance along the axis defined by two points. A
positive translation is from tail to head.
transformres() applies a transformation to those atoms of res that match the atom expression
aex. It returns a copy of the input residue with the changed coordinates. The input residue is
unchanged. It returns NULL if the new residue could not be created. transformmol() applies
a transformation to those atoms of mol that match aex . Unlike transformres(), transformmol()
changes the coordinates of the input molecule. It returns a 0 on success and 1 on failure. In both
functions, the special atom expression NULL selects all atoms in the input residue or molecule.

10.11.3 Frames
Every nab molecule includes a frame, a handle that allows arbitrary and precise movement
of the molecule. This frame is set with the nab builtins setframe() and setframep(). It is
initially set to the standard X, Y and Z directions centered at (0,0,0). setframe() creates a
coordinate frame from atom expressions that specify the the origin, the X direction and the Y
direction. If any atom expression selects more that one atom, the average of the selected
atoms’ coordinates is used. Z is created from X×Y. Since the initial X and Y directions are
unlikely to be orthogonal, the use parameter specifies which of the input X and Y directions is
to become the formal X or Y direction. If use is 1, X is chosen and Y is recreated from Z×X.
If use is 2, then Y is chosen and X is recreated from Y×Z. setframep() is identical except that
the five points defining the frame are explicitly provided.
int setframe( int use, molecule mol, string origin,
string xtail, string xhead,
string ytail, string yhead );

199
10 NAB: Introduction

int setframep( int use, molecule mol, point origin,


point xtail, point xhead,
point ytail, point yhead );
int alignframe( molecule mol, molecule mref );

alignframe() is similar to superimpose(), but works on the molecules’ frames rather than se-
lected sets of their atoms. It transforms mol to superimpose its frame on the frame of mref. If
mref is NULL, alignframe() superimposes the frame of mol on the standard X, Y and Z coordinate
system centered at (0,0,0).
Here’s how frames and transformations work together to permit precise motion between two
molecules. Corresponding frames are defined for two molecules. These frames are based on
molecular directions. alignframe() is first used to align the frame of one molecule along with the
standard X, Y and Z directions. The molecule is then moved and reoriented via transformations.
Because its initial frame was along these molecular directions, the transformations are likely to
be along or about the axes. Finally alignframe() is used to realign the transformed molecule on
the frame of the fixed molecule.
One use of this method would be the rough placement of a drug into a groove on a DNA
molecule to create a starting structure for restrained molecular dynamics. setframe() is used to
define a frame for the DNA along the appropriate groove, with its origin at the center of the
binding site. A similar frame is defined for the drug. alignframe() first aligns the drug on the
standard coordinate system whose axes are now important directions between the DNA and the
drug. The drug is transformed and alignframe() realigns the transformed drug on the DNA’s
frame.

10.12 Creating Watson Crick duplexes


Watson/Crick duplexes are fundamental components of almost all nucleic acid structures
and nab provides several functions for use in creating them. They are
residue getres( string resname, string reslib );
molecule bdna( string seq );
molecule fd_helix( string helix_type, string seq, string acid_type );
string wc_complement( string seq, string reslib, string natype );
molecule wc_basepair( residue sres, residue ares );
molecule wc_helix( string seq, string rlib, string natype,
string aseq, string arlib, string anatype, float xoff,
float incl, float twist, float rise, string opts );

All of these functions are written in nab allowing the user to modify or extend them as needed
without having to modify the nab compiler.
Note: If you just want to create a regular helical structure with a given sequence, use the
"fiber-diffraction" routine fd_helix(), which is discussed in Section 3.13. The methods discussed
next are more general, and can be extended to more complicated problems, but they are also
much harder to follow and understand. The construction of "unusual" nucleic acids was the
original focus of NAB; if you are using NAB for some other purpose (such as running Amber
force field calculations) you should probably skip to Chapter 3 at this point.

200
10.12 Creating Watson Crick duplexes

10.12.1 bdna() and fd_helix()


The function bdna() which was used in the first example converts a string into a Watson/Crick
DNA duplex using average DNA helical parameters.
 
1 // bdna() - create average B-form duplex
2 molecule bdna( string seq )
3 {
4 molecule m;
5 string cseq;
6 cseq = wc_complement( seq, "", "dna" );
7 m = wc_helix( seq, "", "dna",
8 cseq, "", "dna",
9 2.25, -4.96, 36.0, 3.38, "s5a5s3a3" );
10 return( m );
11 };
 
bdna() calls wc_helix() to create the molecule. However, wc_helix() requires both strands of
the duplex so bdna() calls wc_complement() to create a string that represents the Watson/Crick
complement of the sequence contained in its parameter seq. The string "s5a5s3a3" replaces
both the sense and anti 5’ terminal phosphates with hydrogens and adds hydrogens to both the
sense and anti 3’ terminal O3’ oxygens. The finished molecule in m is returned as the function’s
value. If any errors had occurred in creating m, it would have the value NULL, indicating that
bdna() failed.
Note that the simple method used in bdna() for constructing the helix is not very generic,
since it assumes that the internal geometry of the residues in the (default) library are appropriate
for this sort of helix. This is in fact the case for B-DNA, but this method cannot be trivially
generalized to other forms of helices. One could create initial models of other helical forms in
the way described above, and fix up the internal geometry by subsequent energy minimization.
An alternative is to directly use fiber-diffraction models for other types of helices. The fd_helix()
routine does this, reading a database of experimental coordinates from fiber diffraction data, and
constructing a helix of the appropriate form, with the helix axis along z. More details are given
in Section 3.13.

10.12.2 wc_complement()
The function wc_complement() takes three strings. The first is a sequence using the standard
one letter code, the second is the name of an nab residue library, and the third is the nucleic
acid type (RNA or DNA). It returns a string that contains the Watson/Crick complement of the
input sequence in the same one letter code. The input string and the returned complement string
have opposite directions. If the left end of the input string is the 5’ base then the left end of the
returned string will be the 3’ base. The actual direction of the two strings depends on their use.
 
1 // wc_complement() - create a string that is the W/C
2 // complement of the string seq
3 string wc_complement( string seq, string rlib, string rlt )
4 // (note that rlib is unused: included only for backwards compatibility
5 {

201
10 NAB: Introduction

6 string acbase, base, wcbase, wcseq;


7 int i, len;
8

9 if( rlt == "dna" ) acbase = "t";


10 else if( rlt == "rna" ) acbase = "u";
11 else{
12 fprintf( stderr,
13 "wc_complement: rlt (%s) is not dna/rna, no W/C comp.", rlt );
14 return( NULL );
15 }
16 len = length( seq );
17 wcseq = NULL;
18 for( i = 1; i <= len; i = i + 1 ){
19 base = substr( seq, i, 1 );
20 if( base == "a" || base == "A" ) wcbase = acbase;
21 else if( base == "c" || base == "C" ) wcbase = "g";
22 else if( base == "g" || base == "G" ) wcbase = "c";
23 else if( base == "t" || base == "T" ) wcbase = "a";
24 else if( base == "u" || base == "U" ) wcbase = "a";
25 else{
26 fprintf( stderr, "wc_complement: unknown base %sn", base );
27 return( NULL );
28 }
29 wcseq = wcseq + wcbase;
30 }
31 return( wcseq );
32 }
 
wc_complement() begins its work in line 9, where the nucleic acid type, as indicated by rlt
as DNA or RNA is used to determine the correct complement for an a. The complementary
sequence is created in the for loop that begins in line 18 and extends to line 30. The nab builtin
substr() is used to extract single characters from the input sequence beginning with with position
1 and working from left to right until entire input sequence has been converted. The if-tree from
lines 20 to 28 is used to set the character complementary to the current character, using the
previously determined acbase if the input character is an a or A. Any character other than the
expected a, c, g, t, u (or A, C, G, T, U) is an error causing wc_complement() to print an error
message and return NULL, indicating that it failed. Line 29 shows how nab uses the infix +
to concatenate character strings. When the entire string has been complemented, the for loop
terminates and the complementary sequence now in wcseq is returned as the function value.
Note that if the input sequence is empty, wc_complement() returns NULL, indicating failure.

10.12.3 wc_helix() Overview


wc_helix() generates a uniform helical duplex from a sequence, its complement, two residue
libraries and four helical parameters: x-offset, inclination, twist and rise. By using two residue
libraries, wc_helix() can generate RNA/DNA heteroduplexes. wc_helix() returns an nab molecule
containing two strands. The string seq becomes the "sense" strand and the string aseq becomes

202
10.12 Creating Watson Crick duplexes

the "anti" strand. seq and aseq are required to be complementary although this is not checked.
wc_helix() creates the molecule one base pair at a time. seq is read from left to right, aseq is read
from right to left and corresponding letters are extracted and converted to residues by getres().
These residues are in turn combined into an idealized Watson/Crick base pair by wc_basepair().
An AT created by wc_basepair() is shown in Figure 2.
A Watson/Crick duplex can be modeled as a set of planes stacked in a helix. The num-
bers that describe the relationships between the planes and between the planes and the helical
axis are called helical parameters. Planes can be defined for each base or base pair. Six num-
bers (three displacements and three angles) can be defined for every pair of planes; however,
helical parameters for nucleic acid bases are restricted to the six numbers describing the the
relationship between the two bases in a base pair and the six numbers describing the relation-
ship between adjacent base pairs. A complete description of helical parameters can be found in
Dickerson.[164]
wc_helix() uses only four of the 12 helical parameters. It builds its helices from idealized
Watson/Crick pairs. These pairs are planar so the three intra base angles are 0. In addition the
displacements are displacements from the idealized Watson/Crick geometry and are also 0. The
A and the T in Figure 2 are in plane of the page. wc_helix() uses four of the six parameters
that relate a base pair to the helical axis. The helices created by wc_helix() have a single axis
(the Z axis, not shown) which is at the intersection of the X and Y axes of Figure 2. Now
imagine keeping the axes fixed in the plane of the paper and moving the base pair. X-offset
is the displacement along the X axis between the Y axis and the line marked Y’. A positive
X-offset is toward the arrow on the X-axis. Inclination is the rotation of the base pair about
the X axis. A rotation that moves the A above the plane of page and the T below is positive.
Twist involves a rotation of the base pair about the Z-axis. A counterclockwise twist is positive.
Finally, rise is a displacement along the Z-axis. A positive rise is out of the page toward the
reader.

10.12.4 wc_basepair()
The function wc_basepair() takes two residues and assembles them into a two stranded nab
molecule containing one base pair. Residue sres is placed in the "sense" strand and residue
ares is placed in the "anti" strand. The work begins in line 14 where newmolecule() is used to
create an empty molecule stored in m. Two strands, sense and anti are added using addstrand().
In addition, two more molecules are created, m_sense for the sense residue and m_anti for the
anti residue. The if-trees in lines 26-61 and 63-83 are used to select residue dependent atoms
that will be used to move the base pairs into a convenient orientation for helix generation.
The purine:C4 and pyrimidine:C6 distance which is residue dependent is also set. In line 62,
addresidue() adds sres to the strand sense of m_sense. In line 84, addresidue() adds ares to the
strand anti of m_anti. Lines 86 and 87 align the molecules containing the sense residue and anti
residue so that sres and ares are on top of each other. Line 88 creates a transformation matrix
that rotates m_anti ( containing ares ) 180o about the X-axis. After applying this transformation,
the two bases are still occupying the same space but ares is now antiparallel to sres. Line 90
creates a transformation matrix that displaces m_anti and ares along the Y-axis by sep. The
properly positioned molecules containing sres and ares are merged into a single molecule, m,
completing the base pair. Lines 97-98 move this base pair to a more convenient orientation for

203
10 NAB: Introduction

ADE THY
C5

Y’
C1’ N3 C1’
X

Figure 10.2: [Link] from wc_basepair().

helix generation. Initially the base as shown in Figure 10.2 is in the plane of page with origin
on the C4 of the A. The calls to setframe() and alignframe() move the base pair so that the origin
is at the intersection of the lines marked X and Y’.
 
1 // wc_basepair() - create Watson/Crick base pair
2 #define AT_SEP 8.29
3 #define CG_SEP 8.27
4

5 molecule wc_basepair( residue sres, residue ares )


6 {
7 molecule m, m_sense, m_anti;
8 float sep;
9 string srname, arname;
10 string xtail, xhead;
11 string ytail, yhead;
12 matrix mat;
13

14 m = newmolecule();
15 m_sense = newmolecule();
16 m_anti = newmolecule();
17 addstrand( m, "sense" );
18 addstrand( m, "anti" );
19 addstrand( m_sense, "sense" );
20 addstrand( m_anti, "anti" );
21

22 srname = getresname( sres );


23 arname = getresname( ares );
24 ytail = "sense::C1’";
25 yhead = "anti::C1’";
26 if( ( srname == "ADE" ) || ( srname == "DA" ) ||
27 ( srname == "RA" ) || ( srname =~ "[DR]A[35]" ) ){

204
10.12 Creating Watson Crick duplexes

28 sep = AT_SEP;
29 xtail = "sense::C5";
30 xhead = "sense::N3";
31 setframe( 2, m_sense,
32 "::C4", "::C5", "::N3", "::C4", "::N1" );
33 }else if( ( srname == "CYT" ) || ( srname =~ "[DR]C[35]*" ) ){
34 sep = CG_SEP;
35 xtail = "sense::C6";
36 xhead = "sense::N1";
37 setframe( 2, m_sense,
38 "::C6", "::C5", "::N1", "::C6", "::N3" );
39 }else if( ( srname == "GUA" ) || ( srname =~ "[DR]G[35]*" ) ){
40 sep = CG_SEP;
41 xtail = "sense::C5";
42 xhead = "sense::N3";
43 setframe( 2, m_sense,
44 "::C4", "::C5", "::N3", "::C4", "::N1" );
45 }else if( ( srname == "THY" ) || ( srname =~ "DT[35]*" ) ){
46 sep = AT_SEP;
47 xtail = "sense::C6";
48 xhead = "sense::N1";
49 setframe( 2, m_sense,
50 "::C6", "::C5", "::N1", "::C6", "::N3" );
51 }else if( ( srname == "URA" ) || ( srname =~ "RU[35]*" ) ){
52 sep = AT_SEP;
53 xtail = "sense::C6";
54 xhead = "sense::N1";
55 setframe( 2, m_sense,
56 "::C6", "::C5", "::N1", "::C6", "::N3" );
57 }else{
58 fprintf( stderr,
59 "wc_basepair : unknown sres %s\\n",srname );
60 exit( 1 );
61 }
62 addresidue( m_sense, "sense", sres );
63 if( ( arname == "ADE" ) || ( arname == "DA" ) ||
64 ( arname == "RA" ) || ( arname =~ "[DR]A[35]" ) ){
65 setframe( 2, m_anti,
66 "::C4", "::C5", "::N3", "::C4", "::N1" );
67 }else if( ( arname == "CYT" ) || ( arname =~ "[DR]C[35]*" ) ){
68 setframe( 2, m_anti,
69 "::C6", "::C5", "::N1", "::C6", "::N3" );
70 }else if( ( arname == "GUA" ) || ( arname =~ "[DR]G[35]*" ) ){
71 setframe( 2, m_anti,
72 "::C4", "::C5", "::N3", "::C4", "::N1" );
73 }else if( ( arname == "THY" ) || ( arname =~ "DT[35]*" ) ){
74 setframe( 2, m_anti,
75 "::C6", "::C5", "::N1", "::C6", "::N3" );
76 }else if( ( arname == "URA" ) || ( arname =~ "RU[35]*" ) ){

205
10 NAB: Introduction

77 setframe( 2, m_anti,
78 "::C6", "::C5", "::N1", "::C6", "::N3" );
79 }else{
80 fprintf( stderr,
81 "wc_basepair : unknown ares %s\\n",arname );
82 exit( 1 );
83 }
84 addresidue( m_anti, "anti", ares );
85

86 alignframe( m_sense, NULL );


87 alignframe( m_anti, NULL );
88 mat = newtransform( 0., 0., 0., 180., 0., 0. );
89 transformmol( mat, m_anti, NULL );
90 mat = newtransform( 0., sep, 0., 0., 0., 0. );
91 transformmol( mat, m_anti, NULL );
92 mergestr( m, "sense", "last", m_sense, "sense", "first" );
93 mergestr( m, "anti", "last", m_anti, "anti", "first" );
94

95 freemolecule( m_sense ); freemolecule( m_anti );


96

97 setframe( 2, m, "::C1’", xtail, xhead, ytail, yhead );


98 alignframe( m, NULL );
99 return( m );
100 };
 

10.12.5 wc_helix() Implementation


The function wc_helix() assembles base pairs from wc_basepair() into a helical duplex. It
is a fairly complicated function that uses several transformations and shows how mergestr() is
used to combine smaller molecules into a larger one. In addition to creating complete duplexes,
wc_helix() can also create molecules that contain only one strand of a duplex. Using the spe-
cial value NULL for either seq or aseq creates a duplex that omits the residues for the NULL
sequence. The molecule still contains two strands, sense and anti, but the strand corresponding
to the NULL sequence has zero residues. wc_helix() first determines which strands are required,
then creates the first base pair, then creates the subsequent base pairs and assembles them into
a helix and finally packages the requested strands into the returned molecule.
Lines 20-34 test the input sequences to see which strands are required. The variables has_s
and has_a are flags where a value of 1 indicates that seq and/or aseq was requested. If an input
sequence is NULL, wc_complement() is used to create it and the appropriate flag is set to 0. The
nab builtin setreslibkind() is used to set the nucleic acid type so that the proper residue ( DNA
or RNA ) is extracted from the residue library.
The first base pair is created in lines 42-63. The two letters corresponding the 5’ base of
seq and the 3’ base of aseq are extracted using the nab builtin substr(), converted to residues
using getresidue() and assembled into a base pair by wc_basepair(). This base pair is oriented
as in Figure 2 with the origin at the intersection of the lines X and Y’. Two transformations are
created, xomat for the x-offset and inmat for the inclination and applied to this pair.

206
10.12 Creating Watson Crick duplexes

Base pairs 2 to slen-1 are created in the for loop in lines 66-87. substr() is used to extract the
appropriate letters from seq and aseq which are converted into another base pair by getresidue()
and wc_basepair(). Four transformations are applied to these base pairs - two to set the x-
offset and the inclination and two more to set the twist and the rise. Next m2, the molecule
containing the newly created properly positioned base pair must be bonded to the previously
created molecule in m1. Since nab only permits bonds between residues in the same strand,
mergestr() must be used to combine the corresponding strands in the two molecules before
connectres() can create the bonds.
Because the two strands in a Watson/Crick duplex are antiparallel, adding a base pair to one
end requires that one residue be added after the last residue of one strand and that the other
residue added before the first residue of the other strand. In wc_helix() the sense strand is
extended after its last residue and the anti strand is extended before its first residue. The call to
mergestr() in line 79 extends the sense strand of m1 with the the residue of the sense strand of
m2. The residue of m2 is added after the "last" residue of of the sense strand of m1. The final
argument "first" indicates that the residue of m2 are copied in their original order m1:sense:last
is followed by m2:sense:first. After the strands have been merged, connectres() makes a bond
between the O3’ of the next to last residue (i-1) and the P of the last residue (i). The next call
to mergestr() works similarly for the residues in the anti strands. The residue in the anti strand
of m2 are copied into the the anti strand of m1 before the first residue of the anti strand of m1
m2:anti:last precedes m1:anti:first . After merging connectres() creates a bond between the O3’
of the new first residue and the P of the second residue.
Lines 121-130 create the returned molecule m3. If the flag has_s is 1, mergestr() copies the
entire sense strand of m1 into the empty sense strand of m3. If the flag has_a is 1, the anti
strand is also copied.
 
1 // wc_helix() - create Watson/Crick duplex
2 string wc_complement();
3 molecule wc_basepair();
4 molecule wc_helix(
5 string seq, string sreslib, string snatype,
6 string aseq, string areslib, string anatype,
7 float xoff, float incl, float twist, float rise,
8 string opts )
9 {
10 molecule m1, m2, m3;
11 matrix xomat, inmat, mat;
12 string arname, srname;
13 string sreslib_use, areslib_use;
14 string loup[ hashed ];
15 residue sres, ares;
16 int has_s, has_a;
17 int i, slen;
18 float ttwist, trise;
19

20 has_s = 1; has_a = 1;
21 if( sreslib == "" ) sreslib_use = "all_nucleic94.lib";
22 else sreslib_use = sreslib;

207
10 NAB: Introduction

23 if( areslib == "" ) areslib_use = "all_nucleic94.lib";


24 else areslib_use = areslib;
25

26 if( seq == NULL && aseq == NULL ){


27 fprintf( stderr, "wc_helix: no sequence\\n" );
28 return( NULL );
29 }else if( seq == NULL ){
30 seq = wc_complement( aseq, areslib_use, snatype );
31 has_s = 0;
32 }else if( aseq == NULL ){
33 aseq = wc_complement( seq, sreslib_use, anatype );
34 has_a = 0;
35 }
36

37 slen = length( seq );


38 loup["g"] = "G"; loup["a"] = "A";
39 loup["t"] = "T"; loup["c"] = "C";
40

41 // handle the first base pair:


42 setreslibkind( sreslib_use, snatype );
43 srname = "D" + loup[ substr( seq, 1, 1 ) ];
44 if( opts =~ "s5" )
45 sres = getresidue( srname + "5", sreslib_use );
46 else if( opts =~ "s3" && slen == 1 )
47 sres = getresidue( srname + "3", sreslib_use );
48 else sres = getresidue( srname, sreslib_use );
49

50 setreslibkind( areslib_use, anatype );


51 arname = "D" + loup[ substr( aseq, 1, 1 ) ];
52 if( opts =~ "a3" )
53 ares = getresidue( arname + "3", areslib_use );
54 else if( opts =~ "a5" && slen == 1 )
55 ares = getresidue( arname + "5", areslib_use );
56 else ares = getresidue( arname, areslib_use );
57 m1 = wc_basepair( sres, ares );
58 freeresidue( sres ); freeresidue( ares );
59 xomat = newtransform(xoff, 0., 0., 0., 0., 0. );
60 transformmol( xomat, m1, NULL );
61 inmat = newtransform( 0., 0., 0., incl, 0., 0.);
62 transformmol( inmat, m1, NULL );
63

64 // add in the main portion of the helix:


65 trise = rise; ttwist = twist;
66 for( i = 2; i <= slen-1; i = i + 1 ){
67 srname = "D" + loup[ substr( seq, i, 1 ) ];
68 setreslibkind( sreslib, snatype );
69 sres = getresidue( srname, sreslib_use );
70 arname = "D" + loup[ substr( aseq, i, 1 ) ];
71 setreslibkind( areslib, anatype );

208
10.12 Creating Watson Crick duplexes

72 ares = getresidue( arname, areslib_use );


73 m2 = wc_basepair( sres, ares );
74 freeresidue( sres ); freeresidue( ares );
75 transformmol( xomat, m2, NULL );
76 transformmol( inmat, m2, NULL );
77 mat = newtransform( 0., 0., trise, 0., 0., ttwist );
78 transformmol( mat, m2, NULL );
79 mergestr( m1, "sense", "last", m2, "sense", "first" );
80 connectres( m1, "sense", i-1, "O3’", i, "P" );
81 mergestr( m1, "anti", "first", m2, "anti", "last" );
82 connectres( m1, "anti", 1, "O3’", 2, "P" );
83 trise = trise + rise;
84 ttwist = ttwist + twist;
85 freemolecule( m2 );
86 }
87

88

89 i = slen; // add in final residue pair:


90

91 if( i > 1 ){
92 srname = substr( seq, i, 1 );
93 srname = "D" + loup[ substr( seq, i, 1 ) ];
94 setreslibkind( sreslib, snatype );
95 if( opts =~ "s3" )
96 sres = getres( srname + "3", sreslib_use );
97 else
98 sres = getres( srname, sreslib_use );
99 arname = "D" + loup[ substr( aseq, i, 1 ) ];
100 setreslibkind( areslib, anatype );
101 if( opts =~ "a5" )
102 ares = getres( arname + "5", areslib_use );
103 else
104 ares = getres( arname, areslib_use );
105

106 m2 = wc_basepair( sres, ares );


107 freeresidue( sres ); freeresidue( ares );
108 transformmol( xomat, m2, NULL );
109 transformmol( inmat, m2, NULL );
110 mat = newtransform( 0., 0., trise, 0., 0., ttwist );
111 transformmol( mat, m2, NULL );
112 mergestr( m1, "sense", "last", m2, "sense", "first" );
113 connectres( m1, "sense", i-1, "O3’", i, "P" );
114 mergestr( m1, "anti", "first", m2, "anti", "last" );
115 connectres( m1, "anti", 1, "O3’", 2, "P" );
116 trise = trise + rise;
117 ttwist = ttwist + twist;
118 freemolecule( m2 );
119 }
120

209
10 NAB: Introduction

121 m3 = newmolecule();
122 addstrand( m3, "sense" );
123 addstrand( m3, "anti" );
124 if( has_s )
125 mergestr( m3, "sense", "last", m1, "sense", "first" );
126 if( has_a )
127 mergestr( m3, "anti", "last", m1, "anti", "first" );
128 freemolecule( m1 );
129

130 return( m3 );
131 };
 

10.13 Structure Quality and Energetics


Up to this point, all the structures in the examples have been built using only transformations.
These transformations properly place the purine and pyrimidine rings. However, since they are
rigid body transformations, they will create distorted sugar/backbone geometry if any internal
sugar/backbone rearrangements are required to accommodate the base geometry. The amount
of this distortion depends on both the input residues and transformations applied and can vary
from trivial to so severe that the created structures are useless. nab offers two methods for
fixing bad sugar/backbone geometry. They are molecular mechanics and distance geometry.
nab provides distance geometry routines and has its own molecular mechanics package. The
latter is based on the LEaP program, which is part of the AMBER suite of programs developed
at the University of California, San Francisco and at The Scripps Research Institute. The text
version of LEaP, called tleap is distributed as a part of NAB.

10.13.1 Creating a Parallel DNA Triplex


Parallel DNA triplexes are thought to be intermediates in homologous DNA recombination.
These triplexes, investigated by Zhurkin et al.[165] are called R-form DNA, and are believed
to exist in two distinct conformations. In the presence of recombination proteins (eg. RecA),
they adopt an extended conformation that is underwound with respect to standard helices (a
twist of 20o) and very large base stacking distances (a rise of 5.1 Å). However, in the absence
of recombination proteins, R-form DNA exists in a "collapsed" form that resembles conven-
tional triplexes but with two very important differences—the two parallel strands have the same
sequence and the triplex can be made from any Watson/Crick duplex regardless of its base com-
position. The remainder of this section discusses how this triplex could be modeled and two
nab programs that implement that strategy.
If the degrees of freedom of a triplex are specified by the helicoidal parameters required
to place the bases, then a triplex of N bases has 6(N - 1) degrees of freedom, an impossibly
large number for any but trivial N. Fortunately, the nature of homologous recombination allows
some simplifying assumptions. Since the recombination must work on any duplex, the overall
shape of the triplex must be sequence independent. This implies that each helical step uses the

210
10.13 Structure Quality and Energetics

same set of transformational parameters which reduces the size of the problem to six degrees of
freedom once the individual base triads have been created.
The individual triads are created by assuming that they are planar, that the third base is hydro-
gen bonded on the major groove side of the base pair as it appears in a standard Watson/Crick
duplex, that the original Watson Crick base pair pair is essentially undisturbed by the insertion
of the third base and finally that the third base belongs at the point that maximizes its hydrogen
bonding with respect to the original Watson/Crick base pair. After the optimized triads have
been created, they are assembled into dimers. The dimers assume that the helical axis passes
through the center of the circle defined by the positions of the three C1’ atoms. Several instances
of a two parameter family (rise, twist) of dimers are created for each of the 16 pairs of triads
and minimized.

10.13.2 Creating Base Triads


Here is an nab program that computes the vacuum energy of XY:X base triads as a function of
the position and orientation of the X (non-Watson/Crick) base. A minimum energy AU:A found
by the program along with the potential energy surface keyed to the position of the second A
is shown in Figure 3. The program creates a single Watson/Crick DNA base pair and then
computes the energy of a third DNA base at each position of a user defined rectangular grid.
Since hydrogen bonding is both distance and orientation dependent the program allows the
user to specify a range of orientations to try at each grid point. The orientation giving the
lowest energy at each grid point and its associated energy are written to a file. The position and
orientation giving the lowest overall energy is saved and is used to recreate the best triad after
the search is completed.
 
1 // Program 5 - Investigate energies of base triads
2 molecule m;
3 residue tr;
4 string sb, ab, tb;
5 matrix rmat, tmat;
6

7 file ef;
8 string mfnm, efnm;
9 point txyz[ 35 ];
10 float x, lx, hx, xi, mx;
11 float y, ly, hy, yi, my;
12 float rz, lrz, hrz, rzi, urz, mrz, brz;
13

14 int prm;
15 point xyz[ 100 ], force[ 100 ];
16 float me, be, energy;
17

18 scanf( "%s %s %s", sb, ab, tb );


19 scanf( "%lf %lf %lf", lx, hx, xi );
20 scanf( "%lf %lf %lf", ly, hy, yi );
21 scanf( "%lf %lf %lf", lrz, hrz, rzi );
22

211
10 NAB: Introduction

23 mfnm = sprintf( "%s%s%[Link]", sb, ab, tb );


24 efnm = sprintf( "%s%s%[Link]", sb, ab, tb );
25

26 m = wc_helix(sb, "", "dna", ab,


27 "", "dna", 2.25, 0.0, 0.0, 0.0 );
28

29 addstrand( m, "third" );
30 tr = getres( tb, "all_nucleic94.lib" );
31 addresidue( m, "third", tr );
32 setxyz_from_mol( m, "third::", txyz );
33

34 putpdb( m, "[Link]" ); m = getpdb_prm( "[Link]", "learpc.ff99SB", "", 0 );


35 mme_init( m, NULL, "::ZZZ", xyz, NULL );
36

37 ef = fopen( efnm, "w" );


38

39 mrz = urz = lrz - 1;


40 for( x = lx; x <= hx; x = x + xi ){
41 for( y = ly; y <= hy; y = y + yi ){
42 brz = urz;
43 for( rz = lrz; rz <= hrz; rz = rz + rzi ){
44 setmol_from_xyz( m, "third::", txyz );
45 rmat=newtransform( 0., 0., 0., 0., 0., rz );
46 transformmol( rmat, m, "third::" );
47 tmat=newtransform( x, y, 0., 0., 0., 0. );
48 transformmol( tmat, m, "third::" );
49

50 setxyz_from_mol( m, NULL, xyz );


51 energy = mme( xyz, force, 1 );
52

53 if( brz == urz ){


54 brz = rz; be = energy;
55 }else if( energy < be ){
56 brz = rz; be = energy;
57 }
58 if( mrz == urz ){
59 me = energy;
60 mx = x; my = y; mrz = rz;
61 }else if( energy < me ){
62 me = energy;
63 mx = x; my = y; mrz = rz;
64 }
65 }
66 fprintf( ef, "%10.3f %10.3f %10.3f %10.3fn",
67 x, y, brz, be );
68 }
69 }
70 fclose( ef );
71

212
10.13 Structure Quality and Energetics

72 setmol_from_xyz( m, "third::", txyz );


73 rmat = newtransform( 0.0, 0.0, 0.0, 0.0, 0.0, mrz );
74 transformmol( rmat, m, "third::" );
75 tmat = newtransform( mx, my, 0.0, 0.0, 0.0, 0.0 );
76 transformmol( tmat, m, "third::" );
77 putpdb( mfnm, m );
 
Program 5 begins by reading in a description of the desired triad and data defining the location
and granularity of the search area. It does this with the calls to the nab builtin scanf() on lines
18-21. scanf() uses its first argument as a format string which directs the conversion of text
versions of int, float and string values into their internal formats. The first call to scanf() reads
the three letters that specify the bases, the next two calls read the X and Y location, extent and
granularity of the the search rectangle and the last call reads in the first, last and increment
values that will be used specify the orientation of the third base at each point on the search grid.
Lines 23 and 24 respectively, create the names of the files that will hold the best structure
found and the values of the potential energy surface. The file names are created using the
builtin sprintf(). Like scanf() this function also uses its first argument as a format string, used
here to construct a string from the data values that follow it in the parameter list. The action of
these calls is to replace the each format descriptor (%s) with the values of the corresponding
string variable in the parameter list. The file names created for the AU:A shown in Figure 3 were
[Link] and [Link]. Format expressions and formatted I/O including the I/O
like sprintf() are discussed in the sections Format Expressions and Ordinary I/O Functions
of the nab Language Reference.
The triad is created in two major steps in lines 26-32. First a Watson/Crick base pair is created
with wc_helix(). The base pair has an X-offset of 2.25 Å and an inclination of 0.0 meaning it
lies in the XY plane. Twist and rise although they are not used in creating a single base pair
are also set to 0.0. The X-offset which is that of standard B-DNA was chosen to facilitate
extension of triplexes made from the triads created here with standard duplex DNA. Absent this
consideration any X-offset including 0.0 would have been satisfactory. A third strand ("third")
is added to m, the string tb is converted into a DNA residue and this residue is added to the new
strand. Finally in the coordinates of the third strand are saved in the point array txyz. Referring
to Figure 3, the third base is located directly on top of the Watson/Crick pair. A purine would
have its C4 atom at the origin and its C4-N1 vector along the Y axis; a pyrimidine its C6 at the
origin and its C6-N3 vector along the Y axis. Obviously this is not a real structure; however,
as will be seen in the next section, this initial placement greatly simplifies the transformations
required to explore the search area.

10.13.3 Finding the lowest energy triad


The energy calculation begins in line 34 and extends to line 69. Elements of the general
molecular mechanics code skeleton discussed in the Language Reference chapter are seen at
lines 34-35 and lines 50-51. Initialization takes place in lines 34 and 35 with the call to get-
pdb_prm() to prepare the information needed to compute molecular mechanics energies. The
force field routine is initialized in line 35, asking that all atoms be allowed to move. The actual
energy calculation is done in lines 50 and 51. setxyz_from_mol() copies the current conforma-
tion of mol into the point array xyz and then mme() evaluates the energy of this conformation.

213
10 NAB: Introduction

URA

6.5 Y

ADE
X

Y’
-4.5

-10 X’
-6

ADE

Figure 10.3: Minimum energy AUA triad and the potential energy surface.

Note that the energy evaluation is in a loop, in this case nested inside the three loops that control
the conformational search.
The search area shown in Figure 10.3 is on the left side of the Watson/Crick base pair. This
corresponds to inserting the third base into the major groove of the duplex. Now as the third base
is initially positioned at the origin with its hydrogen bonding edge pointing towards the top of
the page, it must be both moved to the left or in the -X direction and rotated approximately -90o
so that its hydrogen bonding sites can interact with those on the left side of the Watson/Crick
pair.
The search is executed by the three nested for loops in lines 40, 41 and 43. They control the
third base’s X and Y position and its orientation in the XY plane. Two transformations are used
to place the base. The first step of the placement process is in line 44 where the nab builtin
setmol_from_xyz() is used to restore the original (untransformed) coordinates of the base. The
call to newtransform() in line 45 creates a transformation matrix that will point the third base so
that its hydrogen bonding sites are aimed in the positive X direction. A second transformation
matrix created on line 47 is used to move the properly oriented third base to a point on the
search area. The call to setxyz_from_mol() extracts the coordinates of this conformation into
xyz and mme() computes and returns its energy.
The remainder of the loop determines if this is either the best overall energy or the best energy
for this grid point. Lines 53-57 compute the best energy at this point and lines 58-64 compute
the best overall energy. The complexity arises from the fact that the energy returned by mme()
can be any float value. Thus it is not possible to to pick a value that is guaranteed to be higher
than any value returned during the search. The solution is to use the value from the first iteration
of the loop as the value to test against. The two variables mrz and brz are used to indicate the
very first iteration and the first iteration of the rz loop. The gray rectangle of Figure 10.3 shows

214
10.13 Structure Quality and Energetics

the vacuum energy of the best AU:A triad found when the origin of the X’ Y’ axes are at that
point on the rectangle. Darker grays are lower energies. Figure 10.3 shows the best AU:A found.

10.13.4 Assembling the Triads into Dimers


Once the minimized base triads have been created, they must be assembled into triplexes.
Since these triplexes are believed to be intermediates in homologous recombination, their struc-
ture should be nearly sequence independent. This means that they can be assembled by applying
the same set of helical parameters to each optimized triad. However, several things still need to
be determined. These are the location of the helical axis and just what helical parameters are
to be applied. This code assumes that the three backbone strands are roughly on the surface of
a cylinder whose axis is the global helical axis. In particular the helical axis is the center of
the circle defined by the three C1’ atoms in each triad. While the four circles defined by the
four minimized triads are not exactly the same, their radii are within X Å of each other with the
XY:X triad having the largest offset of Y Å. The code makes two additional assumptions. The
sugar rings are all in the C2’-endo conformation and the triads are not inclined with respect to
the helical axis. The program that creates and evaluates the dimers is shown below. A detailed
explanation of the program follows the listing.
 
1 // Program 6 - Assemble triads into dimers
2 molecule gettriad( string mname )
3 {
4 molecule m;
5 point p1, p2, p3, pc;
6 matrix mat;
7

8 if( mname == "a" ){


9 m = getpdb( "[Link]" );
10 setpoint( m, "A:ADE:C1’", p1 );
11 setpoint( m, "B:THY:C1’", p2 );
12 setpoint( m, "C:ADE:C1’", p3 );
13 }else if( mname == "c" ){
14 m = getpdb( "[Link]" );
15 setpoint( m, "A:CYT:C1’", p1 );
16 setpoint( m, "B:GUA:C1’", p2 );
17 setpoint( m, "C:CYT:C1’", p3 );
18 }else if( mname == "g" ){
19 m = getpdb( "[Link]" );
20 setpoint( m, "A:GUA:C1’", p1 );
21 setpoint( m, "B:CYT:C1’", p2 );
22 setpoint( m, "C:GUA:C1’", p3 );
23 }else if( mname == "t" ){
24 m = getpdb( "[Link]" );
25 setpoint( m, "A:THY:C1’", p1 );
26 setpoint( m, "B:ADE:C1’", p2 );
27 setpoint( m, "C:THY:C1’", p3 );
28 }
29 circle( p1, p2, p3, pc );

215
10 NAB: Introduction

30 mat = newtransform( -pc.x, -pc.y, -pc.z, 0.0, 0.0, 0.0 );


31 transformmol( mat, m, NULL );
32 setreskind( m, NULL, "DNA" );
33 return( m );
34 };
35

36 int mk_dimer( string ti, string tj )


37 {
38 molecule mi, mj;
39 matrix mat;
40 int sid;
41 float ri, tw;
42 string ifname, sfname, mfname;
43 file idx;
44

45 int natoms;
46 float dgrad, fret;
47 float box[ 3 ];
48 float xyz[ 1000 ];
49 float fxyz[ 1000 ];
50 float energy;
51

52 sid = 0;
53 mi = gettriad( ti );
54 mj = gettriad( tj );
55 mergestr( mi, "A", "last", mj, "A", "first" );
56 mergestr( mi, "B", "first", mj, "B", "last" );
57 mergestr( mi, "C", "last", mj, "C", "first" );
58 connectres( mi, "A", 1, "O3’", 2, "P" );
59 connectres( mi, "B", 1, "O3’", 2, "P" );
60 connectres( mi, "C", 1, "O3’", 2, "P" );
61

62 putpdb( "[Link]", mi );
63 mi = getpdb_prm( "[Link]", "leaprc.ff99SB", "", 0 );
64

65 ifname = sprintf( "%s%[Link]", ti, tj );


66 idx = fopen( ifname, "w" );
67 for( ri = 3.2; ri <= 4.4; ri = ri + .2 ){
68 for( tw = 25; tw <= 45; tw = tw + 5 ){
69 sid = sid + 1;
70 fprintf( idx, "%3d %5.1f %5.1f", sid, ri, tw );
71

72 mi = gettriad( ti );
73 mj = gettriad( tj );
74

75 mat = newtransform( 0.0, 0.0, ri, 0.0, 0.0, tw );


76 transformmol( mat, mj, NULL );
77

78 mergestr( mi, "A", "last", mj, "A", "first" );

216
10.13 Structure Quality and Energetics

79 mergestr( mi, "B", "first", mj, "B", last" );


80 mergestr( mi, "C", last", mj, "C", "first" );
81 connectres( mi, "A", 1, "O3’", 2, "P" );
82 connectres( mi, "B", 1, "O3’", 2, "P" );
83 connectres( mi, "C", 1, "O3’", 2, "P" );
84

85 sfname = sprintf( "%s%s3.%[Link]", ti, tj, sid );


86 putpdb( sfname, mi ); // starting coords
87

88 natoms = getmolyz( mi, NULL, xyz );


89 mme_init( mi, NULL, "::ZZZ", xyz, NULL );
90

91 dgrad = 3*natoms*0.001;
92 conjgrad( xyz, 3*natoms, fret, mme, dgrad, 10., 100 );
93 energy = mme( xyz, fxyz, 1 );
94

95 setmol_from_xyz( mi, NULL, xyz );


96 mfname = sprintf( "%s%s3.%[Link]", ti, tj, sid );
97 putpdb( mfname, mi ); // minimized coords
98 }
99 }
100 fclose( idx );
101 };
102

103 int i, j;
104 string ti, tj;
105 for( i = 1; i <= 4; i = i + 1 ){
106 for( j = 1; j <= 4; j = j + 1 ){
107 ti = substr( "acgt", i, 1 );
108 tj = substr( "acgt", j, 1 );
109 mk_dimer( ti, tj );
110 }
111 }
 
Program 6 assembles, minimizes and writes the final energies of a family of dimers for each
of the 16 pairs of optimized triads. The program is long but straightforward. It is organized into
two subroutines followed by a main program. The first subroutine gettriad() is defined in lines
2-34, the second subroutine mk_dimer() in lines 36-101 and the main program in lines 103-111.
The overall organization is that the main program controls the sequence of the dimers beginning
with AA and continuing with AC, AG, ... and on up to TT. Each time it selects the sequence of
the dimer, it calls mk_dimer() to explore the family of structures defined by variation in the rise
and twist. mk_dimer() in turn calls gettriad() to fetch and orient the specified base triples.
The function gettriad() (lines 2-34) takes a string with one of the four values "a", "c", "g" or "t".
The if-tree in lines 8-28 uses this string to select the coordinates of the corresponding optimized
triad. The if-tree sets the value of the three points p1, p2 and p3 that will be used to define the
circle whose center will intersect the global helical axis. Once these points are defined, the nab
builtin circle() (line 29) returns the center of the circle they define in pc. The builtin circle()
returns a 1 if the three points do not define a circle and a 0 if they do. In this case it is known

217
10 NAB: Introduction

that the positions of the three C1’ atoms are well behaved, so the return value is ignored. The
selected triad is properly centered in lines 30-31. Each residue of the triad is set to be of type
"DNA" via the call to setreskind() in line 32 so that its atomic charges and forcefield potentials
can be set correctly to perform the minimization. The new molecule is returned as the function’s
value in line 33.
The dimers are created by the function mk_dimers() that is defined in lines 36-101. The
process uses two stages. The molecule is first prepared for molecular mechanics in lines 53-63
and then dimers are created and minimized in the two nested loops in lines 67-99. The results
of the minimizations are stored in a file whose name is derived from the name of the triads in
the dimer. For example, the results for an AA would be in the file "[Link]". There is one file
for each of the 16 dimers. The file name is created in line 65 and opened for writing in line 66.
It is closed just before the function returns in line 100. Each line of the file contains a number
that identifies the dimer’s parameters followed by its rise, twist and final (minimized) energy.
In order to perform molecular on a molecule the nab program must create a parameter struc-
ture for it. This structure contains the topology of the molecule and parameters for the various
terms of forcefield–things like bond lengths and angles, torsions, chirality and planarity. This
is done in lines 53-63. The particular dimer is created. The function gettriad() is called twice to
return the two properly centered triads in the molecules mi and mj. Next the three strands of mj
are merged into the three strands of mi to create a triplex of length 2. The "A" and "B" strands
form the Watson/Crick pairs of the triplex and the "C" strand contains the strand that is parallel
to the "A" strand. The three calls to connectres() create an O3’-P bond between the newly added
residue and the existing residues in each of the three strands. After all this is done, the call to
getpdb_prm() in line 63 builds the parameter structure, returning 1 on failure and 0 on success.
This section of code seems simple enough except for one thing—the two triads in the dimer
are obviously directly on top of each other. However, this is not a problem because get-
pdb_prm() ignores the molecule’s coordinates. Instead it uses the molecule’s residue names
to get each residue’s internal coordinates and other information from a library which it uses to
up the parameter and topology structure required by the minimization routines.
The dimers are built and minimized in the two nested loops in lines 69-104. The outer loop
varies the rise from 3.2 to 4.4 Å by 0.2 Å, and the inner loop varies the twist from 25o to 45o
in steps of 5o, creating 35 different starting dimers. The variable sid is a number that identifies
each (rise,twist) pair. It is inserted into the file names of the starting coordinates (lines 85-86)
and minimized coordinates (lines 96-97) to make it easy to identify them.
Each dimer is created in lines 72-83. The two specified triads are returned by the calls to
gettriad() as the molecule’s mi and mj. Next the triad in mj is transformed to give it the current
rise and twist with respect to the triad in mi. The transformed triad in mj is merged into mi
and bonded to mi. These starting coordinates are written to a file whose name contains both
the dimer sequence and sid. For example, the first dimer for AA would be "[Link]", the 01
indicating that this dimer used a rise of 3.2 Å and a twist of 25o.
The minimization is performed in lines 88-95. The call to setxyz_from_mol() extracts the
current atom positions of mi into the array xyz. The coordinates are passed to mme_init() which
initializes the molecular mechanics system. The actual minimization is done with the call to
conjgrad() which performs 100 cycles of conjugate gradient minimization, printing the results
every 10 cycles. The final energy is written to the file idx and the molecule’s original coordinates
are updated with the minimized coordinates by the call to setmol_from_xyz(). Once all dimers

218
10.13 Structure Quality and Energetics

have been made for this sequence the loops terminate. The last thing done by mk_dimer() before
it returns to the main program is to close the file containing the energy results for this family of
dimer.

219
11 NAB: Language Reference

11.1 Introduction
nab is a computer language used to create, modify and describe models of macromolecules,
especially those of unusual nucleic acids. The following sections provide a complete description
of the nab language. The discussion begins with its lexical elements, continues with sections on
expressions, statements and user defined functions and concludes with an explanation of each
of nab’s builtin functions. Two appendices contain a more detailed and formal description of
the lexical and syntactic elements of the language including the actual lex and yacc input used
to create the compiler. Two other appendices describe nab’s internal data structures and the C
code generated to support some of nab’s higher level operations.

11.2 Language Elements


An nab program is composed of several basic lexical elements: identifiers, reserved words,
literals, operators and special characters. These are discussed in the following sections.

11.2.1 Identifiers
An identifier is a sequence of letters, digits and underscores beginning with a letter. Upper
and lower case letters are distinct. Identifiers are limited to 255 characters in length. The
underscore (_) is a letter. Identifiers beginning with underscore must be used carefully as they
may conflict with operating system names and nab created temporaries. Here are some nab
identifiers.

mol i3 twist TWIST Watson_Crick_Base_Pair

11.2.2 Reserved Words


Certain identifiers are reserved words, special symbols used by nab to denote control flow
and program structure. Here are the nab reserved words:

allocate assert atom bounds break


continue deallocate debug delete dynamic
else file for float hashed
if in int matrix molecule
point residue return string while

221
11 NAB: Language Reference

11.2.3 Literals
Literals are self defining terms used to introduce constant values into expressions. nab
provides three types of literals: integers, floats and character strings. Integer literals are
sequences of one or more decimal digits. Float literals are sequences of decimal digits that
include a decimal point and/or are followed by an exponent. An exponent is the letter e or E
followed by an optional + or - followed by one to three decimal digits. The exponent is
interpreted as “times 10 to the power of exp” where exp is the number following the e or E. All
numeric literals are base 10. Here are some integer and float literals:

1 3.14159 5 .234 3.0e7 1E-7

String literals are sequences of characters enclosed in double quotes ("). A double quote is
placed into a string literal by preceding it with a backslash (\). A backslash is inserted into a
string by preceding it with a backslash. Strings of zero length are permitted.

"" "a string" "string with a \"" "string with a \\"

Non-printing characters are inserted into strings via escape sequences: one to three characters
following a backslash. Here are the nab string escapes and their meanings:

\a Bell (a for audible alarm)


\b Back space
\f Form feed (new page)
\n New line
\r Carriage return
\t Horizontal tab
\v Vertical tab
\” Literal double quote
\\ Literal backspace
\ooo Octal character
\xhh Hex character (hh is 1 or 2 hex digits

Here are some strings with escapes:

"Molecule\tResidue\tAtom\n"
"\252Real quotes\272"

The second string has octal values, \252, the left double quote, and \272, the right double
quote.

11.2.4 Operators
nab uses several additional 1 or 2 character symbols as operators. Operators combine literals
and identifiers into expressions.

222
11.3 Higher-level constructs

Operator Meaning Precedence Associates


() expression grouping 9
[] array indexing 9
. select attribute 8
unary − negation 8 right to left
! not 8
^ cross product 6 left to right
@ dot product 6
* multiplication 6 left to right
/ division 6 left to right
% modulus 6 left to right
+ addition, concatenation 5 left to right
binary − subtraction 5 left to right
< less than 4
<= less than or equal to 4
== equal 4
!= not equal 4
>= greater than or equal to 4
> greater than 4
=~ match 4
!~ doesn’t match 4
in hashed array member 4
or atom in molecule
&& and 3
|| or 2
= assignment 1 right to left

11.2.5 Special Characters


nab uses braces ({}) to group statements into compound statements and statements and dec-
larations into function bodies. The semicolon (;) is used to terminate statements. The comma
(,) separates items in parameter lists and declarations. The sharp (#) used in column 1 desig-
nates a preprocessor directive, which invokes the standard C preprocessor to provide constants,
macros and file inclusion. A # in any other column, except in a comment or a literal string is an
error. Two consecutive forward slashes (//) indicate that the rest of the line is a comment which
is ignored. All other characters except white space (spaces, tabs, newlines and formfeeds) are
illegal except in literal strings and comments.

11.3 Higher-level constructs


11.3.1 Variables
A variable is a name given to a part of memory that is used to hold data. Every nab variable
has type which determines how the computer interprets the variable’s contents. nab provides

223
11 NAB: Language Reference

10 data types. They are the numeric types int and float which are translated into the underlying
C compiler’s int and double respectively.*
The string type is used to hold null (zero byte) terminated (C) character strings. The file
type is used to access files (equivalent to C’s FILE *). There are three types—atom, residue
and molecule for creating and working with molecules. The point type holds three float values
which can represent the X, Y and Z coordinates of a point or the components of a 3-vector. The
matrix type holds 16 float values in a 4×4 matrix and the bounds type is used to hold distance
bounds and other information for use in distance geometry calculations.
nab string variables are mapped into C char * variables which are allocated as needed and
freed when possible. However, all of this is invisible at the nab level where strings are atomic
objects. The atom, residue, molecule and bounds types become pointers to the appropriate C
structs. point and matrix are implemented as float [3] and float [4][4] respectively. Again the nab
compiler automatically generates all the C code required to makes these types appear as atomic
objects.
Every nab variable must be declared. All declarations for functions or variables in the main
block must precede the first executable statement of that block. Also all declarations in a user
defined nab function must precede the first executable statement of that function. An nab
variable declaration begins with the reserved word that specifies the variable’s type followed
by a comma separated list of identifiers which become variables of that type. Each declaration
ends with a semicolon.

int i, j, j;
matrix mat;
point origin;

Six nab types—string, file, atom, residue, molecule and bounds use the predefined identifier
NULL to indicate a non-existent object of these types. nab builtin functions returning objects of
these types return NULL to indicate that the object could not be created. nab considers a NULL
value to be false. The empty nab string "" is not equal to NULL.

11.3.2 Attributes
Four nab types—atom, residue, molecule and point—have attributes which are elements of
their internal structure directly accessible at the nab level. Attributes are accessed via the
select operator (.) which takes a variable as its left hand operand and an attribute name (an
identifier) as its right. The general form is

[Link]

Most attributes behave exactly like ordinary variables of the same type. However, some
attributes are read only. They are not permitted to appear as the left hand side of an
assignment. When a read only attribute is passed to an nab function, it is copied into temporary
variable which in turn is passed to the function. Read only attributes are not permitted to
appear as destination variables in scanf() parameter lists. Attribute names are kept separate
from variable and function names and since attributes can only appear to the right of select
there is no conflict between variable and attribute names. For example, if x is a point, then

224
11.3 Higher-level constructs

x // the point variable x


x.x // x coordinate of x
.x // Error!

Here is the complete list of nab attributes.

Atom attributes Type Write? Meaning


atomname string yes Ordinarily taken from columns 13-16 of an input pdb
file, or from a residue library. Spaces are removed.
atomnum int no The number of the atom starting at 1 for each strand
in the molecule.
tatomnum int no The total number of the atom starting at 1. Unlike
atomnum, tatomnum does not restart at 1 for each
strand.
fullname string no The fully qualified atom name, having the form
strandnum:resnum:atomname.
resid string yes The resid of the residue containing this atom; see the
Residue attributes table.
resname string yes The name of the residue containing this atom.
resnum int no The number of the residue containing the atom.
resnum starts at 1 for each strand.
tresnum int no The total number of the residue containing this atom
starting at 1. Unlike resnum, tresnum does not restart
at 1 for each strand.
strandname string yes The name of the strand containing this atom.
strandnum int no The number of the strand containing this atom.
pos point yes point variable giving the atom’s position.
x,y,z float yes The Cartesian coordinates of this atom
charge float yes Atomic charge
radius float yes Dielectric radius
int1 int yes User-definable integer
float1 float yes User-definable float

225
11 NAB: Language Reference

Residue attributes Type Write? Meaning


resid string yes A 6-character string, ordinarily taken from columns
22-27 of a PDB file. It can be re-set to something
else, but should always be either empty or exactly 6
characters long, since this string is used (if it is not
empty) by putpdb.
resname string yes Three-character identifier
resnum int no The number of the residue. resnum starts at 1 for
each strand.
tresnum int no The total number of the residue, starting at 1. Unlike
resnum, tresnum does not restart at 1 for each strand.
strandname string yes The name of the strand containing this residue.
strandnum int no The number of the strand containing this residue.

Molecule attributes Type Write? Meaning


natoms int no The total number of atoms in the molecule.
nresidues int no The total number of residues in the molecule.
nstrands int no The total number of strands in the molecule.

11.3.3 Arrays
nab supports two kinds of arrays—ordinary arrays where the selector is a comma separated
list of integer expressions and associative or “hashed” arrays where the selector is a character
string. The set of character strings that is associated with data in a hashed array is called its
keys. Array elements may be of any nab type. All the dimensions of an ordinary array are
indexed from 1 to Nd , where Nd is the size of the d th dimension. Non parameter array
declarations are similar to scalar declarations except the variable name is followed by either a
comma separated list of integer constants surrounded by square brackets ([]) for ordinary
arrays or the reserved word hashed in square brackets for associative arrays. Associative
arrays have no predefined size.

float energy[ 20 ], surface[ 13,13 ];


int attr[ dynamic, dynamic ];
molecule structs[ hashed ];

The syntax for multi-dimensional arrays like that for Fortran, not C. The nab2c compiler lin-
earizes all index references, and the underlying C code sees only single-dimension arrays. Ar-
rays are stored in "column-order", so that the most-rapidly varying index is the first index, as in
Fortran. Multi-dimensional int or float arrays created in nab can generally be passed to Fortran
routines expecting the analogous construct.
Dynamic arrays are not allocated space upon program startup, but are created and freed by
the allocate and deallocate statements:

226
11.3 Higher-level constructs

allocate attr[ i, j ];
....
deallocate attr;

Here i and j must be integer expressions that may be evaluated at run-time. It is an error (gen-
erally fatal) to refer to the contents of such an array before it has been allocated or after it has
been deallocated.

11.3.4 Expressions
Expressions use operators to combine variables, constants and function values into new val-
ues. nab uses standard algebraic notation (a+b*c, etc) for expressions. Operators with higher
precedence are evaluated first. Parentheses are used to alter the evaluation order. The complete
list of nab operators with precedence levels and associativity is listed under Operators.
nab permits mixed mode arithmetic in that int and float data may be freely combined in
expressions as long as the operation(s) are defined. The only exceptions are that the modulus
operator (%) does not accept float operands, and that subscripts to ordinary arrays must be
integer valued. In all other cases except parameter passing and assignment, when an int and
float are combined by an operator, the int is converted to float then the operation is executed. In
the case of parameter passing, nab requires (but does not check) that actual parameters passed
to functions have the same type as the corresponding formal parameters. As for assignment (=)
the right hand side is converted to the type of the left hand side (as long as both are numeric)
and then assigned. nab treats assignment like any other binary operator which permits multiple
assignments (a=b=c) as well as “embedded” assignments like:
if( mol = newmolecule() ) ...

nab relational operators are strictly binary. Any two objects can be compared provided that
both are numeric, both are string or both are the same type. Comparisons for objects other than
int, float and string are limited to tests for equality. Comparisons between file, atom, residue,
molecule and bounds objects test for “pointer” equality, meaning that if the pointers are the
same, the objects are same and thus equal, but if the pointers are different, no inference about
the actual objects can be made. The most common comparison on objects of these types is
against NULL to see if the object was correctly created. Note that as nab considers NULL to be
false the following expressions are equivalent.
if( var == NULL )... is the same as if( !var )...
if( var != NULL )... is the same as if( var )...

The Boolean operators && and || evaluate only enough of an expression to determine its truth
value. nab considers the value 0 to be false and any non-zero value to be true. nab supports di-
rect assignment and concatenation of string values. The infix + is used for string concatenation.
nab provides several infix vector operations for point values. They can be assigned and point
valued functions are permitted. Two point values can be added or subtracted. A point can be
multiplied or divided by a float or an int. The unary minus can be applied to a point which has
the same effect as multiplying it by -1. Finally, the at sign (@) is used to form the dot product
of two points and the circumflex ( ˆ) is used to form their cross product.

227
11 NAB: Language Reference

11.3.5 Regular expressions


The =∼ and !∼ operators (match and not match) have strings on the left-hand-sides and
regular expression strings on their right-hand-sides. These regular expressions are interpreted
according to standard conventions drawn from the UNIX libraries.

11.3.6 Atom Expressions


An atom expression is a character string that contains one or more patterns that match a set of
atom names in a molecule. Atom expressions contain three substrings separated by colons (:).
They represent the strand, residue and atom parts of the atom expression. Each subexpression
consists of a comma (,) separated list of patterns, or for the residue part, patterns and/or number
ranges. Several atom expressions may be placed in a single character string by separating them
with the vertical bar (|).
Patterns in atom expressions are similar to Unix shell expressions. Each pattern is a sequence
of 1 or more single character patterns and/or stars (*). The star matches zero or more occurrences
of any single character. Each part of an atom expression is composed of a comma separated
list of limited regular expressions, or in the case of the residue part, limited regular expressions
and/or ranges. A range is a number or a pair of numbers separated by a dash. A regular expres-
sion is a sequence of ordinary characters and “metacharacters”. Ordinary characters represent
themselves, while the metacharacters are operators used to construct more complicated patterns
from the ordinary characters. All characters except ?, *, [, ], -, ,(comma), : and | are ordinary
characters. Regular expressions and the strings they match follow these rules.

aexpr matches
x An ordinary character matches itself.
? A question mark matches any single character.
* A star matches any run of zero of more characters. The pattern *
matches anything.
[xyz] A character class. It matches a single occurrence of any character
between the [ and the ].
[^xyz] A “negated” character class. It matches a single occurrence of any
character not between the ˆ and the ]. Character ranges, f-l , are
permitted in both types of character class. This is a shorthand for all
characters beginning with f up to and including l. Useful ranges are 0-9
for all the digits and a-zA-Z for all the letters.
- The dash is used to delimit ranges in characters classes and to separate
numbers in residue ranges.
$ The dollar sign is used in a residue range to represent the “last” residue
without having to know its number.
, The comma separates regular expressions and/or ranges in an atom
expression part.
: The colon separates the parts of an atom expression.
| The vertical bar separates atom expressions in the same character string.
\ The backslash is used as an escape. Any character including
metacharacters following a backslash matches itself.

228
11.3 Higher-level constructs

Atom expressions match the entire name. The pattern C, matches only C, not CA, HC, etc.
To match any name that begins with C use C*; to match any name that ends with C, use *C; to
match any name containing a C, use *C*. A table of examples was given in chapter 2.

11.3.7 Format Expressions


A format expression is a special character string that is used to direct the conversion between
the computer’s internal data representations and their character equivalents. nab uses the un-
derlying C compiler’s printf()/scanf() system to provide formatted I/O. This section provides a
short introduction to this system. For the complete description, consult any standard C refer-
ence. Note that since nab supports fewer types than its underlying C compiler, formatted I/O
options pertaining to the data subtypes (h,l,L) are not applicable to nab format expressions.
An input format string is a mixture of ordinary characters, spaces and format descriptors. An
output format string is mixture of ordinary characters including spaces and format descriptors.
Each format descriptor begins with a percent sign (%) followed by several optional characters
describing the format and ends with single character that specifies the type of the data to be
converted. Here are the most common format descriptors. The ... represent optional characters
described below.

%...c convert a character


%...d convert and integer
%...lf convert a float
%...s convert a string
%% convert a literal %

Input and output format descriptors and format expressions resemble each other and in many
cases the same format expression can be used for both input and output. However, the two types
of format descriptors have different options and their actions are sufficiently distinct to consider
in some detail. Generally, C based formatted output is more useful than C based formatted
input.
When an input format expression is executed, it is scanned at most once from left to right.
If the current format expression character is an ordinary character (anything but space or %), it
must match the current character in the input stream. If they match then both the current char-
acter of the format expression and current character of the stream are advanced one character
to the right. If they don’t match, the scan ends. If the current format expression character is a
space or a run of spaces and if the current input stream is one or more “white space” characters
(space, tab, newline), then both the format and input stream are advanced to the next non-white
space character. If the input format is one or more spaces but the current character of the input
stream is non-blank, then only the format expression is advanced to the next non-blank char-
acter. If the current format character is a percent sign, the format descriptor is used to convert
the next “field” in the input stream. A field is a sequence of non-blank characters surrounded
by white space or the beginning or end of the stream. This means that a format descriptor will
skip white space including newlines to find non blank characters to convert, even if it is the first
element of the format expression. This implicit scanning is what limits the ability of C based
formatted input to read fixed format data that contains any spaces.

229
11 NAB: Language Reference

Note that lf is used to input a NAB float variable, rather than the f argument that would be used
in C. This is because float in NAB is converted to double in the output C code (see defreal.h if
you want to change this behavior.) Ideally, the NAB compiler should parse the format string,
and make the appropriate substitutions, but this is not (yet) done: NAB translates the format
string directly into the C code, so that the NAB code must also generally use lf as a format
descriptor for floating point values.
nab input format descriptors have two options, a field width, and an assignment suppression
indicator. The field width is an integer which specifies how much of current field and not the
input stream is to be converted. Conversion begins with the first character of the field and stops
when the correct number of characters have been converted or white space is encountered. A
star (*) option indicates that the field is to be converted, but the result of the conversion is not
stored. This can be used to skip unwanted items in a data stream. The order of the two options
does not matter.
The execution of an output format expression is somewhat different. It is scanned once
from left to right. If the current character is not a percent sign, it placed on the output stream.
Thus spaces have no special significance in formatted output. When the scan encounters a
percent sign it replaces the entire format descriptor with the properly formatted value of the
corresponding output expression.
Each output format descriptor has four optional attributes—width, alignment, padding and
precision. The width is the minimum number of characters the data is to occupy for output.
Padding controls how the field will be filled if the number of characters required for the data is
less than the field width. Alignment specifies whether the data is to start in the first character of
the field (left aligned) or end in the last (right aligned). Finally precision, which applies only to
string and float conversions controls how much of the string is be converted or how many digits
should follow the decimal point.
Output field attributes are specified by optional characters between the initial percent sign
and the final data type character. Alignment is first, with left alignment specified by a minus
sign (-). Any other character after the percent sign indicates right alignment. Padding is spec-
ified next. Padding depends on both the alignment and the type of the data being converted.
Character conversions (%c) are always filled with spaces, regardless of their alignment. Left
aligned conversions are also always filled with spaces. However, right aligned string and nu-
meric conversions can use a 0 to indicate that left fill should be zeroes instead of spaces. In
addition numeric conversions can also specify an optional + to indicate that non-negative num-
bers should be preceded by a plus sign. The default action for numeric conversions is that
negative numbers are preceded by a minus, and other numbers have no sign. If both 0 and + are
specified, their order does not matter.
Output field width and precision are last and are specified by one or two integers or stars
(*) separated by a period (.). The first number (or star) is the field width, the second is its
precision. If the precision is not specified, a default precision is chosen based on the conversion
type. For floats (%f), it is six decimal places and for strings it is the entire string. Precision
is not applicable to character or integer conversions and is ignored if specified. Precision may
be specified without the field width by use of single integer (or star) preceded by a period.
Again, the action is conversion type dependent. For strings (%s), the action is to print the first
N characters of the string or the entire string, whichever is shorter. For floats (%f), it will print
N decimal places but will extend the field to whatever size if required to print the whole number

230
11.4 Statements

part of the float. The use of the star (*) as an output width or precision indicates that the width
or precision is specified as the next argument in the conversion list which allows for runtime
widths and precisions.

Ouput format options


Alignment
- left justified
default right justified
Padding
0 %d, %f, %s only, left fill with zeros, right fill with spaces.
+ %d, %f only, precede non-negative numbers with a +.
default left and right fill with spaces.
Width & precision
W minimum field width of W . W is either an integer or a * where the star
indicates that the width is the next argument in the parameter list.
W.P minimum field width of W , with a precision of P. W,P are integers or
stars, where stars indicate that they are to be set from the appropriate
arguments in the parameter list. Precision is ignored for %c and %d.
.P %s, print the first P characters of the string or the entire string
whichever is shorter. %f, print P decimal places in a field wide enough
to hold the integer and fractional parts of the number. %c and %d, use
whatever width is required. Again P is either an integer or a star where
the star indicates that it is to be taken from the next expression in the
parameter list.
default %c, %d, %s, use whatever width is required to exactly hold the data. %f,
use a precision of 6 and whatever width is required to hold the data.

11.4 Statements
nab statements describe the action the nab program is to perform. The expression statement
evaluates expressions. The if statement provides a two way branch. The while and for statements
provide loops. The break statement is used to “short circuit” or exit these loops. The continue
statement advances a for loop to its next iteration. The return statement assigns a function’s
value and returns control to the caller. Finally a list of statements can be enclosed in braces ({})
to create a compound statement.

11.4.1 Expression Statement


An expression statement is an expression followed by a semicolon. It evaluates the
expression. Many expression statements include an assignment operator and its evaluation will
update the values of those variables on the left hand side of the assignment operator. These
kinds of expression statements are usually called “assignment statements” in other languages.
Other expression statements consist of a single function call with its result ignored. These
statements take the place of “call statements” in other languages. Note that an expression
statement can contain any expression, even ones that have no lasting effect.

231
11 NAB: Language Reference

mref = getpdb( "[Link]" ); // "assignment" stmt


m = getpdb( "[Link]" );
superimpose( m,"::CA",mref,"::CA" ); // "call" stmt
0; // expression stmt.

11.4.2 Delete Statement


nab provides the delete statement to remove elements of hashed arrays. The syntax is

delete h_array [ str ];

where h_array is a hashed array and str is a string valued expression. If the specified element
is in h_array it is removed; if not, the statement has no effect.

11.4.3 If Statement
The if statement is used to choose between two options based on the value of the if
expression. There are two kinds of if statements—the simple if and the if-else. The simple if
contains an expression and a statement. If the expression is true (any non-zero value), the
statement is executed. If the expression is false (0), the statement is skipped.

if( expr ) true_stmt;

The if-else statement places two statements under control of the if. One is executed if the
expression is true, the other if it is false.

if( expr )
true_stmt;
else
false_stmt;

11.4.4 While Statement


The while statement is used to execute the statement under its control as long as the the while
expression is true (non-zero). A compound statement is required to place more than one
statement under the while statement’s control.

while( expr ) stmt;


while( expr ) {
stmt_1;
stmt_2;
...
stmt_N ;
}

232
11.4 Statements

11.4.5 For Statement


The for statement is a loop statement that allows the user to include initialization and an
increment as well as a loop condition in the loop header. The single statement under the
control of the for statement is executed as long as the condition is true (non-zero). A
compound statement is required to place more than one statement under control of a for. The
general form of the for statement is

for( expr_1; expr_2; expr_3 ) stmt;

which behaves like

expr_1;
while( expr_2 ) {
stmt;
expr_3;
}

expr_3 is generally an expression that computes the next value of the loop index. Any or all of
expr_1, expr_2 or expr_3 can be omitted. An omitted expr_2 is considered to be true, thus
giving rise to an “infinite” loop. Here are some for loops.

for( i = 1; i <= 10; i = i + 1 )


printf( "%3d\n", i ); // print 1 to 10
for( ; ; ) // "infinite" loop
{
getcmd( cmd ); // Exit better be in
docmd( cmd ); // getcmd() or docmd().
}

nab also includes a special kind of for statement that is used to range over all the entries of a
hashed array or all the atoms of a molecule. The forms are

// hashed version
for( str in h_array ) ~stmt;
// molecule version
for( a in mol ) ~stmt;

In the first code fragment, str is string and h_array is a hashed array. This loop sets str to each
key or string associated with data in h_array. Keys are returned in increasing lexical order. In
the second code fragment a is an atom and mol is a molecule. This loop sets a to each atom in
mol. The first atom is the first atom in the first residue of the first strand. Once all the atoms in
this residue have been visited, it moves to the first atom of the next residue in the first strand.
Once all atoms in all residues in the first strand have been visited, the process is repeated on the
second and subsequent strands in mol until all atoms have been visited. The order of the strands
of molecule is the order in which they were created using addstrand(). Residues in each strand
are numbered from 1 to N. The order of the atoms in a residue is the order in which the atoms
were listed in the reslib entry or pdbfile that that residue derives from.

233
11 NAB: Language Reference

11.4.6 Break Statement


Execution of a break statement exits the immediately enclosing for or while loop. By placing
the break under control of an if conditional exits can be created. break statements are only
permitted inside while or for loops.
for( expr_1; expr_2; expr_3 ) {
...
if( expr ) break; // "break" out of loop
...
}

11.4.7 Continue Statement


Execution of a continue statement causes the immediately enclosing for loop to skip to its
next value. If the next value causes the loop control expression to be false, the loop is exited.
continue statements are permitted only inside while and for loops.
for( expr_1; expr_2; expr_3 ) {
... if( expr ) continue; // "continue" with next value
...
}

11.4.8 Return Statement


The return statement has two uses. It terminates execution of the current function returning
control to the point immediately following the call and when followed by an optional
expression, returns the value of the expression as the value of the function. A function’s
execution also ends when it “runs off the bottom”. When a function executes the last statement
of its definition, it returns even if that statement is not a return. The value of the function in
such cases is undefined.
return expr ; // return the value expr
return; // return, function value undefined.

11.4.9 Compound Statement


A compound statement is a list of statements enclosed in braces. Compound statements are
required when a loop or an if has to control more than one statement. They are also required
to associate an else with an if other than the nearest unpaired one. Compound statements may
include other compound statements. Unlike C, nab compound statements are not blocks and
may not include declarations.

11.5 Structures
A struct is collection of data elements, where the elements are accessed via their names.
Unlike arrays which require all elements of an array to have the same type, elements of a

234
11.5 Structures

structure can have different types. Users define a struct via the reserved word ‘struct’. Here’s a
simple example, a struct that could be used to hold a complex number.
struct cmplx_t { float r, i; } c;

This declares a nab variable, ‘c’, of user defined type ‘struct cmplx_t’. The variable, c, has two
float valued elements, ‘c.r’, ‘c.i’ which can be used like any other nab float variables:

c.r = -2.0; ... 5*c.i ... printf( "c.r,i = %8.3f, %8.3f\n", c.r, c.i );

Now, let’s look more closely at that struct declaration.


struct cmplx_t { float r, i; } c;

As mentioned before, every nab struct begins with the reserved word struct. This must be
followed by an identifier called the structure tag, which in this example is ‘cmplx_t’. Unlike
C/C++, a nab struct can not be anonymous.
Following the structure tag is a list of the struct’s element declarations surrounded by a left
and right curly bracket. Element declarations are just like ordinary nab variable declarations:
they begin with the type, followed by a comma separated list of variables and end with a semi-
colon. nab structures must contain at least one declaration containing at least one variable.
Also, nab struct elements are currently restricted to scalar values of the basic nab types, so nab
structs can not contain arrays or other structs. Note that in our example, both elements are in
one declaration, but two declarations would have worked as well.
The whole assembly ‘struct ... }’ serves to define a new type which can be used like any
other nab type to declare variables of that type, in this example, a single scalar variable, ‘c’.
And finally, like all other nab variable declarations, this one also ends with a semicolon.
Although nab structs can not contain arrays, nab allows users to create arrays, including
dynamic and hashed arrays of structs. For example

struct cmplx_t { float r, i; } a[ 10 ], da[ dynamic ], ha[ hashed ];

declares an ordinary, dynamic and hashed array of struct cmplx_t.


Up til now, we’ve only looked at complete struct declaration. Our example
struct cmplx_t { float r, i; } c;

contains all the parts of a struct declaration. However there are two other forms of struct
declarations. The first one is to define a type, as opposed to declaring variables:
struct cmplx_t { float r, i; };

defines a new type ‘struct cmplx_t’ but does not declare any variables of this type. This is quite
useful in that the type can be placed in a header file allowing it to be shared among parts of a
larger program.
The othe form of a struct declaration is this short form:
struct cmplx_t cv1, cv2;

235
11 NAB: Language Reference

This form can only be used once the type has been defined, either via a type declaration (ie not
variable) or a complete type + variable declaration. In fact, once a struct type has been defined,
all subsequent declarations of variables of that type, including parameters, must use the short
form.

struct cmplx_t { float r, i; }; // define type type ‘struct cmplx_t’


struct cmplx_t c, ctab[ 10 ]; // define some vars
int f( int s, struct cmplx_t ct[1] ) // func taking array of
// struct cmplx_t { ... };

11.6 Functions
A function is a named group of declarations and statements that is executed as a unit by using
the function’s name in an expression. Functions may include special variables called parameters
that enable the same function to work on different data. All nab functions return a value which
can be ignored in the calling expression. Expression statements consisting of a single function
call where the return value is ignored resemble procedure call statements in other languages.
All parameters to user defined nab functions are passed by reference. This means that each
nab parameter operates on the actual data that was passed to the function during the call.
Changes made to parameters during the execution of the function will persist after the func-
tion returns. The only exception to this is if an expression is passed in as a parameter to a user
defined nab function. It this case, nab evaluates the expression, stores its value in a compiler
created temporary variable and uses that temporary variable as the actual parameter. For exam-
ple if a user were to pass in the constant 1 to an nab function which in turned used it and then
assigned it the value 6, the 6 would be stored in the temporary location and the external 1 would
be unchanged.

11.6.1 Function Definitions


An nab function definition begins with a header that describes the function value type, the
function name and the parameters if any. If a function does not have parameters, an empty
parameter list is still required. Following the header is a list of declarations and statements
enclosed in braces. The function’s declarations must precede all of its statements. A function
can include zero or more declarations and/or zero or more statements. The empty function—no
declarations and no statements is legal.
The function header begins with the reserved word specifying the type of the function. All
nab functions must be typed. An nab function can return a single value of any nab type. nab
functions can not return nab arrays. Following the type is an identifier which is the name of
the function. Each parameter declaration begins with the parameter type followed by its name.
Parameter declarations are enclosed in parentheses and separated by commas. If a function has
no parameters, there is nothing between the parentheses. Here is the general form of a function
definition:

ftype fname( ptype1 parm1, ... )

236
11.7 Points and Vectors

{
decls
stmts
};

11.6.2 Function Declarations


nab requires that every function be declared or made known to the compiler before it is
used. Unfortunately this is not possible if functions used in one source file are defined in other
source files or if two functions are mutually recursive. To solve these problem, nab permits
functions to be declared as well as defined. A function declaration resembles the header of a
function definition. However, in place of the function body, the declaration ends with a
semicolon or a semicolon preceded by either the word c or the word fortran indicating the
external function is written in C or Fortran instead of nab.

ftype fname( ptype1 parm1, ... ) flang ;

11.7 Points and Vectors


The nab type point is an object that holds three float values. These values can represent the
X, Y and Z coordinates of a point or the components of 3-vector. The individual elements of a
point variable are accessed via attributes or suffixes added to the variable name. The three point
attributes are "x", "y" and "z". Many nab builtin functions use, return or create point values. When
used in this context, the three attributes represent the point’s X, Y and Z coordinates. nab allows
users to combine point values with numbers in expressions using conventional algebraic or
infix notation. nab does not support operations between numbers and points where the number
must be converted into a vector to perform the operation. For example, if p is a point then
the expression p + 1. is an error, as nab does not know how to expand the scalar 1. into a
3-vector. The following table contains nab point and vector operations. p, q are point variables;
s a numeric expression.

Operator Example Precedence Explanation


Unary - -p 8 Vector negation, same as -1 * p.
^ pˆ q 7 Compute the cross or vector product of p, q.
@ p@q 6 Compute the scalar or dot product of p, q.
* s*p 6 Multiply p by s, same as p * s.
/ p/s 6 Divide p by s, s / p not allowed.
+ p+q 5 Vector addition
Binary - p-q 5 Vector subtraction
== p == q 4 Test if p and q equal.
!= p != q 4 Test if p and q are different.
= p=q 1 Set the value of p to q.

237
11 NAB: Language Reference

11.8 String Functions


nab provides the following awk-like string functions. Unlike awk, the nab functions do not
have optional parameters or builtin variables that control the actions or receive results from
these functions. nab strings are indexed from 1 to N where N is the number of characters in the
string.

int length( string s );


int index( string s, string t );
int match( string s, string r, int rlength );
string substr( string s, int pos, int len );
int split( string s, string fields[], string fsep );
int sub( string r, string s, string t );
int gsub( string r, string s, string t );

length() returns the length of the string s. Both "" and NULL have length 0. index() returns the
position of the left most occurrence of t in s. If t is not in s, index() returns 0. match returns
the position of the longest leftmost substring of s that matches the regular expression r. The
length of this substring is returned in rlength. If no substring of s matches r, match() returns 0
and rlength is set to 0. substr() extracts the substring of length len from s beginning at position
pos. If len is greater than the rest of the string beginning at pos, return the substring from pos
to N where N is the length of the string. If pos is < 1 or > N, return "".
split() partitions s into fields separated by fsep. These field strings are returned in the array
fields. The number of fields is returned as the function value. The array fields must be allocated
before split() is called and must be large enough to hold all the field strings. The action of split()
depends on the value of fsep. If fsep is a string containing one or more blanks, the fields of s are
considered to be separated by runs of white space. Also, leading and trailing white space in s do
not indicate an empty initial or final field. However, if fsep contains any value but blank, then
fields are considered to be delimited by single characters from fsep and initial and/or trailing
fsep characters do represent initial and/or trailing fields with values of "". NULL and the empty
string "" have 0 fields. If both s and fsep are composed of only white space then s also has 0
fields. If fsep is not white space and s consists of nothing but characters from fsep, s will have
N + 1 fields of "" where N is the number of characters of s.
sub() replaces the leftmost longest substring of t that matches the regular expression r. gsub()
replaces all non overlapping substrings of t that match the regular expression r with the string s.

11.9 Math Functions


nab provides the following builtin mathematical functions. Since nab is intended for chem-
ical structure calculations which always measure angles in degrees, the argument to the trig
functions—cos(), sin() and tan()— and the return value of the inverse trig functions—acos(),
asin(), atan() and atan2()—are in degrees instead of radians as they are in other languages.
Note that the pseudo-random number functions have a different calling sequence than in ear-
lier versions of NAB; you may have to edit and re-compile earlier programs that used those
routines.

238
11.9 Math Functions

nab Builtin Mathematical Functions


Inverse Trig Functions.
float acos( float x ); Return cos−1 (x) in degrees.
float asin( float x ); Return sin−1 (x) in degrees.
float atan( float x ); Return tan−1 (x) in degrees.
float atan2( float x ); Return tan -1 ( y / x ) in degrees. By keeping x and y
separate, 90o can be returned without encountering a
zero divide. Also, atan2 will return an angle in the
full range [-180o, 180o].
Trig Functions
float cos( float x ); Return cos( x ), where x is in degrees.
float sin( float x ); Return sin( x ), where x is in degrees.
float tan( float x ); Return tan( x ), where x is in degrees.
Conversion Functions.
float atof( string str ); Interpret the next run of non blank characters in str as
a float and return its value. Return 0 on error.
int atoi( string str ); Interpret the next run of non blank characters in str as
an int and return its value. Return 0 on error.
Other Functions.
float rand2(); Return pseudo-random number in (0,1).
float gauss( float mean, float sd ); Return a pseudo-random number taken from a
Gaussian distribution with the given mean and
standard deviation. The rand2() and gauss() routines
share a common seed.
int setseed( int seed ); Reset the pseudo-random number sequence with the
new seed, which must be a negative integer.
int rseed( ); Use the system time() command to set the random
number sequence with a reasonably random seed.
Returns the seed it used; this could be used in a later
call to setseed() to regenerate the same sequence of
pseudo-random values.
float ceil( float x ); Return dxe.
float exp( float x ); Return ex .
float cosh( float x ); Return the hyperbolic cosine of x.
float fabs( float x ); Return |x|.
float floor( float x ); Return bxc.
float fmod( float x, float y ); Return r, the remainder of x with respect to y; the
signs of r and y are the same.
float log( float x ); Return the natural logarithm of x.
float log10( float x ); Return the base 10 logarithm of x.
float pow( float x, float y ); Return xy , x > 0.
float sinh( float x ); Return the hyperbolic sine of x.
float tanh( float x ); Return the hyperbolic tangent of x.
float sqrt( float x ); Return positive square root of x, x >= 0.

239
11 NAB: Language Reference

11.10 System Functions


int exit( int i );
int system( string cmd );

The function exit() terminates the calling nab program with return status i. system() invokes a
subshell to execute cmd. The subshell is always /bin/sh. The return value of system() is the
return value of the subshell and not the command it executed.

11.11 I/O Functions


nab uses the C I/O model. Instead of special I/O statements, nab I/O is done via calls to spe-
cial builtin functions. These function calls have the same syntax as ordinary function calls but
some of them have different semantics, in that they accept both a variable number of parameters
and the parameters can be various types. nab uses the underlying C compiler’s printf()/scanf()
system to perform I/O on int, float and string objects. I/O on point is via their float x, y and z
attributes. molecule I/O is covered in the next section, while bounds can be written using dump-
bounds(). Transformation matrices can be written using dumpmatrix(), but there is currently no
builtin for reading them. The value of an nab file object may be written by treating as an integer.
Input to file variables is not defined.

11.11.1 Ordinary I/O Functions


nab provides these functions for stream or FILE * I/O of int, float and string objects.

int fclose( file f );


file fopen( string fname, string mode );
int unlink( string fname );
int printf( string fmt, ... );
int fprintf( file f, string fmt, ... );
string sprintf( string fmt, ... );
int scanf( string fmt, ... );
int fscanf( file f, string fmt, ... );
int sscanf( string str, string fmt, ... );
string getline( file f );

fclose() closes (disconnects) the file represented by f. It returns 0 on success and -1 on failure.
All open nab files are automatically closed when the program terminates. However, since the
number of open files is limited, it is a good idea to close open files when they are no longer
needed. The system call unlink removes (deletes) the file.
fopen() attempts to open (prepare for use) the file named fname with mode mode. It returns
a valid nab file on success, and NULL on failure. Code should thus check for a return value of
NULL, and do the appropriate thing. (An alternative, safe_fopen() sends an error message to
stderr and exits on failure; this is sometimes a convenient alternative to fopen() itself, fitting with
a general bias of nab system functions to exit on failure, rather than to return error codes that

240
11.11 I/O Functions

must always be processed.) Here are the most common values for mode and their meanings.
For other values, consult any standard C reference.
fopen() mode values
“r” Open for reading. The file fname must exist and be readable by
the user.
“w” Open for writing. If the file exists and is writable by the user,
truncate it to zero length. If the file does not exist, and if the
directory in which it will exist is writable by the user, then
create it.
“a” Open for appending. The file must exist and be writable by the
user.
The three functions printf(), fprintf() and sprintf() are for formatted (ASCII) output to stdout,
the file f and a string. Strictly speaking, sprintf() does not perform output, but is discussed here
because it acts as if “writes” to a string. Each of these functions uses the format string fmt to
direct the conversion of the expressions that follow it in the parameter list. Format strings and
expressions are discussed Format Expressions. The first format descriptor of fmt is used to
convert the first expression after fmt, the second descriptor, the next expression etc. If there are
more expressions than format descriptors, the extra expressions are not converted. If there are
fewer expressions than format descriptors, the program will likely die when the function tries
to covert non-existent data.
The three functions scanf(), fscanf() and sscanf() are for formatted (ASCII) input from stdin,
the file f and the string str. Again, sscanf() does not perform input but the function behaves like
it is “reading” from str. The action of these functions is similar to their output counterparts in
that the format expression in fmt is used to direct the conversion of characters in the input and
store the results in the variables specified by the parameters following fmt. Format descriptors
in fmt correspond to variables following fmt, with the first descriptor corresponding to the first
variable, etc. If there are fewer descriptors than variables, then extra variables are not assigned;
if there are more descriptors than variables, the program will most likely die due to a reference
to a non-existent address.
There are two very important differences between nab formatted I/O and C formatted I/O. In
C, formatted input is assigned through pointers to the variables (&var). In nab formatted I/O,
the compiler automatically supplies the addresses of the variables to be assigned The second
difference is when a string object receives data during an nab formatted I/O. nab strings are
allocated when needed. However, in the case of any kind of scanf() to a string or the implied
(and hidden) writing to a string with sprintf(), the number of characters to be written to the string
is unknown until the string has been written. nab automatically allocates strings of length 256
to hold such data with the idea that 256 is usually big enough. However, there will be cases
where it is not big enough and this will cause the program to die or behave strangely as it will
overwrite other data.
Also note that the default precision for floats in nab is double precision (see $NABHOME/sr-
c/defreal.h, since this could be changed, or may be different on your system.) Formats for floats
for the scanf functions then need to be "%lf" rather than "%f".
The getline() function returns a string that has the next line from file f. The end-of-line
character has been stripped off.

241
11 NAB: Language Reference

11.11.2 matrix I/O


NAB uses 4x4 matrices to represent coordinate transformations:

r r r 0
r r r 0
r r r 0
dx dy dz 1

The r’s are a 3x3 rotation matrix, and the d’s are the translations along the X,Y and Z axes.
NAB coordinates are row vectors which are transformed by appending a 1 to each point
(x,y,z) -> (x,y,z,1), post multiplying by the transformation matrix, and then discarding the final
1 in the new point.
Two builtins are provided for reading/writing transformation matrices.

matrix getmatrix(string filename);

Read the matrix from the file with name filename. Use "-" to read a matrix from stdin. A
matrix is 4 lines of 4 numbers. A line of less than 4 numbers is an error, but anything after the
4th number is ignored. Lines beginning with a ’#’ are comments. Lines after the 4th data line
are not read. Return a matrix with all zeroes on error, which can be tested:

mat = getmatrix("[Link]");
if(!mat){ fprintf(stderr, "error reading matrix\n"); ... }

Keep in mind that nab transformations are intended for use on molecular coordinates, and that
transformations like scaling and shearing [which can not be created with nab directly but can
now be introduced via getmatrix()] may lead to incorrect on non-sensical results.

int putmatrix(string filename, matrix mat);

Write matrix mat to to file with name filename. Use "-" to write a matrix to stdout. There is
currently no way to write matrix to stderr. A matrix is writen as 4 lines of 4 numbers. Return 0
on success and 1 on failure.

11.12 Molecule Creation Functions


The nab molecule type has a complex and dynamic internal structure organized in a three
level hierarchy. A molecule contains zero or more named strands. Strand names are strings of
any characters except white space and can not exceed 255 characters in length. Each strand in
a molecule must have a unique name. Strands in different molecules may have the same name.
A strand contains zero or more residues. Residues in each strand are numbered from 1. There
is no upper limit on the number of residues a strand may contain. Residues have names, which
need not be unique. However, the combination of strand-name:res-num is unique for every
residue in a molecule. Finally residues contain one or more atoms. Each atom name in a
residue should be distinct, although this is neither required nor checked by nab. nab uses the
following functions to create and modify molecules.

242
11.13 Creating Biopoloymers

molecule newmolecule();
molecule copymolecule( molecule mol );
int freemolecule( molecule mol );
int freeresidue( residue r );
int addstrand( molecule mol, string sname );
int addresidue( molecule mol, string sname, residue res );
int connectres( molecule mol, string sname, int res1, string aname1,
int res2, string aname2 );
int mergestr( molecule mol1, string str1, string end1, molecule mol2, string str2, string end2 );
newmolecule() creates an “empty” molecule—one with no strands, residues or atoms. It returns
NULL if it can not create it. copymolecule() makes a copy of an existing molecule and returns
a NULL on failure. freemolecule() and freeresidue() are used to deallocate memory set aside
for a molecule or residue. In most programs, these functions are usually not necessary, but
should be used when a large number of molecules are being copied. Once a molecule has been
created, addstrand() is used to add one or more named strands. Strands can be added at any to
a molecule. There is no limit on the number of strands in a molecule. Strands can be added
to molecules created by getpdb() or other functions as long as the strand names are unique.
addstrand() returns 0 on success and 1 on failure. Finally addresidue() is used to add residues
to a strand. The first residue is numbered 1 and subsequent residues are numbered 2, 3, etc.
addresidue() also returns 0 on success and 1 on failure.
nab requires that users explicitly make all inter-residue bonds. connectres() makes a bond
between two atoms of different residues of the strand with name sname. It returns 0 on success
and 1 on failure. Atoms in different strands can not be bonded. The bonding between atoms in
a residue is set by the residue library entry and can not be changed at runtime at the nab level.
The last function mergestr() is used to merge two strands of the same molecule or copy a
strand of the second molecule into a strand of the first. The residues of a strand are ordered
from 1 to N, where N is the number of residues in that strand. nab imposes no chemical
ordering on the residues in a strand. However, since the strands are generally ordered, there are
four ways to combine the two strands. mergestr() uses the two values "first" and "last" to stand
for residues 1 and N. The four combinations and their meanings are shown in the next table. In
the table, str1 has N residues and str2 has M residues.
end1 end2 Action
first first The residues of str2 are reversed and then inserted before those
of str1: M , ..., 2, 1 : 1 , 2 , ..., N
first last The residues of str2 are inserted before those of str1: 1 , 2, ...,
M : 1 , 2 , ..., N
last first The residues of str2 are inserted after those of str1: 1 , 2 , ..., N
: 1 , 2 , ..., M
last last The residues of str2 are reversed and then inserted after those
of str1: 1 , 2 , ..., N : M , ..., 2 , 1

11.13 Creating Biopoloymers


molecule linkprot( string strandname, string seq, string reslib );

243
11 NAB: Language Reference

molecule link_na( string strandname, string seq, string reslib, string natype,
string opts );
molecule getpdb_prm( string pdb-
file, string leaprc, string leap_cmd2, int savef )

Although many nab functions don’t care what kind of molecule they operate on, many oper-
ations require molecules that are compatible with the Amber force field libraries (see Chapter
6). The best and most general way to do this is to use tleap commands, described in Chapter 8).
The link_prot() and link_na() routines given here are limited commands that may sometimes be
useful, and are included for backwards compatibility with earlier versions of NAB.
linkprot() takes a strand identifier and a sequence, and returns a molecule with this sequence.
The molecule has an extended structure, so that the φ , ψand ω angles are all 180o . The reslib
input determines which residue library is used; if it is an empty string, the AMBER 94 all-atom
library is used, with charged end groups at the N and C termini. All nab residue libraries are
denoted by the suffix .rlb and LEaP residue libraries are denoted by the suffix .lib. If reslib
is set to "nneut", "cneut" or "neut", then neutral groups will be used at the N-terminus, the
C-terminus, or both, respectively.
The seq string should give the amino acids using the one-letter code with upper-case let-
ters. Some non-standard names are: "H" for histidine with the proton on the δ position; "h"
for histidine with the proton at the ε position; "3" for protonated histidine; "n" for an acetyl
blocking group; "c" for an HNMe blocking group, "a" for an NH 2 group, and "w" for a water
molecule. If the sequence contains one or more "|" characters, the molecule will consist of
separate polypeptide strands broken at these positions.
The link_na() routine works much the same way for DNA and RNA, using an input residue
library to build a single-strand with correct local geometry but arbitrary torsion angles connect-
ing one residue to the next. natype is used to specify either DNA or RNA. If the opts string
contains a "5", the 5’ residue will be "capped" (a hydrogen will be attached to the O5’ atom); if
this string contains a "3" the O3’ atom will be capped.
The newer (and generally recommended) way to generate biomolecules uses the getpdb_prm()
function described in Chapter 6.

11.14 Fiber Diffraction Duplexes in NAB

The primary function in NAB for creating Watson-Crick duplexes based on fibre-diffraction
data is fd_helix:

molecule fd_helix( string helix_type, string seq, string acid_type );

fd_helix() takes as its arguments three strings - the helix type of the duplex, the sequence of one
strand of the duplex, and the acid type (which is "dna" or "rna"). Available helix types are as
follows:

244
11.15 Reduced Representation DNA Modeling Functions

Helix type options for fd_helix()


arna Right Handed A-RNA (Arnott)
aprna Right Handed A’-RNA (Arnott)
lbdna Right Handed B-DNA (Langridge)
abdna Right Handed B-DNA (Arnott)
sbdna Left Handed B-DNA (Sasisekharan)
adna Right Handed A-DNA (Arnott)

The molecule returns contains a Watson-Crick double-stranded helix, with the helix axis
along z. For a further explanation of the fd_helix code, please see the code comments in the
source file fd_helix.nab.
References for the fibre-diffraction data:

1. Structures of synthetic polynucleotides in the A-RNA and A’-RNA conformations. X-ray


diffraction analyses of the molecule conformations of (polyadenylic acid) and (polyi-
nosinic acid).(polycytidylic acid). Arnott, S.; Hukins, D.W.L.; Dover, S.D.; Fuller, W.;
Hodgson, A.R. [Link]. Biol. (1973), 81(2), 107-22.

2. Left-handed DNA helices. Arnott, S; Chandrasekaran, R; Birdsall, D.L.; Leslie, A.G.W.;


Ratliff, R.L. Nature (1980), 283(5749), 743-5.

3. Stereochemistry of nucleic acids and polynucleotides. Lakshimanarayanan, A.V.; Sasisekha-


ran, V. Biochim. Biophys. Acta 204, 49-53.

4. Fuller, W., Wilkins, M.H.F., Wilson, H.R., Hamilton, L.D. and Arnott, S. (1965). J. Mol.
Biol. 12, 60.

5. Arnott, S.; Campbell Smith, P.J.; Chandraseharan, R. in Handbook of Biochemistry and


Molecular Biology, 3rd Edition. Nucleic Acids–Volume II, Fasman, G.P., ed. (Cleveland:
CRC Press, 1976), pp. 411-422.

11.15 Reduced Representation DNA Modeling Functions


nab provides several functions for creating the reduced representation models of DNA
described by R. Tan and S. Harvey.[166] This model uses only 3 pseudo-atoms to represent a
base pair. The pseudo atom named CE represents the helix axis, the atom named SI represents
the position of the sugar-phosphate backbone on the sense strand and the atom named MA
points into the major groove. The plane described by these three atoms ( and a corresponding
virtual atom that represents the anti sugar-phosphate backbone ) represents quite nicely an all
atom watson-crick base pair plane.

molecule dna3( int nbases, float roll, float tilt, float twist, float rise );
molecule dna3_to_allatom( molecule m_dna3, string seq, string aseq, string reslib, string natype );
molecule allatom_to_dna3( molecule m_allatom, string sense, string anti );

The function dna3() creates a reduced representation DNA structure. dna3() takes as parameters
the number of bases nbases, and four helical parameters roll, tilt, twist, and rise.

245
11 NAB: Language Reference

dna3_to_allatom() makes an all-atom dna model from a dna3 molecule as input. The molecule
m_dna3 is a dna3 molecule, and the strings seq and aseq are the sense and anti sequences of the
all-atom helix to be constructed. Obviously, the number of bases in the all-atom model should
be the same as in the dna3 model. If the string aseq is left blank ( "" ), the sequence generated
is the wc_complement() of the sense sequence. reslib names the residue library from which the
all-atom model is to be constructed. If left blank, this will default to all_nucleic94.lib The last
parameter is either "dna" or "rna" and defaults to dna if left blank.
The allatom_to_dna3() function creates a dna3 model from a double stranded all-atom helix.
The function takes as parameters the input all-atom molecule m_allatom, the name of the sense
strand in the all-atom molecule, sense and the name of the anti strand, anti.

11.16 Molecule I/O Functions


nab provides several functions for reading and writing molecule and residue objects.

residue getresidue( string rname, string rlib );


molecule getpdb( string fname [, string options ] );
molecule getcif( string fname, string blockId );
int putpdb( string fname, molecule mol [, string options ] );
int putcif( string fname, molecule mol );
int putbnd( string fname, molecule mol );
int putdist( string fname, molecule mol );

The function getresidue() returns a copy of the residue with name rname from the residue
library named rlib. If it can not do so it returns the value NULL.
The function getpdb() converts the contents of the PDB file with name fname into an nab
molecule. getpdb() creates bonds between any two atoms in the same residue if their distance
is less than: 1.20 Å if either atom is a hydrogen, 2.20 Å if either atom is a sulfur, and 1.85 Å
otherwise. Atoms in different residues are never bonded by getpdb().
getpdb() creates a new strand each time the chain id changes or if the chain id remains the
same and a TER card is encountered. The strand name is the chain id if it is not blank and "N ",
where N is the number of that strand in the molecule beginning with 1. For example, a PDB
file containing chain with no chain ID, followed by chain A, followed by another blank chain
would have three strands with names "1", "A" and "3". getpdb() returns a molecule on success
and NULL on failure.
The optional final argument to getpdb can be used for a variety of purposes, which are out-
lined in the table below.
The (experimental!) function getcif is like getpdb, but reads an mmCIF (macro-molecular
crystallographic information file) formatted file, and extracts "atom-site" information from data
block blockID. You will need to compile and install the cifparse library in order to use this.
The next group of builtins write various parts of the molecule mol to the file fname. All return
0 on success and 1 on failure. If fname exists and is writable, it is overwritten without warning.
putpdb() writes the molecule mol into the PDB file fname. If the "resid" of a residue has been
set (either by using getpdb to create the molecule, or by an explicit operation in an nab routine)
then columns 22-27 of the output pdb file will use it; otherwise, nab will assign a chain-id and

246
11.17 Other Molecular Functions

residue number and use those. In this latter case, a molecule with a single strand will have a
blank chain-id; if there is more than one strand, each strand is written as a separate chain with
chain id "A" assigned to the first strand in mol, "B" to the second, etc.

Options flags for putpdb


keyword meaning
-pqr Put charges and radii into the columns following the xyz coordinates.
-nobocc Do not put occupancy and b-factor into the columns following the xyz
coordinates. This is implied if -pqr is present, but may also be used to
save space in the output file, or for compatibility with programs that do
not work well if such data is present.
-brook Convert atom and residue names to the conventions used in Brookhaven
PDB (version 2) files. This often gives greater compatibility with other
software that may expect these conventions to hold, but the conversion
may not be what is desired in many cases. Also, put the first character of
the atom name in column 78, a preliminary effort at identifying it as in
the most recent PDB format. If the -brook flag is not present, no
conversion of atom and residue names is made, and no id is in column
78.
-wwpdb Same as the -brook option, except use the “wwPDB” (aka version 3)
residue and atom naming scheme.
-nocid Do not put the chain-id (see the description of getpdb, above) in the
output (i.e. if this flag is present, the chain-id column will be blank).
This can be useful when many water molecules are present.
-allcid If set, create a chain ID for every strand in the molecule being written.
Use the strand’s name if it is an upper case letter, else use the next free
upper case letter. Use a blank if no more upper case letters are available.
Default is false.
-tr Do not start numbering residues over again when a new chain is
encountered, i.e. the residue numbers are consecutive across chains, as
required by some force-field programs like Amber.

putbnd() writes the bonds of mol into fname. Each bond is a pair of integers on a line. The
integers refer to atom records in the corresponding PDB-style file. putdist() writes the
interatomic distances between all atoms of mol a i , a j where i< j, in this seven column format.

rnum1 rname1 aname1 rnum2 rname2 aname2 distance

11.17 Other Molecular Functions


matrix superimpose( molecule mol, string aex1, molecule r_mol, string aex2 );
int rmsd( molecule mol, string aex1, molecule r_mol, string aex2, float r );
float angle( molecule mol, string aex1, string aex2, string aex3 );

247
11 NAB: Language Reference

float anglep( point pt1, point pt2, point pt3 );


float torsion( molecule mol, string aex1, string aex2, string aex3, string aex4 );
float torsionp( point pt1, point pt2, point pt3, point pt4 );
float dist( molecule mol, string aex1, string aex2 );
float distp( point pt1, point pt2 );
int countmolatoms( molecule mol, string aex );
int sugarpuckeranal( molecule mol, int strandnum, int startres, int endres );
int helixanal( molecule mol );
int plane( molecule mol, string aex, float A, float B, float C );
float molsurf( molecule mol, string aex, float probe_rad );

superimpose() transforms molecule mol so that the root mean square deviation between corre-
sponding atoms in mol and r_mol is minimized. The corresponding atoms are those selected
by the atom expressions aex1 applied to mol and aex2 applied to r_mol. The atom expressions
must select the same number of atoms in each molecule. No checking is done to insure that
the atoms selected by the two atom expressions actually correspond. superimpose() returns the
transformation matrix it found. rmsd() computes the root mean square deviation between the
pairs of corresponding atoms selected by applying aex1 to mol and aex2 to r_mol and returns
the value in r. The two atom expressions must select the same number of atoms. Again, it is
the user’s responsibility to insure the two atom expressions select corresponding atoms. rmsd()
returns 0 on success and 1 on failure.
angle() and anglep() compute the angle in degrees between three points. angle() uses atoms
expressions to determine the average coordinates of the sets. anglep() takes as an argument three
explicit points. Similarly, torsion() and torsionp() compute a torsion angle in degrees defined by
four points. torsion() uses atom expressions to specify the points. These atom expression match
sets of atoms in mol. The points are defined by the average coordinates of the sets. torsionp()
uses four explicit points. Both functions return 0 if the torsion angle is not defined.
dist() and distp() compute the distance in angstroms between two explicit atoms. dist() uses
atom expressions to determine which atoms to include in the calculation. An atom expression
which selects more than one atom results in the distance being calculated from the average
coordinate of the selected atoms. distp() returns the distance between two explicit points. The
function countmolatoms() returns the number of atoms selected by aex in mol.
sugarpuckeranal() is a function that reports the various torsion angles in a nucleic acid struc-
ture. helixanal() is an interactive helix analysis function based on the methods described by
Babcock et al..[167]
The plane() routine takes an atom expression aex and calculates the least-squares plane and
returns the answer in the form z = Ax + By + C. It returns the number of atoms used to calculate
the plane.
The molsurf() routine is an NAB adaptation of Paul Beroza’s program of the same name. It
takes coordinates and radii of atoms matching the atom expression aex in the input molecule,
and returns the molecular surface area (the area of the solvent-excluded surface), in square
angstroms. To compute the solvent-accessible area, add the probe radius to each atom’s radius
(using a for( a in m ) loop), and call molsurf with a zero value for probe_rad.

248
11.18 Debugging Functions

11.18 Debugging Functions


nab provides the following builtin functions that allow the user to write the contents of
various nab objects to an ASCII file. The file must be opened for writing before any of these
functions are called.
int dumpmatrix( file, matrix mat );
int dumpbounds( file f, bounds b, int binary );
float dumpboundsviolations( file f, bounds b, int cutoff );
int dumpmolecule( file f, molecule mol, int dres, int datom, int dbond );
int dumpresidue( file f, residue res, int datom, int dbond );
int dumpatom( file f, residue res, int anum, int dbond );
int assert( condition );
int debug( expression(s) );
dumpmatrix() writes the 16 float values of mat to the file f. The matrix is written as four rows
of four numbers. dumpbounds() writes the distance bounds information contained in b to the
file f using this eight column format:
atom-number1 atom-number2 lower upper
If binary is set to a non-zero value, equivalent information is written in binary format, which
can save disk-space, and is much faster to read back in on subsequent runs.
dumpboundsviolations() writes all the bounds violations in the bounds object that are more
than cutoff, and returns the bounds violation energy. dumpmolecule() writes the contents of mol
to the file f. If dres is 1, then detailed residue information will also be written. If datom or
dbond is 1, then detailed atom and/or bond information will be written. dumpresidue() writes
the contents of residue res to the file f. Again if datom or dbond is 1, detailed information about
that residue’s atoms and bonds will be written. Finally dumpatom() writes the contents of the
atom anum of residue res to the file f. If dbond is 1, bonding information about that atom is also
written.
The assert() statement will evaluate the condition expression, and terminate (with an error
message) if the expression is not true. Unlike the corresponding "C" language construct
(which is a macro), code is generated at compile time to indicate both the file and line number
where the assertion failed, and to parse the condition expression and print the values of
subexpressions inside it. Hence, for a code fragment like:
i=20; MAX=17;
assert( i < MAX );
the error message will provide the assertion that failed, its location in the code, and the current
values of "i" and "MAX". If the -noassert flag is set at compile time, assert statements in the
code are ignored.
The debug() statement will evaluate and print a comma-separated expression list along with
the source file(s) and line number(s). Continuing the above example, the statement
debug( i, MAX );
would print the values of "i" and "MAX" to stdout, and continue execution. If the -nodebug flag
is set at compile time, debug statements in the code are ignored.

249
11 NAB: Language Reference

11.19 Time and date routines


NAB incorporates a few interfaces to time and date routines:
string date();
string timeofday();
string ftime( string fmt );
float second();

The date() routine returns a string in the format "03/08/1999", and the timeofday() routine re-
turns the current time as "13:45:00". If you need access to more sophisticated time and date
functions, the ftime() routine is just a wrapper for the standard C routine strftime, where the
format string is used to determine what is output; see standard C documentation for how this
works.
The second() routine returns the number of seconds of CPU utilization since the beginning
of the process. It is really just a wrapper for the C function clock()/CLOCKS_PER_SEC, and
so the meaning and precision of the output will depend upon the implementation of the
underlying C compiler and libraries. Generally speaking, you should be able to time a certain
section of code in the following manner:
t1 = second();
..... // code to be timed
t2 = second();
elapsed = t2 - t1

250
12 NAB: Rigid-Body Transformations
This chapter describes NAB functions to create and manipulate molecules through a variety
of rigid-body transformations. This capability, when combined with distance geometry (de-
scribed in the next chapter) offers a powerful approach to many problems in initial structure
generation.

12.1 Transformation Matrix Functions


nab uses 4×4 matrices to hold coordinate transformations. nab provides these functions to
create transformation matrices.
matrix newtransform( float dx, float dy, float dz, float rx, float ry, float rz );
matrix rot4( molecule mol, string aex1, string aex2, float ang );
matrix rot4p( point p1, point p2, float angle );

newtransform() creates a 4×4 matrix that will rotate an object by rz degrees about the Z axis,
ry degrees about the Y axis, rx degrees about the X axis and then translate the rotated object
by dx, dy, dz along the X, Y and Z axes. All rotations and transformations are with respect the
standard X, Y and Z axes centered at (0,0,0). rot4() and rot4p() create transformation matrices
that rotate an object about an arbitrary axis. The rotation amount is in degrees. rot4() uses two
atom expressions to define an axis that goes from aex1 to aex2. If an atom expression matches
more that one atom in mol, the average of the coordinates of the matched atoms are used. If
an atom expression matches no atoms in mol, the zero matrix is returned. rot4p() uses explicit
points instead of atom expressions to specify the axis. If p1 and p2 are the same, the zero matrix
is returned.

12.2 Frame Functions


Every nab molecule has a “frame” which is three orthonormal vectors and their origin. The
frame acts like a handle attached to the molecule allowing control over its movement. Two
frames attached to different molecules allow for precise positioning of one molecule with
respect to the other. These functions are used in frame creation and manipulation. All return 0
on success and 1 on failure.
int setframe( int use, molecule mol, string org, string xtail, string xhead,
string ytail, string yhead );
int setframep( int use, molecule mol, point org, point xtail, point xhead,
point ytail, point yhead );
int alignframe( molecule mol, molecule r_mol );

251
12 NAB: Rigid-Body Transformations

setframe() and setframep() create coordinate frames for molecule mol from an origin and two
independent vectors. In setframe(), the origin and two vectors are specified by atom expressions.
These atom expressions match sets of atoms in mol. The average coordinates of the selected
sets are used to define the origin (org), an X-axis (xtail to xhead) and a Y-axis (ytail to yhead).
The Z-axis is created as X×Y. Since it is unlikely that the original X and Y axes are orthogonal,
the parameter use specifies which of them is to be a real axis. If use == 1, then the specified
X-axis is the real X-axis and Y is recreated from Z×X. If use == 2, then the specified Y-axis is
the real Y-axis and X is recreated from Y×Z. setframep() works exactly the same way except
the vectors and origin are specified as explicit points.
alignframe() transforms mol to superimpose its frame on the frame of r_mol. If r_mol is NULL,
alignframe() transforms mol to superimpose its frame on the standard X,Y,Z directions centered
at (0,0,0).

12.3 Functions for working with Atomic Coordinates


nab provides several functions for getting and setting user defined sets of molecular
coordinates.

int setpoint( molecule mol, string aex, point pt );


int setxyz_from_mol( molecule mol, string aex, point pts[] );
int setxyzw_from_mol( molecule mol, string aex, float xyzw[] );
int setmol_from_xyz( molecule mol, string aex, point pts[] );
int setmol_from_xyzw( molecule mol, string aex, float xyzw[] );
int transformmol( matrix mat, molecule mol, string aex );
residue transformres( matrix mat, residue res, string aex );

setpoint() sets pt to the average value of the coordinates of all atoms selected by the atom ex-
pression aex. If no atoms were selected it returns 1, otherwise it returns a 0. setxyz_from_mol()
copies the coordinates of all atoms selected by the atom expression aex to the point array pt.
It returns the number of atoms selected. setmol_from_xyz() replaces the coordinates of the se-
lected atoms from the values in pt. It returns the number of replaced coordinates. The routines
setxyzw_from_mol and setmol_from_xyzw work in the same way, except that they use four-
dimensional coordinates rather than three-dimensional sets.
transformmol() applies the transformation matrix mat to those atoms of mol that were selected
by the atom expression aex. It returns the number of atoms selected. transformres() applies the
transformation matrix mat to those atoms of res that were selected by the atom expression aex
and returns a transformed copy of the input residue. It returns NULL if the operation failed.

12.4 Symmetry Functions


Here we describe a set of NAB routines that provide an interface for rigid-body transforma-
tions based on crystallographic, point-group, or other symmetries. These are primarily higher-
level ways to creating and manipulating sets of transformation matrices corresponding to com-
mon types of symmetry operations.

252
12.4 Symmetry Functions

12.4.1 Matrix Creation Functions


int MAT_cube( point pts[3], matrix mats[24] )
int MAT_ico( point pts[3], matrix mats[60] )
int MAT_octa( point pts[3], matrix mats[24] )
int MAT_tetra( point pts[3], matrix mats[12] )
int MAT_dihedral( point pts[3], int nfold, matrix mats[1] )
int MAT_cyclic( point pts[2], float ang, int cnt, matrix mats[1] )
int MAT_helix( point pts[2], float ang, float dst, int cnt, matrix mats[1] )
int MAT_orient( point pts[4], float angs[3], matrix mats[1] )
int MAT_rotate( point pts[2], float ang, matrix mats[1] )
int MAT_translate( point pts[2], float dst, matrix mats[1] )

These two groups of functions produce arrays of matrices that can be applied to objects to
generate point group symmetries (first group) or useful transformations (second group). The
operations are defined with respect to a center and a set of axes specified by the points in
the array pts[]. Every function requires a center and one axis which are pts[1] and the vector
pts[1]→pts[2]. The other two points (if required) define two additional directions: pts[1]→pts[3]
and pts[1]→pts[4]. How these directions are used depends on the function.
The point groups generated by the functions MAT_cube(), MAT_ico(), MAT_octa() and MAT_tetra()
have three internal 2-fold axes. While these 2-fold are orthogonal, the 2 directions specified by
the three points in pts[] need only be independent (not parallel). The 2-fold axes are con-
structed in this fashion. Axis-1 is along the direction pts[1]→pts[2]. Axis-3 is along the vector
pts[1]→pts[2] × pts[1]→pts[3] and axis-2 is recreated along the vector axis-3 × axis-1. Each of
these four functions creates a fixed number of matrices.
Dihedral symmetry is generated by an N-fold rotation about an axis followed by a 2-fold
rotation about a second axis orthogonal to the first axis. MAT_dihedral() produces matrices that
generate this symmetry. The N-fold axis is pts[0]→pts[1] and the second axis is created by the
same orthogonalization process described above. Unlike the previous point group functions the
number of matrices created by MAT_dihedral() is not fixed but is equal to 2 × n f old.
MAT_cyclic() creates cnt matrices that produce uniform rotations about the axis pts[1]→pts[2].
The rotations are in multiples of the angle ang beginning with o, and increasing by ang until
cnt matrices have been created. cnt is required to be > 0, but ang can be 0, in which case
MAT_cyclic returns cnt copies of the identity matrix.
MAT_helix() creates cnt matrices that produce a uniform helical twist about the axis pts[1]→pts[2].
The rotations are in multiples of ang and the translations in multiples of dst. cnt must be > 0,
but either ang or dst or both may be zero. If ang is not 0, but dst is, MAT_helix() produces a
uniform plane rotation and is equivalent to MAT_cyclic(). An ang of 0 and a non-zero dst pro-
duces matrices that generate a uniform translation along the axis. If both ang and dst are 0, the
MAT_helix() creates cnt copies of the identity matrix.
The three functions MAT_orient(), MAT_rotate() and MAT_translate() are not really symmetry
operations but are auxiliary operations that are useful for positioning the objects which are
to be operated on by the true symmetry operators. Two of these functions MAT_rotate() and
MAT_translate() produce a single matrix that either rotates or translates an object along the
axis pts[1]→pts[2]. A zero ang or dst is acceptable in which case the function creates an identity

253
12 NAB: Rigid-Body Transformations

matrix. Except for a different user interface these two functions are equivalent to the nab builtins
rot4p() and tran4p().
MAT_orient() creates a matrix that rotates a object about the three axes pts[1]→pts[2], pts[1]→pts[3]
and pts[1]→pts[4]. The rotations are specified by the values of the array angs[], with ang[1] the
rotation about axis-1 etc. The rotations are applied in the order axis-3, axis-2, axis-1. The axes
remained fixed throughout the operation and zero angle values are acceptable. If all three angles
are zero, MAT_orient() creates an identity matrix.

12.4.2 Matrix I/O Functions


int MAT_fprint( file f, int nmats, matrix mats[1] )
int MAT_sprint( string str, int nmats, matrix mats[1] )
int MAT_fscan( file f, int smats, matrix mats[1] )
int MAT_sscan( string str, int smats, matrix mats[1] )
string MAT_getsyminfo()

This group of functions is used to read and write nab matrix variables. The two functions
MAT_fprint() and MAT_sprint() write the the matrix to the file f or the string str. The number of
matrices is specified by the parameter nmats and the matrices are passed in the array mats[].
The two functions MAT_fscan() and MAT_sscan() read matrices from the file f or the string str
into the array mats[]. The parameter smats is the size of the matrix array and if the source file
or string contains more than smats only the first smats will be returned. These two functions
return the number of matrices read unless there the number of matrices is greater than smat or
the last matrix was incomplete in which case they return -1.
In order to understand the last function in this group, MAT_getsyminfo(), it is necessary to
discuss both the internal structure the nab matrix type and one of its most important uses. The
nab matrix type is used to hold transformation matrices. Although these are atomic objects at
the nab level, they are actually 4 × 4 matrices where the first three elements of the fourth row
are the X Y and Z components of the translation part of the transformation. The matrix print
functions write each matrix as four lines of four numbers separated by a single space. Similarly
the matrix read functions expect each matrix to be represented as four lines of four white space
(any number of tabs and spaces) separated numbers. The print functions use %13.6e for each
number in order to produce output with aligned columns, but the scan functions only require
that each matrix be contained in four lines of four numbers each.
Most nab programs use matrix variables as intermediates in creating structures. The structures
are then saved and the matrices disappear when the program exits. Recently nab was used to
create a set of routines called a “symmetry server”. This is a set of nab programs that work
together to create matrix streams that are used to assemble composite objects. In order to make
it most general, the symmetry server produces only matrices leaving it to the user to apply them.
Since these programs will be used to create hierarchies of symmetries or transformations we
decided that the external representation (files or strings) of matrices would consist of two kinds
of information — required lines of row values and optional lines beginning with the character #
some of which are used to contain information that describes how these matrices were created.
MAT_getsyminfo() is used to extract this symmetry information from either a matrix file
or a string that holds the contents of a matrix file. Each time the user calls MAT_fscan() or

254
12.5 Symmetry server programs

MAT_sscan(), any symmetry information present in the source file or string is saved in private
buffer. The previous contents of this buffer are overwritten and lost. MAT_getsyminfo() returns
the contents of this buffer. If the buffer is empty, indicating no symmetry information was
present in either the source file or string, MAT_getsyminfo() returns NULL.

12.5 Symmetry server programs


This section describes a set of nab programs that are used together to create composite objects
described by a hierarchical nest of transformations. There are four programs for creating and
operating on transformation matrices: matgen, matmerge, matmul and matextract, a program,
transform, for transforming PDB or point files, and two programs, tss_init and tss_next for
searching spaces defined by transformation hierarchies. In addition to these programs, all of
this functionality is available directly at the nab level via the MAT_ and tss_ builtins described
above.

12.5.1 matgen
The program matgen creates matrices that correspond to a symmetry or transformation
operation. It has one required argument, the name of a file containing a description of this
operation. The created matrices are written to stdout. A single matgen may be used by itself or
two or more matgen programs may be connected in a pipeline producing nested symmetries.

matgen -create sydef-1 | matgen symdef-2 | ... | matgen symdef-N

Because a matgen can be in the middle of a pipeline, it automatically looks for an stream of
matrices on stdin. This means the first matgen in a pipeline will wait for an EOF (generally
Ctl-D) from the terminal unless connected to an empty file or equivalent. In order to avoid the
nuisance of having to create an empty matrix stream the first matgen in a pipeline should use
the -create flag which tells matgen to ignore stdin.
If input matrices are read, each input matrix left multiplies the first generated matrix, then
the second etc. The table below shows the effect of a matgen performing a 2-fold rotation on
an input stream of three matrices.

Input: IM1, IM2 , IM3


Operation: 2-fold rotation: R1 , R2
Output: IM1 × R1 , IM2 × R1 , IM3 × R1 , IM1 × R2 , IM2 × R2 , IM3 × R2

12.5.2 Symmetry Definition Files


Transformations are specified in text files containing several lines of keyword/value pairs.
These lines define the operation, its associated axes and other parameters such as angles, a
distance or count. Most keywords have a default value, although the operation, center and axes
are always required. Keyword lines may be in any order. Blank lines and most lines starting
with a sharp (#) are ignored. Lines beginning with #S{, #S+ and #S} are structure comments that
describe how the matrices were created. These lines are required to search the space defined by

255
12 NAB: Rigid-Body Transformations

the transformation hierarchy and their meaning and use is covered in the section on “Searching
Transformation Spaces”. A complete list of keywords, their acceptable values and defaults is
shown below.
Keyword Default Value Possible Values
symmetry None cube, cyclic, dihedral, dodeca, helix, ico, octa, tetra.
transform None orient, rotate, translate.
name mPid Any string of nonblank characters.
noid false true, false.
axestype relative absolute, relative.
center None Any three numbers separated by tabs or spaces.
axis, axis1 None
axis2 None
axis3 None
angle,angle1 0 Any number.
angle2 0
angle3 0
dist 0
count 1 Any integer.
axis and axis1 are synonyms as are angle and angle1.
The symmetry and transform keywords specify the operation. One or the other but not both
must be specified.
The name keyword names a particular symmetry operation. The default name is m immedi-
ately followed by the process ID, eg m2286. name is used by the transformation space search
routines tss_init and tss_next and is described later in the section “Searching Transformation
Spaces”.
The noid keyword with value true suppresses generation of the identity matrix in symmetry
operations. For example, the keywords below
symmetry cyclic
noid false
center 0 0 0
axis 0 0 1
count 3

produce three matrices which perform rotations of 0o, 120o and 240o about the Z-axis. If noid
is true, only the two non-identity matrices are created. This option is useful in building objects
with two or three orthogonal 2-fold axes and is discussed further in the example “Icosahedron
from Rotations”. The default value of noid is false.
The axestype, center and axis* keywords defined the symmetry axes. The center and axis*
keywords each require a point value which is three numbers separated by tabs or spaces. Num-
bers may integer or real and in fixed or exponential format. Internally all numbers are converted
to nab type float which is actually double precision. No space is permitted between the minus
sign of a negative number and the digits.
The interpretation of these points depends on the value of the keyword axestype. If it is ab-
solute then the axes are defined as the vectors center→axis1, center→axis2 and center→axis3.

256
12.5 Symmetry server programs

If it relative, then the axes are vectors whose directions are O→axis1, O→axis2 and O→axis3
with their origins at center. If the value of center is 0,0,0, then absolute and relative are equiv-
alent. The default value axestype is relative; center and the axis* do not have defaults.
The angle keywords specify the rotation about the axes. angle1 is associated with axis1 etc.
Note that angle and angle1 are synonyms. The angle is in degrees, with positive being in the
counterclockwise direction as you sight from the axis point to the center point. Either an integer
or real value is acceptable. No space is permitted between the minus sign of a negative number
and its digits. All angle* keywords have a default value of 0.
The dist keyword specifies the translation along an axis. The positive direction is from center
to axis. Either integer or real value is acceptable. No space is permitted between the minus sign
of a negative number and its digits. The default value of dist is 0.
The count keyword is used in three related ways. For the cyclic value of the symmetry it
specifies ount matrices, each representing a rotation of 360/count. It also specifies the same
rotations about the non 2-fold axis of dihedral symmetry. For helix symmetry, it indicates that
count matrices should be created, each with a rotation of angle. In all cases the default value is
1.
This table shows which keywords are used and/or required for each type of operation.

symmetry name noid axestype center axes angles dist count


cube mPid false relative Required 1,2 - - -
cyclic mPid false relative Required 1 - - D=1
dihedral mPid false relative Required 1,2 - - D=1
dodeca mPid false relative Required 1,2 - - -
helix mPid false relative Required 1 1,D=0 D=0 D=1
ico mPid false relative Required 1,2 - - -
octa mPid false relative Required 1,2 - - -
tetra mPid false relative Required 1,2 - - -
transform name noid axestype center axes angles dist count
orient mPid - relative Required All All,D=0 - -
rotate mPid - relative Required 1 1,D=0 - -
translate mPid - relative Required 1 - D=0 -

12.5.3 matmerge
The matmerge program combines 2-4 files of matrices into a single stream of matrices
written to stdout. Input matrices are in files whose names are given on as arguments on the
matmerge command line. For example, the command line below

matmerge [Link] [Link] [Link]

copies the matrices from [Link] to stdout, followed by those of [Link] and finally those of [Link].
Thus matmerge is similar to the Unix cat command. The difference is that while they are called
matrix files, they can contain special comments that describe how the matrices they contain
were created. When matrix files are merged, these comments must be collected and grouped so
that they are kept together in any further matrix processing.

257
12 NAB: Rigid-Body Transformations

12.5.4 matmul
The matmul program takes two files of matrices, and creates a new stream of matrices formed
by the pair wise product of the matrices in the input streams. The new matrices are written to
stdout. If the number of matrices in the two input files differ, the last matrix of the shorter file is
replicated and applied to all remaining matrices of the longer file. For example, if the file [Link]
has three matrices and the file [Link] has five, then the command “matmul [Link] [Link]” would
result in the third matrix of [Link] multiplying the third, forth and fifth matrices of [Link].

12.5.5 matextract
The matextract is used to extract matrices from the matrix stream presented on stdin and
writes them to stdout. Matrices are numbered from 1 to N, where N is the number of matrices
in the input stream. The matrices are selected by giving their numbers as the arguments to the
matextract command. Each argument is comma or space separated list of one or more ranges,
where a range is either a number or two numbers separated by a dash (-). A range beginning
with - starts with the first matrix and a range ending with - ends with the last matrix. The range
- selects all matrices. Here are some examples.

Command Action
matextract 2 Extract matrix number 2.
matextract 2,5 Extract matrices number 2 and 5.
matextract 2 5 Extract matrices number 2 and 5.
matextract 2-5 Extract matrices number 2 up to and including 5.
matextract -5 Extract matrices 1 to 5.
matextract 2- Extract all matrices beginning with number 2.
matextract - Extract all matrices.
matextract 2-4,7 13 15,19- Extract matrices 2 to 4, 7, 13, 15 and all matrices numbered 19
or higher.

12.5.6 transform
The transform program applies matrices to an object creating a composite object. The matri-
ces are read from stdin and the new object is written to stdout. transform takes one argument,
the name of the file holding the object to be transformed. transform is limited to two types of
objects, a molecule in PDB format, or a set of points in a text file, three space/tab separated
numbers/line. The name of object file is preceded by a flag specifying its type.

Command Action
transform -pdb [Link] Transform a PDB format file.
transform -point [Link] Transform a set of points.

258
13 NAB: Distance Geometry
The second main element in NAB for the generation of initial structures is distance geometry.
The next subsection gives a brief overview of the basic theory, and is followed by sections giving
details about the implementation in NAB.

13.1 Metric Matrix Distance Geometry


A popular method for constructing initial structures that satisfy distance constraints is based
on a metric matrix or "distance geometry" approach.[156, 168] If we consider describing a
macromolecule in terms of the distances between atoms, it is clear that there are many con-
straints that these distances must satisfy, since for N atoms there are N(N − 1)/2distances but
only 3N coordinates. General considerations for the conditions required to "embed" a set of
interatomic distances into a realizable three-dimensional object forms the subject of distance
geometry. The basic approach starts from the metric matrix that contains the scalar products of
the vectors xi that give the positions of the atoms:

gi j ≡ xi · x j (13.1)

These matrix elements can be expressed in terms of the distances di j :


2
gi j = 2(di0 + d 2j0 − di2j ) (13.2)

If the origin ("0") is chosen at the centroid of the atoms, then it can be shown that distances
from this point can be computed from the interatomic distances alone. A fundamental theorem
of distance geometry states that a set of distances can correspond to a three-dimensional object
only if the metric matrix g is rank three, i.e. if it has three positive and N-3 zero eigenvalues.
This is not a trivial theorem, but it may be made plausible by thinking of the eigenanalysis
as a principal component analysis: all of the distance properties of the molecule should be
describable in terms of three "components," which would be the x, y and z coordinates. If we
denote the eigenvector matrix as w and the eigenvalues λ , the metric matrix can be written in
two ways:
3 3
gi j = ∑ xik x jk = ∑ wik w jk λk (13.3)
k=1 k=1
The first equality follows from the definition of the metric tensor, Eq. (1); the upper limit
of three in the second summation reflects the fact that a rank three matrix has only three non-
zero eigenvalues. Eq. (3) then provides an expression for the coordinates xi in terms of the
eigenvalues and eigenvectors of the metric matrix:
1/2
xik = λk wik (13.4)

259
13 NAB: Distance Geometry

If the input distances are not exact, then in general the metric matrix will have more than
three non-zero eigenvalues, but an approximate scheme can be made by using Eq. (4) with the
three largest eigenvalues. Since information is lost by discarding the remaining eigenvectors,
the resulting distances will not agree with the input distances, but will approximate them in a
certain optimal fashion. A further "refinement" of these structures in three-dimensional space
can then be used to improve agreement with the input distances.
In practice, even approximate distances are not known for most atom pairs; rather, one can set
upper and lower bounds on acceptable distances, based on the covalent structure of the protein
and on the observed NOE cross peaks. Then particular instances can be generated by choosing
(often randomly) distances between the upper and lower bounds, and embedding the resulting
metric matrix.
Considerable attention has been paid recently to improving the performance of distance ge-
ometry by examining the ways in which the bounds are "smoothed" and by which distances
are selected between the bounds.[169, 170] The use of triangle bound inequalities to improve
consistency among the bounds has been used for many years, and NAB implements the "ran-
dom pairwise metrization" algorithm developed by Jay Ponder.[158] Methods like these are
important especially for underconstrained problems, where a goal is to generate a reasonably
random distribution of acceptable structures, and the difference between individual members of
the ensemble may be quite large.
An alternative procedure, which we call "random embedding", implements the procedure of
deGroot et al. for satisfying distance constraints.[171] This does not use the embedding idea
discussed above, but rather randomly corrects individual distances, ignoring all couplings be-
tween distances. Doing this a great many times turns out to actually find fairly good structures
in many cases, although the properties of the ensembles generated for underconstrained prob-
lems are not well understood. A similar idea has been developed by Agrafiotis,[172] and we
have adopted a version of his "learning parameter" strategy into our implementation.
Although results undoubtedly depend upon the nature of the problem and the constraints,
in many (most?) cases, randomized embedding will be both faster and better than the metric
matrix strategy. Given its speed, randomized embedding should generally be tried first.

13.2 Creating and manipulating bounds, embedding


structures
A variety of metric-matrix distance geometry routines are included as builtins in nab.

bounds newbounds( molecule mol, string opts );


int and-
bounds( bounds b, molecule mol, string aex1, string aex2, float lb, float ub );
int or-
bounds( bounds b, molecule mol, string aex1, string aex2, float lb, float ub );
int set-
bounds( bounds b, molecule mol, string aex1, string aex2, float lb, float ub );
int showbounds( bounds b, molecule mol, string aex1, string aex2 );
int useboundsfrom( bounds b, molecule mol1, string aex1, molecule mol2,

260
13.2 Creating and manipulating bounds, embedding structures

Option type Default Action


-rbm string None The value of the option is the name of a file containing the
bounds matrix for this molecule. This file would ordinarily be
made by the dump-bounds command.
-binary If this flag is present, bounds read in with the -rbm will expect
a binary file created by the dumpbounds command.
-nocov If this flag is present, no covalent (bonding) information will
be used in constructing the bounds matrix.
-nchi int 4 The option containing the keyword nchi allocates n extra chiral
atoms for each residue of this molecule. This allows for
additional chirality information to be provided by the user. The
default is 4 extra chiral atoms per residue.

Table 13.1: Options to newbounds.

string aex2, float deviation );


int setboundsfromdb( bounds b, molecule mol, string aex1, string aex2,
string dbase, float mul );
int setchivol( bounds b, molecule mol, string aex1, string aex2, string aex3, string aex4, float vol );
int setchiplane( bounds b, molecule mol, string aex );
float getchivol( molecule mol, string aex1, string aex2, string aex3, string aex4 );
float getchivolp( point p1, point p2, point p3, point p4 );
int tsmooth( bounds b, float delta );
int geodesics( bounds b );
int dg_options( bounds b, string opts );
int embed( bounds b, float xyz[] );

The call to newbounds() is necessary to establish a bounds matrix for further work. This
routine sets lower bounds to van der Waals limits, along with bounds derived from the input
geometry for atoms bonded to each other, and for atoms bonded to a common atoms (i.e.
so-called 1-2 and 1-3 interactions.) Upper and lower bounds for 1-4 interactions are set to the
maximum and minimum possibilities (the max ( syn , "Van der Waals limits" ) and anti
distances). newbounds() has a string as its last parameter. This string is used to pass in options
that control the details of how those routines execute. The string can be NULL, "" or contain
one or more options surrounded by white space. The formats of an option are
-name=value
-name to select the default value if it exists.

The options to newbounds() are listed in Table 13.1.


The next five routines use atom expressions aex1 and aex2 to select two sets of atoms. Each
of these four routines returns the number of bounds set or changed. For each pair of atoms (a1
in aex1 and a2 in aex2) andbounds() sets the lower bound to max ( current_lb, lb ) and the
upper bound to the min ( current_ub, ub ). If ub < current_lb or if lb > current_ub, the
bounds for that pair are unchanged. The routine orbounds() works in a similar fashion, except
that it uses the less restrictive of the two sets of bounds, rather than the more restrictive one.

261
13 NAB: Distance Geometry

The setbounds() call updates the bounds, overwriting whatever was there. showbounds() prints
all the bounds between the atoms selected in the first atom expression and those selected in the
second atom expression. The useboundsfrom() routine sets the the bounds between all the
selected atoms in mol1 according to the geometry of a reference molecule, mol2. The bounds
are set between every pair of atoms selected in the first atom expression, aex1 to the distance
between the corresponding pair of atoms selected by aex2 in the reference molecule. In
addition, a slack term, deviation, is used to allow some variance from the reference geometry
by decreasing the lower bound and increasing the upper bound between every pair of atoms
selected. The amount of increase or decrease depends on the distance between the two atoms.
Thus, a deviation of 0.25 will result in the lower bound set between two atoms to be 75% of
the actual distance separating the corresponding two atoms selected in the reference molecule.
Similarly, the upper bound between two atoms will be set to 125% of the actual distance
separating the corresponding two atoms selected in the reference molecule. For instance, the
call

useboundsfrom(b, mol1, "1:2:C1’,N1", mref, "3:4:C1’,N1", 0.10 );

sets the lower bound between the C1’ and N1 atoms in strand 1, residue 2 of molecule mol1 to
90% of the distance between the corresponding pair of atoms in strand 3, residue 4 of the
reference molecule, mref. Similarly, the upper bound between the C1’ and N1 atoms selected
in mol1 is set to 110% of the distance between the corresponding pair of atoms in mref. A
deviation of 0.0 sets the upper and lower bounds between every pair of atoms selected to be
the actual distance between the corresponding reference atoms. If aex1 selects the same atoms
as aex2, the bounds between those atoms selected will be constrained to the current geometry.
Thus the call,

useboundsfrom(b, mol1, "1:1:", mol1, "1:1", 0.0 );

essentially constrains the current geometry of all the atoms in strand 1, residue 1, by setting
the upper and lower bounds to the actual distances separating each atom pair. useboundsfrom()
only checks the number of atoms selected by aex1 and compares it to the number of atoms
selected by aex2. If the number of atoms selected by both atom expressions are not equal, an
error message is output. Note, however, that there is no checking on the atom types selected
by either atom expression. Hence, it is important to understand the method in which nab atom
expressions are evaluated. For more information, refer to Section 2.6, “Atom Names and Atom
Expressions”.
The useboundsfrom() function can also be used with distance geometry "templates", as dis-
cussed in the next subsection.
The routine setchivol() uses four atom expressions to select exactly four different atoms and
sets the volume of the chiral (ordered) tetrahedron they describe to vol. Setting vol to 0 forces
the four atoms to be planar. setchivol() returns 0 on success and 1 on failure. setchivol() does
not affect any distance bounds in b and may precede or follow triangle smoothing.
Similar to setchivol(), setchiplane() enforces planarity across four or more atoms by setting
the chiral volume to 0 for every quartet of atoms selected by aex. setchiplane() returns the
number of quartets constrained. Note: If the number of chiral constraints set is larger than the
default number of chiral objects allocated in the call to newbounds(), a chiral table overflow will

262
13.2 Creating and manipulating bounds, embedding structures

result. Thus, it may be necessary to allocate space for additional chiral objects by specifying a
larger number for the option nchi in the call to newbounds().
getchivol() takes as an argument four atom expressions and returns the chiral volume of
the tetrahedron described by those atoms. If more than one atom is selected for a particular
point, the atomic coordinate is calculated from the average of the atoms selected. Similarly,
getchivolp() takes as an argument four parameters of type point and returns the chiral volume of
the tetrahedron described by those points.
After bounds and chirality have been set in this way, the general approach would be to call
tsmooth() to carry out triangle inequality smoothing, followed by embed() to create a three-
dimensional object. This might then be refined against the distance bounds by a conjugate-
gradient minimization routine. The tsmooth() routine takes two arguments: a bounds object,
and a tolerance parameter delta, which is the amount by which an upper bound may exceed a
lower bound without triggering a triangle error. For most circumstances, delta would be chosen
as a small number, like 0.0005, to allow for modest round-off. In some circumstances, however,
delta could be larger, to allow some significant inconsistencies in the bounds (in the hopes that
the problems would be fixed in subsequent refinement steps.) If the tsmooth() routine detects
a violation, it will (arbitrarily) adjust the upper bound to equal the lower bound. Ideally, one
should fix the bounds inconsistencies before proceeding, but in some cases this fix will allow
the refinements to proceed even when the underlying cause of the inconsistency is not corrected.
For larger systems, the tsmooth() routine becomes quite time-consuming as it scales O(ˆ3). In
this case, a more efficient triangle smoothing routine, geodesics() is used. geodesics() smoothes
the bounds matrix via the triangle inequality using a sparse matrix version of a shortest path
algorithm.
The embed routine takes a bounds object as input, and returns a four-dimensional array of co-
ordinates; (values of the 4-th coordinate may be nearly zero, depending on the value of k4d, see
below.) Options for how the embed is done are passed in through the dg_options routine, whose
option string has name=value pairs, separated by commas or whitespace. Allowed options are
listed in the following table.

keyword default meaning


ddm none Dump distance matrix to this file.
rdm none Instead of creating a distance matrix, read it from this file.
dmm none Dump the metric matrix to this file.
rmm none Instead of creating a metric matrix, read it from this file.
gdist 0 If set to non-zero value, use a Gaussian distribution for
selecting distances; this will have a mean at the center of the
allowed range, and a standard deviation equal to 1/4 of the
range. If gdist=0, select distances from a uniform distribution
in the allowed range.
randpair 0 Use random pair-wise metrization for this percentage of the
distances, i.e., randpair=10. would metrize 10% of the distance
pairs.
eamax 10 Maximum number of embed attempts before bailing out.
seed -1 Initial seed for the random number generator.

263
13 NAB: Distance Geometry

keyword default meaning


pembed 0 If set to a non-zero value, use the "proximity embedding"
scheme of de Groot et al., [26] and Agrafiotis [27], rather than
metric matrix embedding.
shuffle 1 Set to 1 to randomize coordinates inside a box of dimension
rbox at the beginning of the pembed scheme; if 0, use whatever
coordinates are fed to the routine.
rbox 20.0 Size, in angstroms, of each side of the cubic into which the
coordinates are randomly created in the proximity-embed
procedure, if shuffle is set.
riter 1000 Maximum number of cycles for random-embed procedure.
Each cycle selects 1000 pairs for adjustment.
slearn 1.0 Starting value for the learning parameter in proximity
embedding; see [27] for details.
kchi 1.0 Force constant for enforcement of chirality constraints.
k4d 1.0 Force constant for squeezing out the fourth dimensional
coordinate. If this is non-zero, a penalty function will be added
to the bounds-violation energy, which is equal to 0.5 * k4d * w
* w, where w is the value of the fourth dimensional coordinate.
sqviol 0 If set to non-zero value, use parabolas for the violation energy
when upper or lower bounds are violated; otherwise use
functions based on those in the dgeom program. See the code
in embed.c for details.
lbpen 3.5 Weighting factor for lower-bounds violations, relative to
upper-bounds violations. The default penalizes lower bounds
3.5 times as much as the equivalent upper-bounds violations,
which is frequently appropriate distance geometry calculations
on molecules.
ntpr 10 Frequency at which the bounds matrix violations will be
printed in subsequent refinements.
pencut -1.0 If pencut >= 0.0, individual distance and chirality violations
greater than pencut will be printed out (along with the total
energy) every ntpr steps.

Typical calling sequences. The following segment shows some ways in which these routines
can be put together to do some simple embeds:
 
1 molecule m;
2 bounds b;
3 float fret, xyz[ 10000 ];
4 int ier;
5

6 m = getpdb( argv[2] );
7 b = newbounds( m, "" );

264
13.3 Distance geometry templates

8 tsmooth( b, 0.0005 );
9

10 dg_options( b, "gdist=1, ntpr=50, k4d=2.0, randpair=10." );


11 embed( b, xyz );
12 ier = conjgrad( xyz, 4*[Link], fret, db_viol, 0.1, 10., 200 );
13 printf( "conjgrad returns %d\\n", ier );
14

15 setmol_from_xyzw( m, NULL, xyz );


16 putpdb( "[Link]", m );
 
In lines 6-8, the molecule is created by reading in a pdb file, then bounds are created and
smoothed for it. The embed options (established in line 10) include 10% random pairwise
metrization, use of Gaussian distance selection, squeezing out the 4-th dimension with a force
constant of 2.0, and printing every 50 steps. The coordinates developed in the embed step (line
11) are passed to a conjugate gradient minimizer (see the description below), which will min-
imize for 200 steps, using the bounds-violation routine db_viol as the target function. Finally,
in lines 15-16, the setmol_from_xyzw routine is used to put the coordinates from the xyz array
back into the molecule, and a new pdb file is written.
More complex and representative examples of distance geometry are given in the Examples
chapter below.

13.3 Distance geometry templates


The useboundsfrom() function can be used with structures supplied by the user, or by canon-
ical structures supplied with the nab distribution called "templates". These templates include
stacking schemes for all standard residues in a A-DNA, B-DNA, C-DNA, D-DNA, T-DNA,
Z-DNA, A-RNA, or A’-RNA stack. Also included are the 28 possible basepairing schemes as
described in Saenger.[173] The templates are in PDB format and are located in $NABHOME-
/dgdb/basepairs/ and $NABHOME/dgdb/stacking/.
A typical use of these templates would be to set the bounds between two residues to some
percentage of the idealized distance described by the template. In this case, the template would
be the reference molecule ( the second molecule passed to the function ). A typical call might
be:

useboundsfrom(b, m, "1:2,3:??,H?ˆ’T]", get-


pdb( PATH + "[Link]" ), "::??,H?[ˆ’T]", 0.1 );

where PATH is $NABHOME/dgdb/stacking/. This call sets the bounds of all the base atoms in
residues 2 ( GUA ) and 3 ( CYT ) of strand 1 to be within 10% of the distances found in the
template.
The basepair templates are named so that the first field of the template name is the one-
character initials of the two individual residues and the next field is the Roman numeral cor-
responding to same bonding scheme described by Sanger, p. 120. Note: since no specific
sugar or backbone conformation is assumed in the templates, the non-base atoms should not be
referenced. The base atoms of the templates are show in figures 13.1 and 13.2.

265
13 NAB: Distance Geometry

[Link] [Link] [Link] [Link] [Link]


[Link]

[Link] [Link] [Link] [Link] [Link]


[Link] (Reversed Watson-Crick)
(Watson-Crick)

[Link] [Link] [Link] [Link] [Link] [Link]


(Hoogsteen) (Reversed Hoogsteen) (Watson-Crick) (Reversed Watson-Crick) (Hoogsteen) (Reversed Hoogsteen)

[Link] [Link] [Link] [Link] [Link] [Link]


(Watson-Crick) (Reversed Watson-Crick)

[Link] [Link] [Link] [Link] [Link] [Link]

[Link] [Link] [Link] [Link] [Link]


[Link] (Reversed Watson-Crick)
(Watson-Crick)

Figure 13.1: Basepair templates for use with useboundsfrom(), (aa-gg)

266
13.3 Distance geometry templates

[Link] [Link] [Link] [Link] [Link] [Link]

[Link] [Link] [Link] [Link] [Link] [Link]


(Watson-Crick) (Reversed Watson-Crick) (Hoogsteen) (Reversed Hoogsteen)

[Link] [Link] [Link] [Link] [Link] [Link]

[Link] [Link] [Link] [Link] [Link] [Link]


(Watson-Crick)

[Link] [Link] [Link] [Link] [Link] [Link]


(Reversed Watson-Crick) (Hoogsteen) (Reversed Hoogsteen)

[Link] [Link] [Link] [Link] [Link] [Link]

[Link] [Link]

Figure 13.2: Basepair templates for use with useboundsfrom(), (gg-uu)

267
13 NAB: Distance Geometry

The stacking templates are named in the same manner as the basepair templates. The first
two letters of the template name are the one-character initials of the two residues involved in the
stacking scheme ( 5’ residue, then 3’ residue ) and the second field is the actual helical pattern (
note: a-rna represents the helical parameters of a’rna ). The stacking shemes can be found in
the $AMBERHOME/dat/dgdb/stacking directory.

13.4 Bounds databases


In addition to canonical templates, it is also possible to specify bounds information from a
database of known molecular structures. This provides the option to use data obtained from
actual structures, rather than from an idealized, canonical conformation.
The function setboundsfromdb() sets the bounds of all pairs of atoms between the two residues
selected by aex1 and aex2 to a statistically averaged distance calculated from known struc-
tures plus or minus a multiple of the standard deviation. The statistical information is kept
in database files. Currently, there are three types of database files - Those containing bounds
information between Watson-Crick basepairs, those containing bounds information between
helically stacked residues, and those containing intra-residue bounds information for residues
in any conformation. The standard deviation is multiplied by the parameter mul and subtracted
from the average distance to determine the lower bound and similarly added to the average dis-
tance to determine the upper bound of all base-base atom distances. Base-backbone bounds,
that is, bounds between pairs of atoms in which one atom is a base atom and the other atom
is a backbone atom, are set to be looser than base-base atoms. Specifically, the lower bound
between a base-backbone atom pair is set to the smallest measured distance of all the structures
considered in creating the database. Similarly, the upper bound between a base-backbone atom
pair is set to the largest measured distance of all the structures considered. Base-base, and base-
sugar bounds are set in a similar manner. This was done to avoid imposing false constraints on
the atomic bounds, since Watson-Crick basepairing and stacking does not preclude any specific
backbone and sugar conformation. setboundsfromdb() first searches the current directory for
dbase before checking the default database location, $NABHOME/dgdb
Each entry in the database file has six fields: The atoms whose bounds are to be set, the
number of separate structures sampled in constructing these statistics, the average distance
between the two atoms, the standard deviation, the minimum measured distance, and the
maximum measured distance. For example, the database [Link] has the following
sample entries:
A:C2-T:C1’ 424 6.167 0.198 5.687 6.673
A:C2-T:C2 424 3.986 0.175 3.554 4.505
A:C2-T:C2’ 424 7.255 0.304 5.967 7.944
A:C2-T:C3’ 424 8.349 0.216 7.456 8.897
A:C2-T:C4 424 4.680 0.182 4.122 5.138
A:C2-T:C4’ 424 8.222 0.248 7.493 8.800
A:C2-T:C5 424 5.924 0.168 5.414 6.413
A:C2-T:C5’ 424 9.385 0.306 8.273 10.104
A:C2-T:C6 424 6.161 0.163 5.689 6.679
A:C2-T:C7 424 7.205 0.184 6.547 7.658

268
13.4 Bounds databases

The first column identifies the atoms from the adenosine C2 atom to various thymidine atoms
in a Watson-Crick basepair. The second column indicates that 424 structures were sampled
in determining the next four columns: the average distance, the standard deviation, and the
minimum and maximum distances.
The databases were constructing using the coordinates from all the known nucleic acid struc-
tures from the Nucleic Acid Database (NDB - [Link] If
one wishes to remake the databases, the coordinates of all the NDB structures should be down-
loaded and kept in the $NABHOME/coords directory. The databases are made by issuing the
command $NABHOME/dgdb/make_databases dblist where dblist is a list of nucleic acid types
(i.e., bdna, arna, etc. ). If one wants to add new structures to the structure repository at $NAB-
HOME/coords, it is necessary to make sure that the first two letters of the pdb file identify the
nucleic acid type. i.e., all bdna pdb files must begin with bd.
The nab functions used to create the databases are located in $NABHOME/dgdb/functions.
The stacking databases were constructed as follows: If two residues stacked 5’ to 3’ in a helix
have fewer than ten inter-residue atom distances closer than 2.0 Å or larger than 9.0 Å, and if
the normals between the base planes are less than 20.0o, the residues were considered stacked.
The base plane is calculated as the normal to the N1-C4 and midpoint of the C2-N3 and N1-C4
vectors. The first atom expression given to setboundsfromdb() specifies the 5’ residue and the
second atom expression specifies the 3’ residue. The source for this function is [Link].
Similarly, the basepair databases were constructed by measuring the heavy atom distances
of corresponding residues in a helix to check for hydrogen bonding. Specifically, if an A-U
basepair has an N1-N3 distance of between 2.3 and 3.2 Å and a N6-O4 distance of between
2.3 and 3.3 Å, then the A-U basepair is considered a Waton-Crick basepair and is used in the
database. A C-G basepair is considered Watson-Crick paired if the N3-N1 distance is between
2.3 and 3.3 Å, the N4-O6 distance is between 2.3 and 3.2 Å, and the O2-N2 distance is between
2.3 and 3.2 Å.
The nucleotide databases contain all the distance information between atoms in the same
residue. No residues in the coordinates directory are excluded from this database. The intent
was to allow the residues of this database to assume all possible conformations and ensure that
a nucleotide residue would not be biased to a particular conformation.
For the basepair and stacking databases, setting the parameter mul to 1.0 results in lower
bounds being set from the average database distance minus one standard deviation, and upper
bounds as the average database distance plus one standard deviation, between base-base atoms.
Base-backbone and base-sugar upper and lower bounds are set to the maximum and minimum
measured database values, respectively. Note, however, that a stacking multiple of 0.0 may
not correspond to consistent bounds. A stacking multiple of 0.0 will probably have conflicting
bounds information as the bounds information is derived from many different structures.
The database types are named nucleic_acid_type.database_type.db, and can be found in the
$AMBERHOME/dat/dgdb directory.

269
14 NAB: Molecular mechanics and
dynamics
The initial models created by rigid-body transformations or distance geometry are often in
need of further refinement, and molecular mechanics and dynamics can often be useful here.
nab has facilities to allow molecular mechanics and molecular dynamics calculations to be
carried out. At present, this uses the AMBER program LEaP to set up the parameters and
topology; the force field calculations and manipulations like minimization and dynamics are
done by routines in the nab suite. A version of LEaP is included in the NAB distribution, and
is accessed by the leap() discussed below. A later chapter gives a more detailed description.

14.1 Basic molecular mechanics routines


molecule getpdb_prm( string pdb-
file, string leaprc, string leap_cmd2, int savef );
int readparm( molecule m, string parmfile );
int mme_init( molecule mol, string aexp, string aexp2, point xyz_ref[], file f );
int mm_options( string opts );
float mme( point xyz[], point grad[], int iter );
float mme_rattle( point xyz[], point grad[], int iter );
int conjgrad( float x[], int n, float fret, float func(), float rmsgrad,
float dfpred, int maxiter );
int md( int n, int maxstep, point xyz[], point f[], float v[], float func );
int getxv( string filename, int natom, float start_time, float x[], float v[] );
int putxv( string filename, string ti-
tle, int natom, float start_time, float x[], float v[] );
int getxyz( string filename, int natom, float xyz[] );
int putxyz( string filename, int natom, float xyz[] );
void mm_set_checkpoint( string filename );

The getpdb_prm() is a lot like getpdb() itself, except that it creates a molecule (and the associ-
ated force field parameters) that can be used in subsequent molecular mechanics calculations.
It is often adequate to convert an input PDB file into a NAB molecule. (If this routine fails, you
may be able to fix things up by editing your input pdb file, and/or by modifying the leaprc or
leap_cmd2 strings; if this doesn’t work you will have to run tleap by hand, create a prmtop file,
and use readparm() to input it.)
The leaprc string is passed to LEaP, and identifies which parameter and force field libraries to
load. Sample leaprc files are in $NABHOME/leap/cmd, and there is no default. The leap_cmd2

271
14 NAB: Molecular mechanics and dynamics

string is interpreted after the molecule has been read in to a unit called "X". Typically, leap_cmd2
would modify the molecule, say by adding or removing bonds, etc. The final parameter, savef
will save the intermediate files if non-zero; otherwise, all intermediate files created will be re-
moved. getpdb_prm() returns a molecule whose force field parameters are already populated,
and hence is ready for further force-field manipulation.
readparm reads an AMBER parameter-topology file, created by tleap or with other AM-
BER programs, and sets up a data structure which we call a "parmstruct". This is part of the
molecule, but is not directly accessible (yet) to nab programs. You would use this command as
an alternative togetpdb_prm(). You need to be sure that the molecule used in the readparm() call
has been created by calling getpdb() with a PDB file that has been created by tleap itself (i.e.,
that has exactly the Amber atoms in the correct order). As noted above, the readparm() routine
is primarily intended for cases where getpdb_prm() fails (i.e., when you need to run tleap by
hand).
setxyz_from_mol() copies the atomic coordinates of mol to the array xyz. setmol_from_xyz()
replaces the atomic coordinates of mol with the contents of xyz. Both return the number of
atoms copied with a 0 indicating an error occurred.
The getxv() and putxv() routines read and write Amber-style restart files that have coordi-
nates and velocities. The getxyz() and putxyz() routines read and write restart files that have
coordinates only (and not velocities). The coordinates are written at higher precision than to
an AMBER restart file, i.e., with sufficiently high precision to restart even a Newton-Raphson
minimization where the error in coordinates may be on the order of10−12 . The putxyz() routine
is used in conjunction with the mm_set_checkpoint() routine to write checkpoint or restart files.
The checkpoint files are written at iteration intervals that are specified by the nchk or nchk2
parameters to the mm_options() routine (see below). The checkpoint file names are determined
by the filename string that is passed to mm_set_checkpoint(). If filename contains one or more
%d format specifiers, then the file name will be a modification of filename wherein the leftmost
%d of filename is replaced by the iteration count. If filename contains no %d format specifier,
then the file name will be filename with the iteration count appended on the right.
The mme_init() function must be called after mm_options() and before calls to mme(). It sets
up parameters for future force field evaluations, and takes as input an nab molecule. The string
aexp is an atom expression that indicates which atoms are to be allowed to move in minimization
or dynamics: atoms that do not match aexp will have their positions in the gradient vector set to
zero. A NULL atom expression will allow all atoms to move. The second string, aexp2 identifies
atoms whose positions are to be restrained to the positions in the array xyz_ref. The strength of
this restraint will be given by the wcons variable set in mm_options(). A NULL value for aexp2
will cause all atoms to be constrained. The last parameter to mme_init() is a file pointer for the
output trajectory file. This should be NULL if no output file is desired. NAB writes trajectories
in the binpos format, which can be read by ptraj, and either analyzed, or converted to another
format.
mm_options() is used to set parameters, and must be called before mme_init(); if you change
options through a call to mm_options() without a subsequent call to mme_init() you may get
incorrect calculations with no error messages. Beware. The opts string contains keyword/value
pairs of the form keyword=value separated by white space or commas. Allowed values are
shown in the following table.

272
14.1 Basic molecular mechanics routines

keyword default meaning


ntpr 10 Frequency of printing of the energy and its components.
e_debug 0 If non-zero printout additional components of the energy.
gb_debug 0 If non-zero printout information about Born first derivatives.
gb2_debug 0 If non-zero printout information about Born second derivatives.
nchk 10000 Frequency of writing checkpoint file during first derivative
calculation, i.e., in the mme() routine.
nchk2 10000 Frequency of writing checkpoint file during second derivative
calculation, i.e., in the mme2() routine.
nsnb 25 Frequency at which the non-bonded list is updated.
cut 8.0 Non-bonded cutoff, in angstroms.
wcons 0.0 Restraint weight for keeping atoms close to their positions in
xyz_ref (see mme_init).
dim 3 Number of spatial dimensions; supported values are 3 and 4.
k4d 1.0 Force constant for squeezing out the fourth dimensional
coordinate, if dim=4. If this is non-zero, a penalty function will
be added to the bounds-violation energy, which is equal to 0.5
* k4d * w * w, where w is the value of the fourth dimensional
coordinate.
dt 0.001 Time step, ps.
t 0.0 Initial time, ps.
rattle 0 If set to 1, bond lengths will be constrained to their equilibrium
values, for dynamics; default is not to include such constraints.
Note: if you want to use rattle (effectively "shake") for
minimization, you do not need to set this parameter; rather,
pass the mme_rattle() function to conjgrad().
tautp 999999. Temperature coupling parameter, in ps. The time constant
determines the strength of the weak-coupling ("Berendsen")
temperature bath.[174] Set tautp to a very large value (e.g.
9999999.) in order to turn off coupling and revert to
Newtonian dynamics. This variable only has an effect if
gamma_ln remains at its default value of zero; if gamma_ln is
not zero, Langevin dynamics is assumed, as discussed below.
gamma_ln 0.0 Collision frequency for Langevin dynamics, inps−1 . Values in
the range 2-5ps−1 often give acceptable temperature control,
while allowing transitions to take place.[175] Values near
50ps−1 correspond to the collision frequency for liquid water,
and may be useful if rough physical time scales for motion are
desired. The so-called BBK integrator is used here.[176]
temp0 300.0 Target temperature, K.
vlimit 20.0 Maximum absolute value of any component of the velocity
vector.
ntpr_md 10 Printing frequency for dynamics information to stdout.
ntwx 0 Frequency for dumping coordinates to traj_file.
zerov 0 If non-zero, then the initial velocities will be set to zero.

273
14 NAB: Molecular mechanics and dynamics

keyword default meaning


tempi 0.0 If zerov=0 and tempi>0, then the initial velocities will be
randomly chosen for this temperature. If both zerov and tempi
are zero, the velocities passed into the md() function will be
used as the initial velocities; this combination is useful to
continue an existing trajectory.
genmass 10.0 The general mass to use for MD if individual masses are not
read from a prmtop file; value in amu.
diel C Code for the dielectric model. "C" gives a dielectric constant
of 1; "R" makes the dielectric constant equal to distance in
angstroms; "RL" uses the sigmoidal function of Ramstein &
Lavery, PNAS 85, 7231 (1988); "RL94" is the same thing, but
speeded up assuming one is using the Cornell et al force field;
"R94" is a distance-dependent dielectric, again with speedups
that assume the Cornell et al. force field.
dielc 1.0 This is the dielectric constant used for non-GB simulations. It
is implemented in routine mme_init() by scaling all of the
charges by sqrt(dielc). This means that you need to set this (if
desired) in mm_options() before calling mme_init().
gb 0 If set to 0 then GB is off. Setting gb=1 turns on the Hawkins,
Cramer, Truhlar (HCT) form of pairwise generalized Born
model for solvation. See ref [66] for details of the
implementation; this is equivalent to the igb=1 option in
Amber. Set diel to "C" if you use this option. Setting gb=2
turns on the Onufriev, Bashford, Case (OBC) variant of
GB,[67, 177] with α=0.8, β =0.0 and γ=2.909. This is
equivalent to the igb=2 option in sander. Setting gb=5 just
changes the values of α, β and γ to 1.0, 0.8, and 4.85,
respectively, corresponding to the igb=5 option in sander.
rgbmax 999.0 A maximum value for considering pairs of atoms to contribute
to the calculation of the effective Born radii. The default value
means that there is effectively no cutoff. Calculations will be
sped up by using smaller values, say around 15. Å or so.
gbsa 0 If set to 1, add a surface-area dependent energy equal to
surfen*SASA, where surften is discussed below, and SASA is
an approximate surface area term. NAB uses the "LCPO"
approximation developed by Weiser, Shenkin, and Still.[178]
surften 0.005 Surface tension (see gbsa, above) in kcal/mol/Å2 .
epsext 78.5 Exterior dielectric for generalized Born; interior dielectric is
always 1.
kappa 0.0 Inverse of the Debye-Hueckel length, if gb is turned on, in
Å−1 . This parameter is related to the ionic strength as
κ = [8πβ I/ε]1/2 , where I is the ionic strength (same as the salt
concentration for a 1-1 salt). For T =298.15 and ε=78.5,
κ = (0.10806 I)1/2 , where I is in [M].

274
14.1 Basic molecular mechanics routines

keyword default meaning


ipb 0 Switch to compute electrostatic solvation free energy. If set to
0 then PBSA is off. This is equivalent to the ipb option in pbsa.
Possible values: 0, 1, and 2. See PBSA chapter for more
information.
inp 1 Option to select different methods to compute non-polar
solvation free energy. This is equivalent to the inp option in
pbsa. Possible values: 0, 1, and 2. See PBSA chapter for more
information.
epsin 1.0 Sets the dielectric constant of the solute region. The solute
region is defined to be the solvent excluded volume.
epsout 80.0 Sets the implicit solvent dielectric constant. The solvent region
is defined to be the space not occupied the solute region. i.e.
only two dielectric regions are allowed in the current release.
smoothopt 0 Instructs PB how to set up dielectric values for finite-difference
grid edges that are located across the solute/solvent dielectric
boundary.
istrng 0.0 Sets the ionic strength (in mM) for the PB equation.
radiopt 1 Option to set up atomic radii. This is equivalent to the radiopt
option in pbsa. Possible values: 0, and 1. See PBSA chapter
for more information.
dprob 0.0 Solvent probe radius for molecular surface used to define the
dielectric boundary between solute and solvent. If set 0.0, it
would be later assigned to the value of sprob.
iprob 2.0 Mobile ion probe radius for ion accessible surface used to
define the Stern layer.
npbopt 0 Option to select the linear or the full nonlinear PB equation.
= 0 Linear PB equation is solved.
= 1 Nonlinear PB equation is solved.
solvopt 1 Option to select iterative solvers. This is equivalent to the
solvopt option in pbsa. Possible values: 1, 2, 3, 4, 5, and 6. See
PBSA chapter for more information.
accept 0.001 Sets the iteration convergence criterion (relative to the initial
residue).
maxitn 100 Sets the maximum number of iterations for the finite difference
solvers, default to 100.
fillratio 2.0 The ratio between the longest dimension of the rectangular
finite-difference grid and that of the solute.
space 0.5 Sets the grid spacing for the finite difference solver.
nfocus 2 Set how many successive FD calculations will be used to
perform an electrostatic focussing calculation on a molecule.
Possible values: 1 and 2.
fscale 8 Set the ratio between the coarse and fine grid spacings in an
electrostatic focussing calculation.

275
14 NAB: Molecular mechanics and dynamics

keyword default meaning


bcopt 5 Boundary condition options. This is equivalent to the bcopt
option in pbsa. Possible values: 1, 5, and 6. See PBSA chapter
for more information.
eneopt 2 Option to compute total electrostatic energy and forces. This is
equivalent to the eneopt option in pbsa. Possible values: 1, and
2. See PBSA chapter for more information.
dbfopt n/a This keyword is equivalent to ENEOPT, and will be phased out
in future releases.
= 0 equivalent to ENEOPT = 1.

= 1 equivalent to ENEOPT = 2.

frcopt 0 Option to compute and output electrostatic forces to a file


named [Link] in the working directory. This is equivalent to
the frcopt option in pbsa. Possible values: 0, 1, 2, and 3. See
PBSA chapter for more information.
cutres 99.0 Residue-based cutoff distance. The residue-based non-bonded
list is used to make the generation of the atom-based pair list
efficient.
cutnb 0.0 Atom-based cutoff distance for van der Waals interactions, and
pairwise Coulombic interactions when ENEOPT = 2. When
ENEOPT = 1, this is the cutoff distance used for van der Waals
interactions only.
sprob 1.6 Solvent probe radius for solvent accessible surface area
(SASA) used to compute the dispersion term.
irism 0 Use 3D-RISM.
= 0 Off.

= 1 On.

xvvfile n/a .xvv file which describes bulk solvent properties. Required for
3D-RISM calculations. Produced by rism1d.
guvfile n/a Root name for solute-solvent 3D pair distribution function,
GUV (R), output in ASCII OpenDX format. This will produce
one file for each solvent atom type for each frame requested.
huvfile n/a Rootname for solute-solvent 3D total correlation function,
H UV (R), output in ASCII OpenDX format. This will produce
one file for each solvent atom type for each frame requested.
cuvfile n/a Rootname for solute-solvent 3D total correlation function,
CUV (R), output in ASCII OpenDX format. This will produce
one file for each solvent atom type for each frame requested.

276
14.1 Basic molecular mechanics routines

keyword default meaning


closure 1 Select closure approximation.
= 0 Hyper-netted chain equation (HNC).

= 1 Kovalenko-Hirata (KH).

solvcut buffer Cut-off distance for solvent-solute potential and force


calculations. If buffer < 0 and rism_cut is not explicitly set,
rism_cut = |buffer|. For minimization it is recommended to
not use a cut-off (e.g. solvcut=9999).
buffer 14 Minimum distance in Å between the solute and the edge of the
solvent box.

< 0 Use fixed box size (ng3 and solvbox).

>= 0 Buffer distance.

grdspcX 0.5 Linear grid spacing in Å. X=x, y or z. E.g., grdspcy=0.5.


ngX n/a Sets the number of grid points for a fixed size solvation box.
X=x, y or z. E.g., ngy=64.
solvboxX n/a Sets the size in Å of the fixed size solvation box. X=x, y or z.
E.g., solvboxy=32.0.
tolerance 1e-5 Maximum residual tolerance required for convergence. For
minimization a tolerance of 1e-11 or lower is recommended.
mdiis_del 0.7 “Step size” in MDIIS.
mdiis_vec 5 Number of vectors used by the MDIIS method. Higher values
for this parameter can greatly increase memory requirements
but may also accelerate convergence.
mdiis_method 1 Specify implementation of the MDIIS routine.
= 0 Original. For small systems (e.g. < 643 grid points) this
implementation may be faster than the BLAS optimized
version.

= 1 BLAS optimized.

maxstep 10000 Maximum number of iterations allowed to converge on a


solution.

277
14 NAB: Molecular mechanics and dynamics

keyword default meaning


npropagate 5 Number of previous solutions propagated forward to create an
initial guess for this solute atom configuration.
= 0 Do not use any previous solutions

= 1..5 Values greater than 0 but less than 4 or 5 will use less
system memory but may introduce artifacts to the
solution (e.g., energy drift).

centering 1 Controls how the solute is centered/re-centered in the solvent


box.

= -2 Center of geometry. Center on first step only.

= -1 Center of mass. Center on first step only.

= 0 No centering. Dangerous.

= 1 Center of mass. Center on every step. Recommended for


molecular dynamics.
= 2 Center of geometry. Center on every step. Recommended
for minimization.

zerofrc 1 Redistribute solvent forces across the solute such that the net
solvation force on the solute is zero.
= 0 Unmodified forces.

= 1 Zero net force.

apply_rism_force 1 Calculate and use solvation forces from 3D-RISM. Not


calculating these forces can save computation time and is
useful for trajectory post-processing.
= 0 Do not calculate forces.

= 1 Calculate forces.

ntwrism 0 Indicates that solvent density grid should be written to file


every ntwrism iterations. Note that the only format is ASCII
OpenDX which does not support multiple grids.
= 0 No files written.

>= 1 Output every ntwrism time steps.

278
14.1 Basic molecular mechanics routines

keyword default meaning


verbose 0 Indicates level of diagnostic detail about the calculation written
to the log file.
= 0 No output.

= 1 Print the number of iterations required to converge.

= 2 Print details for each iteration and information about what


FCE is doing every progress iterations.

progress 1 Display progress of the 3D-RISM solution every kshow


iterations. 0 indicates this information will not be displayed.
Must be used with verbose > 1.
static_arrays 1 If set to 1, do not allocate dynamic arrays for each call to the
mme() and mme2() functions. The default value of 1 reduces
computation time by avoiding array allocation.
blocksize 8 The granularity with which loop iterations are assigned to
OpenMP threads or MPI processes. For MPI, a blocksize as
small as 1 results in better load balancing during parallel
execution. For OpenMP, blocksize should not be smaller than
the number of floating-point numbers that fit into one cache
line in order to avoid performance degradation through ’false
sharing’. For ScaLAPACK, the optimum blocksize is not know,
although a value of 1 is probably too small.

The mme() function takes a coordinate set and returns the energy in the function value and the
gradient of the energy in grad. The input parameter iter is used to control printing (see the ntpr
variable) and non-bonded updates (see nsnb). The mme_rattle() function has the same interface,
but constrains the bond lengths and returns a corrected gradient. If you want to minimize with
constrained bond lengths, send mme_rattle and not mme to the conjgrad routine.
The conjgrad() function will carry out conjugate gradient minimization of the function func
that depends upon n parameters, whose initial values are in the x array. The function func must
be of the form func( x[], g[], iter ), where x contains the input values, and the function value is
returned through the function call, and its gradient with respect to x through the g array. The
iteration number is passed through iter, which func can use for whatever purpose it wants; a
typical use would just be to determine when to print results. The input parameter dfpred is
the expected drop in the function value on the first iteration; generally only a rough estimate
is needed. The minimization will proceed until maxiter steps have been performed, or until
the root-mean-square of the components of the gradient is less than rmsgrad. The value of the
function at the end of the minimization is returned in the variable fret. conjgrad can return a
variety of exit codes:

279
14 NAB: Molecular mechanics and dynamics

Return codes for conjgrad routine


>0 minimization converged; gives number of final
iteration
-1 bad line search; probably an error in the relation of
the function to its gradient (perhaps from round-off if
you push too hard on the minimization).
-2 search direction was uphill
-3 exceeded the maximum number of iterations
-4 could not further reduce function value

Finally, the md function will run maxstep steps of molecular dynamics, using func as the
force field (this would typically be set to a function like mme.) The number of dynamical
variables is given as input parameter n: this would be 3 times the number of atoms for ordinary
cases, but might be different for other force fields or functions. The arrays x[], f[] and v[] hold
the coordinates, gradient of the potential, and velocities, respectively, and are updated as the
simulation progress. The method of temperature regulation (if any) is specified by the variables
tautp and gamma_ln that are set in mm_options().
Note: In versions of NAB up to 4.5.2, there was an additional input variable to md() called
minv that reserved space for the inverse of the masses of the particles; this has now been re-
moved. This change is not backwards compatible: you must modify existing NAB scripts that
call md() to remove this variable.

14.2 Typical calling sequences


The following segment shows some ways in which these routines can be put together to do
some molecular mechanics and dynamics:
 
1 // carry out molecular mechanics minimization and some simple dynamics
2 molecule m, mi;
3 int ier;
4 float m_xyz[ dynamic ], f_xyz[ dynamic ], v[ dynamic ];
5 float dgrad, fret, dummy[2];
6

7 mi = bdna( "gcgc" );
8 putpdb( "[Link]", mi );
9 m = getpdb_prm( "[Link]", "leaprc.ff99SB", "", 0 );
10

11 allocate m_xyz[ 3*[Link] ]; allocate f_xyz[ 3*[Link] ];


12 allocate v[ 3*[Link] ];
13 setxyz_from_mol( m, NULL, m_xyz );
14

15 mm_options( "cut=25.0, ntpr=10, nsnb=999, gamma_ln=5.0" );


16 mme_init( m, NULL, "::ZZZ", dummy, NULL );
17 fret = mme( m_xyz, f_xyz, 1 );
18 printf( "Initial energy is %8.3f\n", fret );
19

20 dgrad = 0.1;

280
14.3 Second derivatives and normal modes

21 ier = conjgrad( m_xyz, 3*[Link], fret, mme, dgrad, 10.0, 100 );


22 setmol_from_xyz( m, NULL, m_xyz );
23 putpdb( "[Link]", m );
24

25 mm_options( "tautp=0.4, temp0=100.0, ntpr_md=10, tempi=50." );


26 md( 3*[Link], 1000, m_xyz, f_xyz, v, mme );
27 setmol_from_xyz( m, NULL, m_xyz );
28 putpdb( "[Link]", m );
 
Line 7 creates an nab molecule; any nab creation method could be used here. Then a tem-
porary pdb file is created, and this is used to generate a NAB molecule that can be used for
force-field calculations (line 9). Lines 11-13 allocate some memory, and fill the coordinate ar-
ray with the molecular position. Lines 15-17 initialize the force field routine, and call it once
to get the initial energy. The atom expression "::ZZZ" will match no atoms, so that there will
be no restraints on the atoms; hence the fourth argument to mme_init can just be a place-holder,
since there are no reference positions for this example. Minimization takes place at line 21,
which will call mme repeatedly, and which also arranges for its own printout of results. Finally,
in lines 25-28, a short (1000-step) molecular dynamics run is made. Note the the initialization
routine mme_init must be called before calling the evaluation routines mme or md.
Elaboration of the the above scheme is generally straightforward. For example, a simulated
annealing run in which the target temperature is slowly reduced to zero could be written as
successive calls to mm_options (setting the temp0 parameter) and md (to run a certain number
of steps with the new target temperature.) Note also that routines other than mme could be sent
to conjgrad and md: any routine that takes the same three arguments and returns a float function
value could be used. In particular, the routines db_viol (to get violations of distance bounds
from a bounds matrix) or mme4 (to compute molecular mechanics energies in four spatial
dimensions) could be used here. Or, you can write your own nab routine to do this as well.
For some examples, see the gbrna, gbrna_long and rattle_md programs in the $NABHOME/test
directory.

14.3 Second derivatives and normal modes


Russ Brown has contributed new codes that compute analytically the second derivatives of
the Amber functions, including the generalized Born terms. This capability resides in the three
functions described here.

float mme2( float x[], float g[], float h[], float mass[], int iter );
float newton( float x[], int n, float fret, float func1(), float func2(), float rms,
float nradd, int maxiter );
float nmode( float x[], int n, float func(), int eigp, int ntrun, float eta, float hrmax, int ioseen );

These routines construct and manipulate a Hessian (second derivative matrix), allowing one (for
now) to carry out Newton-Raphson minimization and normal mode calculations. The mme2()
routine takes as input a 3*natom vector of coordinates x[], and returns a gradient vector g[], a
Hessian matrix, stored columnwise in a 3*natom x 3*natom vector h[], and the masses of the

281
14 NAB: Molecular mechanics and dynamics

system, in a vector m[] of length natom. The iteration variable iter is just used to control printing.
At present, these routines only work for gb = 0 or 1.
Users will generally not call mme2() directly, but will pass this as an argument to one of the
next two routines.
The newton() routine takes a input coordinates x[] and a size parameter n (must be set to
3*natom). It performs Newton-Raphson optimization until the root-mean-square of the gradient
vector is less than rms, or until maxiter steps have been taken. For now, the input function
func1() must be mme() and func2() must be mme2(). The value nradd will be added to the
diagonal of the Hessian before the step equations are solved; this is generally set to zero, but
can be set something else under particular circumstances, which we do not discuss here.[179]
Generally, you only want to try Newton-Raphson minimization (which can be very expen-
sive) after you have optimized structures with conjgrad() to an rms gradient of 10 -3 or so. In
most cases, it should only take a small number of iterations then to go down to an rms gradient
of about 10 -12 or so, which is somewhere near the precision limit.
Once a good minimum has been found, you can use the nmode() function to compute nor-
mal/Langevin modes and thermochemical parameters. The first three arguments are the same
as for newton(), the next two integers give the number of eigenvectors to compute and the type
of run, respectively. The last three arguments (only used for Langevin modes) are the viscosity
in centipoise, the value for the hydrodynamic radius, and the type of hydrodynamic interac-
tions. Several techniques are available for diagonalizing the Hessian depending on the number
of modes required and the amount of memory available.
In all cases the modes are written to an Amber-compatible "vecs" file for normal modes or
"lmodevecs" file for Langevin modes. There are currently no nab routines that use this format.
The Langevin modes will also generate an output file called "lmode" that can be read by the
Amber module lmanal.
ntrun
0: The dsyev routine is used to diagonalize the Hessian
1: The dsyevd routine is used to diagonalize the Hessian
2: The ARPACK package (shift invert technique) is used to obtain a small number
of eigenvalues
3: The Langevin modes are computed with the viscosity and hydrodynamic radius
provided
hrmax Hydrodynamic radius for the atom with largest area exposed to solvent. If a file
named "expfile" is provided then the relative exposed areas are read from this file.
If "expfile" is not present all atoms are assigned a hydrodynamic radius of hrmax or
0.2 for the hydrogen atoms. The "expfile" can be generated with the ms (molecular
surface) program.
ioseen
0: Stokes Law is used for the hydrodynamic interaction
1: Oseen interaction included
2: Rotne-Prager correction included

282
14.3 Second derivatives and normal modes

Here is a typical calling sequence:


 
1 molecule m;
2 float x[4000], fret;
3

4 m = getpdb_prm( "[Link]" );
5 mm_options( "cut=999., ntpr=50, nsnb=99999, diel=C, gb=1, dielc=1.0" );
6 mme_init( m, NULL, "::Z", x, NULL);
7 setxyz_from_mol( m, NULL, x );
8

9 // conjugate gradient minimization


10 conjgrad(x, 3*[Link], fret, mme, 0.1, 0.001, 2000 );
11

12 // Newton-Raphson minimization\fP
13 mm_options( "ntpr=1" );
14 newton( x, 3*[Link], fret, mme2, 0.00000001, 0.0, 6 );
15

16 // get the normal modes:


17 nmode( x, 3*[Link], mme2, 0, 0, 0.0, 0.0, 0);
 

283
14 NAB: Molecular mechanics and dynamics

14.4 Low-MODe (LMOD) optimization methods


István Kolossváry has contributed new functions, which implement the LMOD methods for
minimization, conformational searching, and flexible docking.[180–183] The centerpiece of
LMOD is a conformational search algorithm based on eigenvector following of low-frequency
vibrational modes. It has been applied to a spectrum of computational chemistry domains
including protein loop optimization and flexible active site docking. The search method is im-
plemented without explicit computation of a Hessian matrix and utilizes the Arnoldi package
(ARPACK, [Link] ) for computing the low-frequency modes.
LMOD optimization can be thought of as an advanced minimization method. LMOD can not
only energy minimize a molecular structure in the local sense, but can generate a series of very
low energy conformations. The LMOD capability resides in a single, top-level calling function
lmod(), which uses fast local minimization techniques, collectively termed XMIN that can also
be accessed directly through the function xmin().

14.4.1 LMOD conformational searching


The LMOD conformational search procedure is based on gentle, but very effective struc-
tural perturbations applied to molecular systems in order to explore their conformational space.
LMOD perturbations are derived from low- frequency vibrational modes representing large-
amplitude, concerted atomic movements. Unlike essential dynamics where such low modes are
derived from long molecular dynamics simulations, LMOD calculates the modes directly and
utilizes them to improve Monte Carlo sampling.
LMOD has been developed primarily for macromolecules, with its main focus on protein
loop optimization. However, it can be applied to any kind of molecular system,s including
complexes and flexible docking where it has found widespread use. The LMOD procedure starts
with an initial molecular model, which is energy minimized. The minimized structure is then
subjected to an ARPACK calculation to find a user-specified number of low-mode eigenvectors
of the Hessian matrix. The Hessian matrix is never computed; ARPACK makes only implicit
reference to it through its product with a series of vectors. Hv, where v is an arbitrary unit
vector, is calculated via a finite-difference formula as follows,

Hv = [∇(xmin + h) − ∇(xmin )] /h (14.1)


where xmin is the coordinate vector at the energy minimized conformation and h denotes ma-
chine precision. The computational cost of Eq. 1 requires a single gradient calculation at the
energy minimum point and one additional gradient calculation for each new vector. Note that
5x is never 0, because minimization is stopped at a finite gradient RMS, which is typically set
to 0.1-1.0 kcal/mol-Å in most calculations.
The low-mode eigenvectors of the Hessian matrix are stored and can be re-used throughout
the LMOD search. Note that although ARPACK is very fast in relative terms, a single ARPACK
calculation may take up to a few hours on an absolute CPU time scale with a large protein
structure. Therefore, it would be impractical to recalculate the low-mode eigenvectors for each
new structure. Visual inspection of the low-frequency vibrational modes of different, randomly
generated conformations of protein molecules showed very similar, collective motions clearly

284
14.4 Low-MODe (LMOD) optimization methods

suggesting that low-modes of one particular conformation were transferable to other confor-
mations for LMOD use. This important finding implies that the time limiting factor in LMOD
optimization, even for relatively small molecules, is energy minimization, not the eigenvector
calculation. This is the reason for employing XMIN for local minimization instead of NAB’s
standard minimization techniques.

14.4.2 LMOD Procedure


Given the energy-minimized structure of an initial protein model, protein- ligand complex,
or any other molecular system and its low-mode Hessian eigenvectors, LMOD proceeds as
follows. For each of the first n low-modes repeat steps 1-3 until convergence:

1. Perturb the energy-minimized starting structure by moving along the ith (i =1-n) Hes-
sian eigenvector in either of the two opposite directions to a certain distance. The 3N-
dimensional (N is equal to the number of atoms) travel distance along the eigenvector is
scaled to move the fastest moving atom of the selected mode in 3-dimensional space to a
randomly chosen distance between a user-specified minimum and maximum value.
Note: A single LMOD move inherently involves excessive bond stretching and bond an-
gle bending in Cartesian space. Therefore the primarily torsional trajectory drawn by the
low-modes of vibration on the PES is severely contaminated by this naive, linear approx-
imation and, therefore, the actual Cartesian LMOD trajectory often misses its target by
climbing walls rather than crossing over into neighboring valleys at not too high altitudes.
The current implementation of LMOD employs a so-called ZIG-ZAG algorithm, which
consists of a series of alternating short LMOD moves along the low-mode eigenvector
(ZIG) followed by a few steps of minimization (ZAG), which has been found to relax
excessive stretches and bends more than reversing the torsional move. Therefore, it is
expected that such a ZIG- ZAG trajectory will eventually be dominated by concerted tor-
sional movements and will carry the molecule over the energy barrier in a way that is
not too different from finding a saddle point and crossing over into the next valley like
passing through a mountain pass.
Barrier crossing check: The LMOD algorithm checks barrier crossing by evaluating the
following criterion: IF the current endpoint of the zigzag trajectory is lower than the en-
ergy of the starting structure, OR, the endpoint is at least lower than it was in the previous
ZIG-ZAG iteration step AND the molecule has also moved farther away from the starting
structure in terms of all-atom superposition RMS than at the previous position THEN it
is assumed that the LMOD ZIG-ZAG trajectory has crossed an energy barrier.

2. Energy-minimize the perturbed structure at the endpoint of the ZIG- ZAG trajectory.

3. Save the new minimum-energy structure and return to step 1. Note that LMOD saves
only low-energy structures within a user-specified energy window above the then current
global minimum of the ongoing search.

After exploring the modes of a single structure, LMOD goes on to the next starting structure,
which is selected from the set of previously found low- energy structures. The selection is based
on either the Metropolis criterion, or simply the than lowest energy structure is used. LMOD

285
14 NAB: Molecular mechanics and dynamics

Parameter list for xmin()


keyword default meaning
func N/A The name of the function that computes the function value and gradient
of the objective function to be minimized. func() must have the
following argument list: float func( float x[], float g[], int
i)where x[] is the vector of the iterate, g[] is the gradient and i is
currently ignored except when func = mme where i is handled
internally.
natm N/A Number of atoms. NOTE: if func is other than mme, natm is used to
pass the total number of variables of the objective function to be
minimized. However, natm retains its original meaning in case func is a
user-defined energy function for 3-dimensional (molecular) structure
optimization. Make sure that the meaning of natm is compatible with
the setting of mol_struct_opt below.
x[] N/A Coordinate vector. User has to allocate memory in calling program and
fill x[] with initial coordinates using, e.g., the setxyz_from_mol function
(see sample program below). Array size = 3*natm.
g[] N/A Gradient vector. User has to allocate memory in calling program. Array
size = 3*natm.
ene N/A On output, ene stores the minimized energy.
grms_out N/A On output, grms_out stores the gradient RMS achieved by XMIN.

Table 14.2: Arguments for xmin().

terminates when the user-defined number of steps has been completed or when the user-defined
number of low-energy conformations has been collected.
Note that for flexible docking calculations LMOD applies explicit translations and rotations
of the ligand(s) on top of the low-mode perturbations.

14.4.3 XMIN
float xmin( float func(), int natm, float x[], float g[],
float ene, float grms_out, struct xmod_opt xo);

At a glance: The xmin() function minimizes the energy of a molecular structure with ini-
tial coordinates given in the x[] array. On output, xmin() returns the minimized energy as the
function value and the coordinates in x[] will be updated to the minimum-energy conformation.
The arguments to xmin() are described in Table 14.2; the parameters in the xmin_opt structure
are described in Table 14.3; these should be preceded by “xo.”, since they are members of an
xmod_opt struct with that name; see the sample program below to see how this works.
There are three types of minimizers that can be used, specified by the method parameter:
method
1: PRCG Polak-Ribiere conjugate gradient method, similar to the conjgrad() func-
tion [185].

286
14.4 Low-MODe (LMOD) optimization methods

Parameter list for xmin_opt


keyword default meaning
mol_struct_opt 1 1= 3-dimensional molecular structure optimization. Any other value
means general function optimization.
maxiter 1000 Maximum number of iteration steps allowed for XMIN. A value of zero
means single point energy calculation, no minimization.
grms_tol 0.05 Gradient RMS threshold below which XMIN should minimize the input
structure.
method 3 Minimization algorithm. See text for description.
numdiff 1 Finite difference method used in TNCG for approximating the product
of the Hessian matrix and some vector in the conjugate gradient
iteration (the same approximation is used in LMOD, see Eq. 14.1 in
section 14.4.1). 1= Forward difference. 2=Central difference.
m_lbfgs 3 Size of the L-BFGS memory used in either L-BFGS minimization or
L-BFGS preconditioning for TNCG. The value zero turns off
preconditioning. It usually makes little sense to set the value >10.
print_level 0 Amount of debugging printout. 0= No output. 1= Minimization details.
2= Minimization (including conjugate gradient iteration in case of
TNCG) and line search details.
iter N/A Output parameter. The total number of iteration steps completed by
XMIN.
xmin_time N/A Output parameter. CPU time in seconds used by XMIN.
ls_method 2 1= modified Armijo [184](not recommended, primarily used for
testing).
2= Wolfe (after J. J. More’ and D. J. Thuente).
ls_maxiter 20 Maximum number of line search steps per single minimization step.
ls_maxatmov 0.5 Maximum (co-ordinate) movement per degree of freedom allowed in
line search, range > 0.
beta_armijo 0.5 Armijo beta parameter, range (0, 1). Only change it if you know what
you are doing.
c_armijo 0.4 Armijo c parameter, range (0, 0.5). Only change it if you know what you
are doing.
mu_armijo 1.0 Armijo mu parameter, range [0, 2). Only change it if you know what you
are doing.
ftol_wolfe 0.0001 Wolfe ftol parameter, range (0, 0.5). Only change it if you know what
you are doing.
gtol_wolfe 0.9 Wolfe gtol parameter, range (ftol_wolfe, 1). Only change it if you know
what you are doing.
ls_iter N/A Output parameter. The total number of line search steps completed by
XMIN.
error_flag N/A Output parameter. A non-zero value indicates an error. In case of an
error XMIN will always print a descriptive error message.

Table 14.3: Options for xmin_opt.

287
14 NAB: Molecular mechanics and dynamics

2: L-BFGS Limited-memory Broyden-Fletcher-Goldfarb-Shanno quasi-Newton al-


gorithm [186]. L-BFGS is 2-3 times faster than PRCG mainly, because it
requires significantly fewer line search steps than PRCG.
3: lbfgs-TNCG L-BFGS preconditioned truncated Newton conjugate gradient al-
gorithm [185, 187]. Sophisticated technique that can minimize molecular
structures to lower energy and gradient than PRCG and L-BFGS and requires
an order of magnitude fewer minimization steps, but L-BFGS can sometimes
be faster in terms of total CPU time.

NOTE: The xmin routine can be utilized for minimizing arbitrary, user-defined objective func-
tions. The function must be defined in a user NAB program or in any other user library that is
linked in. The name of the function is passed to xmin() via the func argument.

14.4.4 Sample XMIN program


The following sample program, which is based on the test program [Link], reads a molec-
ular structure from a PDB file, minimizes it, and saves the minimized structure in another PDB
file.
 
1 // XMIN reverse communication external minimization package.
2 // Written by Istvan Kolossvary.
3

4 #include "xmin_opt.h"
5

6 // M A I N P R O G R A M to carry out XMIN minimization on a molecule:


7

8 struct xmin_opt xo;


9

10 molecule mol;
11 int natm;
12 float xyz[ dynamic ], grad[ dynamic ];
13 float energy, grms;
14 point dummy;
15

16 xmin_opt_init( xo ); // set up defaults (shown here)


17

18 // xo.mol_struct_opt = 1;
19 // [Link] = 1000;
20 // xo.grms_tol = 0.05;
21 // [Link] = 3;
22 // [Link] = 1;
23 // xo.m_lbfgs = 3;
24 // xo.ls_method = 2;
25 // xo.ls_maxiter = 20;
26 // [Link] = 0.5;
27 // xo.beta_armijo = 0.5;
28 // xo.c_armijo = 0.4;
29 // xo.mu_armijo = 1.0;

288
14.4 Low-MODe (LMOD) optimization methods

30 // xo.ftol_wolfe = 0.0001;
31 // xo.gtol_wolfe = 0.9;
32 // xo.print_level = 0;
33

34 [Link] = 10; // non-defaults are here


35 xo.grms_tol = 0.001;
36 [Link] = 3;
37 xo.ls_maxatmov = 0.15;
38 xo.print_level = 2;
39

40 mol = getpdb( "[Link]" );


41 readparm( mol, "[Link]" );
42 natm = [Link];
43 allocate xyz[ 3*natm ]; allocate grad[ 3*natm ];
44 setxyz_from_mol( mol, NULL, xyz );
45

46 mm_options( "ntpr=1, gb=1, kappa=0.10395, rgbmax=99., cut=99.0, diel=C ");


47 mme_init( mol, NULL, "::ZZZ", dummy, NULL );
48

49 energy = mme( xyz, grad, 0 );


50 energy = xmin( mme, natm, xyz, grad, energy, grms, xo );
51

52 // E N D M A I N
 
The corresponding screen output should look similar to this. Note that this is fairly technical,
debugging information; normally print_level is set to zero.
 
Reading parm file ([Link])
title:
PDB 5DNB, Dickerson decamer
old prmtop format => using old algorithm for GB parms
mm_options: ntpr=99
mm_options: gb=1
mm_options: kappa=0.10395
mm_options: rgbmax=99.
mm_options: cut=99.0
mm_options: diel=C
iter Total bad vdW elect. cons. genBorn frms

ff: 0 -4107.50 906.22 -192.79 -137.96 0.00 -4682.97 1.93e+01

________________________________________________________________

MIN: It= 0 E= -4107.50 ( 19.289)


CG: It= 3 ( 0.310) :-)
LS: step= 0.94735 it= 1 info= 1
MIN: It= 1 E= -4423.34 ( 5.719)
CG: It= 4 ( 0.499) :-)
LS: step= 0.91413 it= 1 info= 1

289
14 NAB: Molecular mechanics and dynamics

MIN: It= 2 E= -4499.43 ( 2.674)


CG: It= 9 ( 0.498) :-)
LS: step= 0.86829 it= 1 info= 1
MIN: It= 3 E= -4531.20 ( 1.543)
CG: It= 8 ( 0.499) :-)
LS: step= 0.95556 it= 1 info= 1
MIN: It= 4 E= -4547.59 ( 1.111)
CG: It= 9 ( 0.491) :-)
LS: step= 0.77247 it= 1 info= 1
MIN: It= 5 E= -4556.35 ( 1.068)
CG: It= 8 ( 0.361) :-)
LS: step= 0.75150 it= 1 info= 1
MIN: It= 6 E= -4562.95 ( 1.042)
CG: It= 8 ( 0.273) :-)
LS: step= 0.79565 it= 1 info= 1
MIN: It= 7 E= -4568.59 ( 0.997)
CG: It= 5 ( 0.401) :-)
LS: step= 0.86051 it= 1 info= 1
MIN: It= 8 E= -4572.93 ( 0.786)
CG: It= 4 ( 0.335) :-)
LS: step= 0.88096 it= 1 info= 1
MIN: It= 9 E= -4575.25 ( 0.551)
CG: It= 64 ( 0.475) :-)
LS: step= 0.95860 it= 1 info= 1
MIN: It= 10 E= -4579.19 ( 0.515)
----------------------------------------------------------------

FIN: :-) E= -4579.19 ( 0.515)


 

The first few lines are typical NAB output from mm_init() and mme(). The output below
the horizontal line comes from XMIN. The MIN/CG/LS blocks contain the following pieces
of information. The MIN: line shows the current iteration count, energy and gradient RMS
(in parentheses). The CG: line shows the CG iteration count and the residual in parentheses.
The happy face :-) means convergence whereas :-( indicates that CG iteration encountered neg-
ative curvature and had to abort. The latter situation is not a serious problem, minimization
can continue. This is just a safeguard against uphill moves. The LS: line shows line search
information. "step" is the relative step with respect to the initial guess of the line search step.
"it" tells the number of line search steps taken and "info" is an error code. "info" = 1 means
that line searching converged with respect to sufficient decrease and curvature criteria whereas
a non- zero value indicates an error condition. Again, an error in line searching doesn’t mean
that minimization necessarily failed, it just cannot proceed any further because of some numer-
ical dead end. The FIN: line shows the final result with a happy face :-) if either the grms_tol
criterion has been met or when the number of iteration steps reached the maxiter value.

290
14.4 Low-MODe (LMOD) optimization methods

14.4.5 LMOD

float lmod( int natm, float x[], float g[], float ene, float conflib[],
float lmod_traj[], int lig_start[], int lig_end[], int lig_cent[],
float tr_min[], float tr_max[], float rot_min[], float rot_max[],
struct xmin_opt, struct xmin_opt, struct lmod_opt);

At a glance: The lmod() function is similar to xmin() in that it optimizes the energy of a molec-
ular structure with initial coordinates given in the x[] array. However, the optimization goes
beyond local minimization, it is a sophisticated conformational search procedure. On output,
lmod() returns the global minimum energy of the LMOD conformational search as the function
value and the coordinates in x[] will be updated to the global minimum-energy conformation.
Moreover, a set of the best low-energy conformations is also returned in the array conflib[].
Coordinates, energy, and gradient are in NAB units. The parameters are given in the table be-
low; items above the line are passed as parameters; the rest of the parameters are all preceded
by “lo.”, because they are members of an lmod_opt struct with that name; see the sample
program below to see how this works.
Also note that xmin()’s xmin_opt struct is passed to lmod() as well. lmod() changes the
default values of some of the “xo.” parameters via the call to lmod_opt_int() relative to a call
to xmin_opt_init(), which means that in a more complex NAB program with multiple calls to
xmin() and lmod(); make sure to always initialize and set user parameters for each and every
XMIN and LMOD search via, respectively calling xmin_opt_init() and lmod_opt_init() just
before the calls to xmin() and lmod().

keyword default meaning


natm Number of atoms.
x[] Coordinate vector. User has to allocate memory in calling
program and fill x[] with initial coordinates using, e.g., the
setxyz_from_mol function (see sample program below). Array
size = 3*natm.
g[] Gradient vector. User has to allocate memory in calling
program. Array size = 3*natm.
ene On output, ene stores the global minimum energy.
conflib[] User allocated storage array where LMOD stores low-energy
conformations. Array size = 3*natm*nconf.
lmod_traj[] User allocated storage array where LMOD stores snapshots of
the pseudo trajectory drawn by LMOD on the potential energy
surface. Array size = 3*natom * (nconf + 1).
lig_start[] N/A The serial number(s) of the first/last atom(s) of the ligand(s).
The number(s) should correspond to the numbering in the NAB
input files. Note that the ligand(s) can be anywhere in the atom
list, however, a single ligand must have continuous numbering
between the corresponding lig_start and lig_end values. The
arrays should be allocated in the calling program. Array size =
nlig, but in case nlig=0 there is no need for allocating memory.

291
14 NAB: Molecular mechanics and dynamics

keyword default meaning


lig_end[] N/A See above.
lig_cent[] N/A Similar array in all respects to lig_start/end, but the serial
number(s) define the center of rotation. The value zero means
that the center of rotation will be the geometric center of
gravity of the ligand.
tr_min[] N/A The range of random translation/rotation applied to individual
ligand(s). Rotation is carried out about the origin defined by
the corresponding lig_cent value(s). The angle is given in +/-
degrees and the distance in angstroms. The particular angles
and distances are randomly chosen from their respective
ranges. The arrays should be allocated in the calling program.
Array size = nlig, but in case nlig=0 there is no need to
allocate memory.
tr_max[] See tr_min[], above.
rot_min[] See tr_min[], above.
rot_max[] See tr_min[], above.
niter 10 The number of LMOD iterations. Note that a single LMOD
iteration involves a number of different computations (see
section 14.4.2.). A value of zero results in a single local
minimization; like a call to xmin.
nmod 5 The total number of low-frequency modes computed by
LMOD every time such computation is requested.
minim_grms 0.1 The gradient RMS convergence criterion of structure
minimization.
kmod 3 The definite number of randomly selected low-modes used to
drive LMOD moves at each LMOD iteration step.
nrotran_dof 6 The number of rotational and translational degrees of freedom.
This is related to the number of frozen or tethered atoms in the
system: 0 atoms dof=6, 1 atom dof=3, 2 atoms dof=1, >=3
atoms dof=0. Default is 6, no frozen or tethered atoms. See
section 14.4.7, note (5).
nconf 10 The maximum number of low-energy conformations stored in
conflib[]. Note that the calling program is responsible for
allocating memory for conflib[].
energy_window 50.0 The energy window for conformation storage; the energy of a
stored structure will be in the interval [global_min, global_min
+ energy_window].
eig_recalc 5 The frequency, measured in LMOD iterations, of the
recalculation of eigenvectors.
ndim_arnoldi 0 The dimension of the ARPACK Arnoldi factorization. The
default, zero, specifies the whole space, that is, three times the
number of atoms. See note below.

292
14.4 Low-MODe (LMOD) optimization methods

keyword default meaning


lmod_restart 10 The frequency, in LMOD iterations, of updating the conflib
storage, that is, discarding structures outside the energy
window, and restarting LMOD with a randomly chosen
structure from the low-energy pool defined by n_best_struct
below. A value >maxiter will prevent LMOD from doing any
restarts.
n_best_struct 10 Number of the lowest-energy structures found so far at a
particular LMOD restart point. The structure to be used for the
restart will be chosen randomly from this pool. n_best_struct =
1 allows the user to explore the neighborhood of the then
current global minimum.
mc_option 1 The Monte Carlo method.
1= Metropolis Monte Carlo (see rtemp below).
2= "Total_Quench", which means that the LMOD trajectory
always proceeds towards the lowest lying neighbor of a
particular energy well found after exhaustive search along all
of the randomly selected kmod low-modes.
3= "Quick_Quench", which means that the LMOD trajectory
proceeds towards the first neighbor found, which is lower in
energy than the current point on the path, without exploring the
remaining modes.
rtemp 1.5 The value of RT in NAB energy units. This is utilized in the
Metropolis criterion.
lmod_step_size_min 2.0 The minimum length of a single LMOD ZIG move in Å. See
section 14.4.2.
lmod_step_size_max 5.0 The maximum length of a single LMOD ZIG move in Å. See
section 14.4.2.
nof_lmod_steps 0 The number of LMOD ZIG-ZAG moves. The default, zero,
means that the number of ZIG-ZAG moves is not pre-defined,
instead LMOD will attempt to cross the barrier in as many
ZIG-ZAG moves as it is necessary. The criterion of crossing an
energy barrier is stated above in section 14.4.2.
nof_lmod_steps > 0 means that multiple barriers may be
crossed and LMOD can carry the molecule to a large distance
on the potential energy surface without severely distorting the
geometry.
lmod_relax_grms 1.0 The gradient RMS convergence criterion of structure
relaxation, see ZAG move in section 14.4.2.
nlig 0 Number of ligands considered for flexible docking. The
default, zero, means no docking.

293
14 NAB: Molecular mechanics and dynamics

keyword default meaning


apply_rigdock 2 The frequency, measured in LMOD iterations, of the
application of rigid-body rotational and translational motions
to the ligand(s). At each apply_rigdock-th LMOD iteration
nof_pose_to-try rotations and translations are applied to the
ligand(s).
nof_poses_to_try 10 The number of rigid-body rotational and translational motions
applied to the ligand(s). Such applications occur at each
apply_rigdock-th LMOD iteration. In case nof_pose_to_try >
1, it is always the lowest energy pose that is kept, all other
poses are discarded.
random_seed 314159 The seed of the random number generator. A value of zero
requests hardware seeding based on the system clock.
print_level 0 Amount of debugging printout. 0= No output. 1= Basic output.
2= Detailed output. 3= Copious debugging output including
ARPACK details.
lmod_time N/A CPU time in seconds used by LMOD itself.
aux_time N/A CPU time in seconds used by auxiliary routines.
error_flag N/A A non-zero value indicates an error. In case of an error LMOD
will always print a descriptive error message.

Notes on the ndim_arnoldi parameter: Basically, the ARPACK package used for the eigen-
vector calculations solves multiple "small" eigenvalue problems instead of a single "large"
problem, which is the diagonalization of the three times the number of atoms by three times
the number of atoms Hessian matrix. This parameter is the user specified dimension of the
"small" problem. The allowed range is nmod + 1 <= ndim_arnoldi <= 3*natm. The default
means that the "small" problem and the "large" problem are identical. This is the preferred,
i.e., fastest, calculation for small to medium size systems, because ARPACK is guaranteed to
converge in a single iteration. The ARPACK calculation scales with three times the number
of atoms times the Arnoldi dimension squared and, therefore, for larger molecules there is an
optimal ndim_arnoldi much less than three times the number of atoms that converges much
faster in multiple iterations (possibly thousands or tens of thousands of iterations). The key to
good performance is to select ndim_arnoldi such that all the ARPACK storage fits in memory.
For proteins, ndim_arnoldi =1000 is generally a good value, but often a very small ∼50-100
Arnoldi dimension provides the fastest net computational cost with very many iterations.

14.4.6 Sample LMOD program


The following sample program, which is based on the test program [Link], reads a molec-
ular structure from a PDB file, runs a short LMOD search, and saves the low-energy conforma-
tions in PDB files.
 
1 // LMOD reverse communication external minimization package.
2 // Written by Istvan Kolossvary.
3

294
14.4 Low-MODe (LMOD) optimization methods

4 #include "xmin_opt.h"
5 #include "lmod_opt.h"
6

7 // M A I N P R O G R A M to carry out LMOD simulation on a molecule/complex:


8

9 struct xmin_opt xo;


10 struct lmod_opt lo;
11

12 molecule mol;
13 int natm;
14 float energy;
15 int lig_start[ dynamic ], lig_end[ dynamic ], lig_cent[ dynamic ];
16 float xyz[ dynamic ], grad[ dynamic ], conflib[ dynamic ], lmod_trajectory[ dynamic ];
17 float tr_min[ dynamic ], tr_max[ dynamic ], rot_min[ dynamic ], rot_max[ dynamic ];
18 float glob_min_energy;
19 point dummy;
20

21 lmod_opt_init( lo, xo ); // set up defaults


22

23 [Link] = 3; // non-default options are here


24 lo.mc_option = 2;
25 lo.nof_lmod_steps = 5;
26 lo.random_seed = 99;
27 lo.print_level = 2;
28

29 xo.ls_maxatmov = 0.15;
30

31 mol = getpdb( "[Link]" );


32 readparm( mol, "[Link]" );
33 natm = [Link];
34

35 allocate xyz[ 3*natm ]; allocate grad[ 3*natm ];


36 allocate conflib[ [Link] * 3*natm ];
37 allocate lmod_trajectory[ ([Link]+1) * 3*natm ];
38 setxyz_from_mol( mol, NULL, xyz );
39

40 mm_options( "ntpr=5000, gb=0, cut=999.0, nsnb=9999, diel=R ");


41 mme_init( mol, NULL, "::ZZZ", dummy, NULL );
42

43 mme( xyz, grad, 1 );


44 glob_min_energy = lmod( natm, xyz, grad, energy,
45 conflib, lmod_trajectory, lig_start, lig_end, lig_cent,
46 tr_min, tr_max, rot_min, rot_max, xo, lo );
47

48 printf( "\nGlob. min. E = %12.3lf kcal/mol\n", glob_min_energy );


49

50

51 // E N D M A I N
 

295
14 NAB: Molecular mechanics and dynamics

The corresponding screen output should look similar to this.


 
Reading parm file ([Link])
title:

mm_options: ntpr=5000
mm_options: gb=0
mm_options: cut=999.0
mm_options: nsnb=9999
mm_options: diel=R
________________________________________________________________
Low-Mode Simulation
---------------------------------------------------------------------------
1 E = -118.117 ( 0.054) Rg = 5.440
1 / 6 E = -89.2057 ( 0.090) Rg = 2.625 rmsd= 8.240 p= 0.0000
1 / 8 E = -51.682 ( 0.097) Rg = 5.399 rmsd= 8.217 p= 0.0000
3 /12 E = -120.978 ( 0.091) Rg = 3.410 rmsd= 7.248 p= 1.0000
3 /10 E = -106.292 ( 0.099) Rg = 5.916 rmsd= 4.829 p= 0.0004
4 / 6 E = -106.788 ( 0.095) Rg = 4.802 rmsd= 3.391 p= 0.0005
4 / 3 E = -111.501 ( 0.097) Rg = 5.238 rmsd= 2.553 p= 0.0121
---------------------------------------------------------------------------
2 E = -120.978 ( 0.091) Rg = 3.410
1 / 4 E = -137.867 ( 0.097) Rg = 2.842 rmsd= 5.581 p= 1.0000
1 / 9 E = -130.025 ( 0.100) Rg = 4.282 rmsd= 5.342 p= 1.0000
4 / 3 E = -123.559 ( 0.089) Rg = 3.451 rmsd= 1.285 p= 1.0000
4 / 4 E = -107.253 ( 0.095) Rg = 3.437 rmsd= 2.680 p= 0.0001
5 / 5 E = -113.119 ( 0.096) Rg = 3.136 rmsd= 2.074 p= 0.0053
5 / 4 E = -134.1 ( 0.091) Rg = 3.141 rmsd= 2.820 p= 1.0000
---------------------------------------------------------------------------
3 E = -130.025 ( 0.100) Rg = 4.282
1 / 8 E = -150.556 ( 0.093) Rg = 3.347 rmsd= 5.287 p= 1.0000
1 / 4 E = -123.738 ( 0.079) Rg = 4.218 rmsd= 1.487 p= 0.0151
2 / 8 E = -118.254 ( 0.095) Rg = 3.093 rmsd= 5.296 p= 0.0004
2 / 7 E = -115.027 ( 0.090) Rg = 4.871 rmsd= 4.234 p= 0.0000
4 / 7 E = -128.905 ( 0.099) Rg = 4.171 rmsd= 2.113 p= 0.4739
4 /11 E = -133.85 ( 0.099) Rg = 3.290 rmsd= 4.464 p= 1.0000
__________________________________________________
Full list:
1 E = -150.556 / 1 Rg = 3.347
2 E = -137.867 / 1 Rg = 2.842
3 E = -134.1 / 1 Rg = 3.141
4 E = -133.85 / 1 Rg = 3.290
5 E = -130.025 / 1 Rg = 4.282
6 E = -128.905 / 1 Rg = 4.171
7 E = -123.738 / 1 Rg = 4.218
8 E = -123.559 / 1 Rg = 3.451
9 E = -120.978 / 1 Rg = 3.410
10 E = -118.254 / 1 Rg = 3.093

296
14.4 Low-MODe (LMOD) optimization methods

Glob. min. E = -150.556 kcal/mol

Time in libLMOD = 13.880 CPU sec

Time in NAB and libs = 63.760 CPU sec


 

The first few lines come from mm_init() and mme(). The screen output below the horizontal
line originates from LMOD. Each LMOD-iteration is represented by a multi-line block of data
numbered in the upper left corner by the iteration count. Within each block, the first line
displays the energy and, in parentheses, the gradient RMS as well as the radius of gyration
(assigning unit mass to each atom), of the current structure along the LMOD pseudo simulation-
path. The successive lines within the block provide information about the LMOD ZIG-ZAG
moves (see section 14.4.2). The number of lines is equal to 2 times kmod (2x3 in this example).
Each selected mode is explored in both directions, shown in two separate lines. The leftmost
number is the serial number of the mode (randomly selected from the set of nmod modes)
and the number after the slash character gives the number of ZIG-ZAG moves taken. This
is followed by, respectively, the minimized energy and gradient RMS, the radius of gyration,
the RMSD distance from the base structure, and the Boltzmann probability with respect to the
energy of the base structure and rtemp, of the minimized structure at the end of the ZIG-ZAG
path. Note that exploring the same mode along both directions can result in two quite different
structures. Also note that the number of ZIG-ZAG moves required to cross the energy barrier
(see section 14.4.2) in different directions can vary quite a bit, too. Occasionally, an exclamation
mark next to the energy (!E = ...) denotes a structure that could not be fully minimized.

After finishing all the computation within a block, the corresponding LMOD step is com-
pleted by selecting one of the ZIG-ZAG endpoint structures as the base structure of the next
LMOD iteration. The selection is based on the mc_option and the Boltzmann probability. The
LMOD pseudo simulation-path is defined by the series of these mc_option-selected structures
and it is stored in lmod_traj[]. Note that the sample program saves these structures in a multi-
PDB disk file called lmod_trajectory.pdb. The final section of the screen output lists the nconf
lowest energy structures found during the LMOD search. Note that some of the lowest energy
structures are not necessarily included in the lmod_traj[] list, as it depends on the mc_option
selection. The list displays the energy, the number of times a particular conformation was found
(increasing numbers are somewhat indicative of a more complete search), and the radius of gy-
ration. The sample program writes the top ten low-energy structures in separate, numbered PDB
files. The glob. min. energy and the timing results are printed from the sample NAB program,
not from LMOD.

As a final note, it is instructive to be aware of a simple safeguard that LMOD applies . A copy
of the conflib[] array is saved periodically in a binary disk file called [Link]. Since LMOD
searches might run for a long time, in case of a crash low-energy structures can be recovered
from this file. The format of [Link] is as follows. Each conformation is represented by 3
numbers (double energy, double radius of gyration, and int number of times found), followed
by the double (x, y, z) coordinates of the atoms.

297
14 NAB: Molecular mechanics and dynamics

14.4.7 Tricks of the trade of running LMOD searches


1. The AMBER atom types HO, HW, and ho all have zero van der Waals parameters in all
of the AMBER (and some other) force fields. Corresponding Aij and Bij coefficients in
the PRMTOP file are set to zero. This means there is no repulsive wall to prevent two
oppositely charged atoms, one being of type HO, HW or ho, to fuse as a result of the
ever decreasing electrostatic energy as they come closer and closer to each other. This
potential problem is rarely manifest in molecular dynamics simulations, but it presents a
nuisance when running LMOD searches. The problem is local minimization, especially
"aggressive" TNCG minimization (XMIN [Link]=3) that can easily result in atom
fusion. Therefore, before running an LMOD simulation, the PRMTOP file (let’s call it
[Link]) must be processed by running the script "lmodprmtop [Link] [Link]".
This script will replace all the repulsive Aij coefficients set to zero in [Link] with
a high value of 1e03 in [Link] in order to re-create the van der Waals wall. It is
understood that this procedure is parameter fudging; however, note that the primary goal
of using LMOD is the quick generation of approximate, low-energy structures that can
be further refined by high-accuracy MD.
2. LMOD requires that the potential energy surface is continuous everywhere to a great
degree. Therefore, always use a distance dependent dielectric constant in mm_options
when running searches in vacuo, or use GB solvation (note that GB calculations will be
slow), and always apply a large cut-off. It does make sense to run quick and dirty LMOD
searches in vacuo to generate low-energy starting structures for MD runs. Note that the
most likely symptom of discontinuities causing a problem is when your NAB program
utilizing LMOD is grabbing CPU time, but the LMOD search does not seem to progress.
This is the result of NaN’s that often can be seen when print_level is set to > 0.
3. LMOD is NOT INTENDED to be used with explicit water models and periodic bound-
ary conditions. Although explicit-water solvation representation is not recommended,
LMOD docking can be readily used with crystallographic water molecules as ligands.
4. Conformations in the conflib and lmod_trajectory files can have very different orienta-
tions. One trick to keep them in a common orientation is to restrain the position of, e.g.,
a single benzene ring. This will ensure that the molecule cannot be translated or rotated
as a whole. However, when applying this trick you should set nrotran_dof = 0.
5. A subset of the atoms of a molecular system can be frozen or tethered/restrained in NAB
by two different methods. Atoms can either be frozen by using the first atom expression
argument in mme_init() or restrained by using the second atom expression argument and
the reference coordinate array in mme_init() along with the wcons option in mm_options.
LMOD searches, especially docking calculations can be run much faster if parts of the
molecular system can be frozen, because the effective degrees of freedom is determined
by the size of the flexible part of the system. Application of frozen atoms means that a
much smaller number of moving atoms are moving in the fixed, external potential of the
frozen atoms. The tethered atom model is expected to give similar results to the frozen
atom model, but note that the number of degrees of freedom and, therefore, the computa-
tional cost of a tethered calculation is comparable to that of a fully unrestrained system.

298
14.4 Low-MODe (LMOD) optimization methods

However, the eigenvector calculations are likely to converge faster with the tethered sys-
tems.

299
15 NAB: Sample programs
This chapter provides a variety of examples that use the basic NAB functionality described
in earlier chapters to solve interesting molecular manipulation problems. Our hope is that the
ideas and approaches illustrated here will facilitate construction of similar programs to solve
other problems.

15.1 Duplex Creation Functions


nab provides a variety of functions for creating Watson/Crick duplexes. A short description
of four of them is given in this section. All four of these functions are written in nab and the
details of their implementation is covered in the section Creating Watson/Crick Duplexes of
the User Manual. You should also look at the function fd_helix() to see how to create duplex
helices that correspond to fibre-diffraction models. As with the PERL language, "there is more
than one way to do it."

molecule bdna( string seq );


string wc_complement( string seq, string rlib, string rlt );
molecule wc_helix( string seq, string rlib, string natype, string cseq, string cr-
lib,
string cnatype, float xoffset, float incl, float twist, float rise, string options );
molecule dg_helix( string seq, string rlib, string natype,
string cseq, string crlib, string cnatype, float xoff-
set, float incl, float twist, float rise,
string options );
molecule wc_basepair( residue res, residue cres );

bdna() converts the character string seq containing one or more A, C, G or Ts (or their lower
case equivalents) into a uniform ideal Watson/Crick B-form DNA duplex. Each basepair has
an X-offset of 2.25 Å, an inclination of -4.96 Å and a helical step of 3.38 Å rise and 36.0o
twist. The first character of seq is the 5’ base of the strand "sense" of the molecule returned
by bdna(). The other strand is called "anti". The phosphates of the two 5’ bases have been
replaced by hydrogens and and hydrogens have been added to the two O3’ atoms of the three
prime bases. bdna() returns NULL if it can not create the molecule.
wc_complement() returns a string that is the Watson/Crick complement of its argument seq.
Each C, G, T (U) in seq is replaced by G, C and A. The replacements for A depends if rlt is DNA
or RNA. If it is DNA, A is replaced by T. If it is RNA A is replaced by U. wc_complement()
considers lower case and upper case letters to be the same and always returns upper case letters.
wc_complement() returns NULL on error. Note that the while the orientations of the argument

301
15 NAB: Sample programs

string and the returned string are opposite, their absolute orientations are undefined until they
are used to create a molecule.
wc_helix() creates a uniform duplex from its arguments. The two strands of the returned
molecule are called "sense" and "anti". The two sequences, seq and cseq must specify Wat-
son/Crick base pairs. Note the that must be specified as lower-case strings, such as "ggact".
The nucleic acid type ( DNA or RNA ) of the sense strand is specified by natype and of the
complementary strand cseq by cnatype. Two residue libraries—rlib and crlib— permit creation
of DNA:RNA heteroduplexes. If either seq or cseq (but not both) is NULL only the speci-
fied strand of what would have been a uniform duplex is created. The options string contains
some combination of the strings "s5", "s3", "a5" and "a3"; these indicate which (if any) of the
ends of the helices should be "capped" with hydrogens attached to the O5’ atom (in place of a
phosphate) if "s5" or "a5" is specified, and a proton added to the O3’ position if "s3" or "a3"
is specified. A blank string indicates no capping, which would be appropriate if this section
of helix were to be inserted into a larger molecule. The string "s5a5s3a3" would cap the 5’
and 3’ ends of both the "sense" and "anti" strands, leading to a chemically complete molecule.
wc_helix() returns NULL on error.
dg_helix() is the functional equivalent of wc_helix() but with the backbone geometry mini-
mized via a distance constraint error function. dg_helix() takes the same arguments as wc_helix().
wc_basepair() assembles two nucleic acid residues (assumed to be in a standard orientation)
into a two stranded molecule containing one Watson/Crick base pair. The two strands of the
new molecule are "sense" and "anti". It returns NULL on error.

15.2 nab and Distance Geometry


Distance geometry is a method which converts a molecule represented as a set of interatomic
distances and related information into a 3-D structure. nab has several builtin functions that are
used together to provide metric matrix distance geometry. nab also provides the bounds type for
holding a molecule’s distance geometry information. A bounds object contains the molecule’s
interatomic distance bounds matrix and a list of its chiral centers and their volumes. nab uses
chiral centers with a volume of 0 to enforce planarity.
Distance geometry has several advantages. It is unique in its power to create structures from
very incomplete descriptions. It easily incorporates “low resolution structural data” such as
that derived from chemical probing since these kinds of experiments generally return only dis-
tance bounds. And it also provides an elegant method by which structures may be described
functionally.
The nab distance geometry package is described more fully in the section NAB Language
Reference. Generally, the function newbounds() creates and returns a bounds object corre-
sponding to the molecule mol. This object contains two things—a distance bounds matrix
containing initial upper and lower bounds for every pair of atoms in mol and a initial list of the
molecules chiral centers and their volumes. Once a bounds object has been initialized, the mod-
eller uses functions from the middle of the distance geometry function list to tighten, loosen or
set other distance bounds and chiralities that correspond to experimental measurements or parts
of the model’s hypothesis. The four functions andbounds(), orbounds(), setbounds and use-
boundsfrom() work in similar fashion. Each uses two atom expressions to select pairs of atoms

302
15.2 nab and Distance Geometry

from mol. In andbounds(), the current distance bounds of each pair are compared against lb and
ub and are replaced by lb, ub if they represent tighter bounds. orbounds() replaces the current
bounds of each selected pair, if lb, ub represent looser bounds. setbounds() sets the bounds of
all selected pairs to lb, ub. useboundsfrom() sets the bounds between each atom selected in the
first expression to a percentage of the distance between the atoms selected in the second atom
expression. If the two atom expressions select the same atoms from the same molecule, the
bounds between all the atoms selected will be constrained to the current geometry. setchivol()
takes four atom expressions that must select exactly four atoms and sets the volume of the
tetrahedron enclosed by those atoms to vol. Setting vol to 0 forces those atoms to be planar.
getchivol() returns the chiral volume of the tetrahedron described by the four points.
After all experimental and model constraints have been entered into the bounds object, the
function tsmooth() applies a process called “triangle smoothing” to them. This tests each triple
of distance bounds to see if they can form a triangle. If they can not form a triangle then the
distance bounds do not even represent a Euclidean object let alone a 3-D one. If this occurs,
tsmooth() quits and returns a 1 indicating failure. If all triples can form triangles, tsmooth()
returns a 0. Triangle smoothing pulls in the large upper bounds. After all, the maximum distance
between two atoms can not exceed the sum of the upper bounds of the shortest path between
them. Triangle smoothing can also increase lower bounds, but this process is much less effective
as it requires one or more large lower bounds to begin with.
The function embed() takes the smoothed bounds and converts them into a 3-D object. This
process is called “embedding”. It does this by choosing a random distance for each pair of
atoms within the bounds of that pair. Sometimes the bounds simply do not represent a 3-D
object and embed() fails, returning the value 1. This is rare and usually indicates the that the
distance bounds matrix part of the bounds object contains errors. If the distance set does embed,
conjgrad() can subject newly embedded coordinates to conjugate gradient refinement against the
distance and chirality information contained in bounds. The refined coordinates can replace the
current coordinates of the molecule in mol. embed() returns a 0 on success and conjgrad()
returns an exit code explained further in the Language Reference section of this manual. The
call to embed() is usually placed in a loop with each new structure saved after each call to see
the diversity of the structures the bounds represent.
In addition to the explicit bounds manipulation functions, nab provides an implicit way of
setting bounds between interacting residues. The function setboundsfromdb() is for use in cre-
ating distance and chirality bounds for nucleic acids. setboundsfromdb() takes as an argument
two atom expressions selecting two residues, the name of a database containing bounds infor-
mation, and a number which dictates the tightness of the bounds. For instance, if the database
[Link] is specified, setboundsfromdb() sets the bounds between the two residues to what
they would be if they were stacked in strand in a typical Watson-Crick B-form duplex. Simi-
larly, if the database [Link] is specified, setboundsfromdb() sets the bounds between
the two residues to what they would be if the two residues form a typical Watson-Crick basepair
in an A-form helix.

15.2.1 Refine DNA Backbone Geometry


As mentioned previously, wc_helix() performs rigid body transformations on residues and
does not correct for poor backbone geometry. Using distance geometry, several techniques are

303
15 NAB: Sample programs

available to correct the backbone geometry. In program 7, an 8-basepair dna sequence is created
using wc_helix(). A new bounds object is created on line 14, which automatically sets all the
1-2, 1-3, and 1-4 distance bounds information according the geometry of the model. Since this
molecule was created using wc_helix(), the O3’-P distance between adjacent stacked residues
is often not the optimal 1.595 ˚, and hence, the 1-2, 1-3, and 1-4, distance bounds set by new-
bounds() are incorrect. We want to preserve the position of the nucleotide bases, however, since
this is the helix whose backbone we wish to minimize. Hence the call to useboundsfrom() on
line 17 which sets the bounds from every atom in each nucleotide base to the actual distance to
every other atom in every other nucleotide base. In general, the likelihood of a distance geom-
etry refinement to satisfy a given bounds criteria is proportional to the number of ( consistent )
bounds set supporting that criteria. In other words, the more bounds that are set supporting a
given conformation, the greater the chance that conformation will resolve after the refinement.
An example of this concept is the use of useboundsfrom() in line 17, which works to preserve
our rigid helix conformation of all the nucleotide base atoms.
We can correct the backbone geometry by overwriting the erroneous bounds with more ap-
propriate bounds. In lines 19-29, all the 1-2, 1-3, and 1-4 bounds involving the O3’-P con-
nection between strand 1 residues are set to that which would be appropriate for an idealized
phosphate linkage. Similarly, in lines 31-41, all the 1-2, 1-3, and 1-4 bounds involving the O3’-
P connection among strand 2 residues are set to an idealized conformation. This technique is
effective since all the 1-2, 1-3, and 1-4 distance bounds created by newbounds() include those
of the idealized nucleotides in the nucleic acid libraries [Link], [Link], etc.
contained in reslib. Hence, by setting these bounds and refining against the distance energy
function, we are spreading the ’error’ across the backbone, where the ’error’ is the departure
from the idealized sugar conformation and idealized phosphate linkage.
On line 43, we smooth the bounds matrix, and on line 44 we give a substantial penalty for
deviating from a 3-D refinement by setting k4d=4.0. Notice that there is no need to embed the
molecule in this program, as the actual coordinates are sufficient for any refinement.
 
1 // Program 7 - refine backbone geometry using distance function
2 molecule m;
3 bounds b;
4 string seq, cseq;
5 int i;
6 float xyz[ dynamic ], fret;
7

8 seq = "acgtacgt";
9 cseq = wc_complement( "acgtacgt", "", "dna" );
10

11 m = wc_helix( seq, "", "dna", cseq, "",


12 "dna", 2.25, -4.96, 36.0, 3.38, "" );
13

14 b = newbounds(m, "");
15 allocate xyz[ 4*[Link] ];
16

17 useboundsfrom(b, m, "::??,H?[^T’]", m, "::??,H?[^T’]", 0.0 );


18 for ( i = 1; i < [Link]/2 ; i = i + 1 ){
19 setbounds(b,m, sprintf("1:%d:O3’",i),

304
15.2 nab and Distance Geometry

20 sprintf("1:%d:P",i+1), 1.595,1.595);
21 setbounds(b,m, sprintf("1:%d:O3’",i),
22 sprintf("1:%d:O5’",i+1), 2.469,2.469);
23 setbounds(b,m, sprintf("1:%d:C3’",i),
24 sprintf("1:%d:P",i+1), 2.609,2.609);
25 setbounds(b,m, sprintf("1:%d:O3’",i),
26 sprintf("1:%d:O1P",i+1), 2.513,2.513);
27 setbounds(b,m, sprintf("1:%d:O3’",i),
28 sprintf("1:%d:O2P",i+1), 2.515,2.515);
29 setbounds(b,m, sprintf("1:%d:C4’",i),
30 sprintf("1:%d:P",i+1), 3.550,4.107);
31 setbounds(b,m, sprintf("1:%d:C2’",i),
32 sprintf("1:%d:P",i+1), 3.550,4.071);
33 setbounds(b,m, sprintf("1:%d:C3’",i),
34 sprintf("1:%d:O1P",i+1), 3.050,3.935);
35 setbounds(b,m, sprintf("1:%d:C3’",i),
36 sprintf("1:%d:O2P",i+1), 3.050,4.004);
37 setbounds(b,m, sprintf("1:%d:C3’",i),
38 sprintf("1:%d:O5’",i+1), 3.050,3.859);
39 setbounds(b,m, sprintf("1:%d:O3’",i),
40 sprintf("1:%d:C5’",i+1), 3.050,3.943);
41

42 setbounds(b,m, sprintf("2:%d:P",i+1),
43 sprintf("2:%d:O3’",i), 1.595,1.595);
44 setbounds(b,m, sprintf("2:%d:O5’",i+1),
45 sprintf("2:%d:O3’",i), 2.469,2.469);
46 setbounds(b,m, sprintf("2:%d:P",i+1),
47 sprintf("2:%d:C3’",i), 2.609,2.609);
48 setbounds(b,m, sprintf("2:%d:O1P",i+1),
49 sprintf("2:%d:O3’",i), 2.513,2.513);
50 setbounds(b,m, sprintf("2:%d:O2P",i+1),
51 sprintf("2:%d:O3’",i), 2.515,2.515);
52 setbounds(b,m, sprintf("2:%d:P",i+1),
53 sprintf("2:%d:C4’",i), 3.550,4.107);
54 setbounds(b,m, sprintf("2:%d:P",i+1),
55 sprintf("2:%d:C2’",i), 3.550,4.071);
56 setbounds(b,m, sprintf("2:%d:O1P",i+1),
57 sprintf("2:%d:C3’",i), 3.050,3.935);
58 setbounds(b,m, sprintf("2:%d:O2P",i+1),
59 sprintf("2:%d:C3’",i), 3.050,4.004);
60 setbounds(b,m, sprintf("2:%d:O5’",i+1),
61 sprintf("2:%d:C3’",i), 3.050,3.859);
62 setbounds(b,m, sprintf("2:%d:C5’",i+1),
63 sprintf("2:%d:O3’",i), 3.050,3.943);
64 }
65 tsmooth( b, 0.0005 );
66 dg_options(b, "seed=33333, gdist=0, ntpr=100, k4d=4.0" );
67 setxyzw_from_mol( m, NULL, xyz );
68 conjgrad( xyz, 4*[Link], fret, db_viol, 0.1, 10., 500 );

305
15 NAB: Sample programs

5’- -3’

5’- -3’
Figure 15.1: Single-stranded RNA (top) folded into a pseudoknot (bottom). The black and dark
grey base pairs can be stacked.

69 setmol_from_xyzw( m, NULL, xyz );


70 putpdb( "[Link]", m );
 
The approach of Program 7 is effective but has a disadvantage in that it does not scale lin-
early with the number of atoms in the molecule. In particular, tsmooth() and conjgrad() require
extensive CPU cycles for large numbers of residues. For this reason, the function dg_helix() was
created. dg_helix() takes uses the same method of Program 7, but employs a 3-basepair helix
template which traverses the new helix as it is being constructed. In this way, the helix is built
in a piecewise manner and the maximum number of residues considered in each refinement is
less than or equal to six. This is the preferred method of helix construction for large, idealized
canonical duplexes.

15.2.2 RNA Pseudoknots


In addition to the standard helix generating functions, nab provides extensive support for
generating initial structures from low structural information. As an example, we will describe
the construction of a model of an RNA pseudoknot based on a small number of secondary
and tertiary structure descriptions. Shen and Tinoco (J. Mol. Biol. 247, 963-978, 1995) used
the molecular mechanics program X-PLOR to determine the three dimensional structure of a
34 nucleotide RNA sequence that folds into a pseudoknot. This pseudoknot promotes frame
shifting in Mouse Mammary Tumor Virus. A pseudoknot is a single stranded nucleic acid
molecule that contains two improperly nested hairpin loops as shown in Figure 15.1. NMR
distance and angle constraints were converted into a three dimensional structure using a two
stage restrained molecular dynamics protocol. Here we show how a three-dimensional model
can be constructed using just a few key features derived from the NMR investigation.
 
1 // Program 8 - create a pseudoknot using distance geometry
2 molecule m;
3 float xyz[ dynamic ],f[ dynamic ],v[ dynamic ];
4 bounds b;
5 int i, seqlen;
6 float fret;
7 string seq, opt;
8

9 seq = "gcggaaacgccgcguaagcg";
10

306
15.2 nab and Distance Geometry

11 seqlen = length(seq);
12

13 m = link_na("1", seq, "[Link]", "rna", "35");


14

15 allocate xyz[ 4*[Link] ];


16 allocate f[ 4*[Link] ];
17 allocate v[ 4*[Link] ];
18

19

20 b = newbounds(m, "");
21

22 for ( i = 1; i <= seqlen; i = i + 1) {


23 useboundsfrom(b, m, sprintf("1:%d:??,H?[^’T]", i), m,
24 sprintf("1:%d:??,H?[^’T]", i), 0.0 );
25 }
26

27 setboundsfromdb(b, m, "1:1:", "1:2:", "[Link]", 1.0);


28 setboundsfromdb(b, m, "1:2:", "1:3:", "[Link]", 1.0);
29 setboundsfromdb(b, m, "1:3:", "1:18:", "[Link]", 1.0);
30 setboundsfromdb(b, m, "1:18:", "1:19:", "[Link]", 1.0);
31 setboundsfromdb(b, m, "1:19:", "1:20:", "[Link]", 1.0);
32

33 setboundsfromdb(b, m, "1:8:", "1:9:", "[Link]", 1.0);


34 setboundsfromdb(b, m, "1:9:", "1:10:", "[Link]", 1.0);
35 setboundsfromdb(b, m, "1:10:", "1:11:", "[Link]", 1.0);
36 setboundsfromdb(b, m, "1:11:", "1:12:", "[Link]", 1.0);
37 setboundsfromdb(b, m, "1:12:", "1:13:", "[Link]", 1.0);
38

39 setboundsfromdb(b, m, "1:1:", "1:13:", "[Link]", 1.0);


40 setboundsfromdb(b, m, "1:2:", "1:12:", "[Link]", 1.0);
41 setboundsfromdb(b, m, "1:3:", "1:11:", "[Link]", 1.0);
42

43 setboundsfromdb(b, m, "1:8:", "1:20:", "[Link]", 1.0);


44 setboundsfromdb(b, m, "1:9:", "1:19:", "[Link]", 1.0);
45 setboundsfromdb(b, m, "1:10:", "1:18:", "[Link]", 1.0);
46

47 tsmooth(b, 0.0005);
48

49 opt = "seed=571, gdist=0, ntpr=50, k4d=2.0, randpair=5.";


50 dg_options( b, opt );
51 embed(b, xyz );
52

53 for ( i = 3000; i > 2800; i = i - 100 ){


54 conjgrad( xyz, 4*[Link], fret, db_viol, 0.1, 10., 500 );
55

56 dg_options( b, "ntpr=1000, k4d=0.2" );


57 mm_options( "ntpr_md=50, zerov=1, temp0=" +sprintf("%d.",i));
58 md( 4*[Link], 1000, xyz, f, v, db_viol );
59

307
15 NAB: Sample programs

60 dg_options( b, "ntpr=1000, k4d=4.0" );


61 mm_options( "zerov=0, temp0=0., tautp=0.3" );
62 md( 4*[Link], 8000, xyz, f, v, db_viol );
63 }
64

65 setmol_from_xyzw( m, NULL, xyz );


66 putpdb( "[Link]", m );
 

Program 8 uses distance geometry followed by minimization and simulated annealing to


create a model of a pseudoknot. Distance geometry code begins in line 20 with the call to
newbounds() and ends on line 53 with the call to embed(). The structure created with distance
geometry is further refined with molecular dynamics in lines 58-74. Note that very little struc-
tural information is given - only connectivity and general base-base interactions. The stacking
and base-pair interactions here are derived from NMR evidence, but in other cases might arise
from other sorts of experiments, or as a model hypothesis to be tested.
The 20-base RNA sequence is defined on line 9. The molecule itself is created with the
link_na() function call which creates an extended conformation of the RNA sequence and caps
the 5’ and 3’ ends. Lines 15-18 define arrays that will be used in the simulated annealing of the
structure. The bounds object is created in line 20 which automatically sets the 1-2, 1-3, and 1-4
distance bounds in the molecule. The loop in lines 22-25 sets the bounds of each atom in each
residue base to the actual distance to every other atom in the same base. This has the effect of
enforcing the planarity of the base by treating the base somewhat like a rigid body. In lines 27-
45, bounds are set according to information stored in a database. The setboundsfromdb() call
sets the bounds from all the atoms in the two specified residues to a 1.0 multiple of the standard
deviation of the bounds distances in the specified database. Specifically, line 27 sets the bounds
between the base atoms of the first and second residues of strand 1 to be within one standard
deviation of a typical aRNA stacked pair. Similarly, line 39 sets the bounds between residues 1
and 13 to be that of typical Watson-Crick basepairs. For a description of the setboundsfromdb()
function, see Chapter 1.
Line 47 smooths the bounds matrix, by attempting to adjust any sets of bounds that violate
the triangle equality. Lines 49-50 initialize some distance geometry variables by setting the
random number generator seed, declaring the type of distance distribution, how often to print
the energy refinement process, declaring the penalty for using a 4th dimension in refinement,
and which atoms to use to form the initial metric matrix. The coordinates are calculated and
embedded into a 3D coordinate array, xyz by the embed() function call on line 51.
The coordinates xyz are subject to a series of conjugate gradient refinements and simulated
annealing in lines 53-63. Line 65 replaces the old molecular coordinates with the new refined
ones, and lastly, on line 66, the molecule is saved as "[Link]".
The resulting structure of Program 8 is shown in Figure 15.2. This structure had an final total
energy of 9.41 units. The helical region, shown as polytubes, shows stacking and wc-pairing
interactions and a well-defined right-handed helical twist. Of course, good modeling of a "real"
pseudoknot would require putting in more constraints, but this example should illustrate how to
get started on problems like this.

308
15.2 nab and Distance Geometry

Figure 15.2: Folded RNA pseudoknot.

15.2.3 NMR refinement for a protein


Distance geometry techniques are often used to create starting structures in NMR refinement.
Here, in addition to the covalent connections, one makes use of a set of distance and torsional
restraints derived from NMR data. While NAB is not (yet?) a fully-functional NMR refinement
package, it has enough capabilities to illustrate the basic ideas, and could be the starting point
for a flexible procedure. Here we give an illustration of how the rough structure of a protein can
be determined using distance geometry and NMR distance constraints; the structures obtained
here would then be candidates for further refinement in programs like X-plor or Amber.
The program below illustrates a general procedure for a primarily helical DNA binding do-
main. Lines 15-22 just construct the sequence in an extended conformation, such that bond
lengths and angles are correct, but none of the torsions are correct. The bond lengths and angles
are used by newbounds() to construct the "covalent" part of the bounds matrix.
 
1 // Program 8a. General driver routine to do distance geometry \fC
2 // on proteins, with DYANA-like distance restraints.\fC
3

4 #define MAXCOORDS 12000


5

6 molecule m;
7 atom a;
8 bounds b;
9 int ier,i, numstrand, ires,jres;
10 float fret, rms, ub;
11 float xyz[ MAXCOORDS ], f[ MAXCOORDS ], v[ MAXCOORDS ];
12 file boundsf;

309
15 NAB: Sample programs

13 string iresname,jresname,iat,jat,aex1,aex2,aex3,aex4,line,dgopts,seq;
14

15 // sequence of the mrf2 protein:


16 seq = "RADEQAFLVALYKYMKERKTPIERIPYLGFKQINLWTMFQAAQKLGGYETITARRQWKHIY"
17 + "DELGGNPGSTSAATCTRRHYERLILPYERFIKGEEDKPLPPIKPRK";
18

19 // build this sequence in an extended conformation, and construct a bounds


20 // matrix just based on the covalent structure:
21 m = linkprot( "A", seq, "" );
22 b = newbounds( m, "" );
23

24 // read in constraints, updating the bounds matrix using "andbounds":


25

26 // distance constraints are basically those from Y.-C. Chen, R.H. Whitson
27 // Q. Liu, K. Itakura and Y. Chen, "A novel DNA-binding motif shares
28 // structural homology to DNA replication and repair nucleases and
29 // polymerases," Nature Sturct. Biol. 5:959-964 (1998).
30

31 boundsf = fopen( "mrf2.7col", "r" );


32 while( line = getline( boundsf ) ){
33 sscanf( line, "%d %s %s %d %s %s %lf", ires, iresname, iat,
34 jres, jresname, jat, ub );
35

36 // translations for DYANA-style pseudoatoms:


37 if( iat == "HN" ){ iat = "H"; }
38 if( jat == "HN" ){ jat = "H"; }
39

40 if( iat == "QA" ){ iat = "CA"; ub += 1.0; }


41 if( jat == "QA" ){ jat = "CA"; ub += 1.0; }
42 if( iat == "QB" ){ iat = "CB"; ub += 1.0; }
43 if( jat == "QB" ){ jat = "CB"; ub += 1.0; }
44 if( iat == "QG" ){ iat = "CG"; ub += 1.0; }
45 if( jat == "QG" ){ jat = "CG"; ub += 1.0; }
46 if( iat == "QD" ){ iat = "CD"; ub += 1.0; }
47 if( jat == "QD" ){ jat = "CD"; ub += 1.0; }
48 if( iat == "QE" ){ iat = "CE"; ub += 1.0; }
49 if( jat == "QE" ){ jat = "CE"; ub += 1.0; }
50 if( iat == "QQG" ){ iat = "CB"; ub += 1.8; }
51 if( jat == "QQG" ){ jat = "CB"; ub += 1.8; }
52 if( iat == "QQD" ){ iat = "CG"; ub += 1.8; }
53 if( jat == "QQD" ){ jat = "CG"; ub += 1.8; }
54 if( iat == "QG1" ){ iat = "CG1"; ub += 1.0; }
55 if( jat == "QG1" ){ jat = "CG1"; ub += 1.0; }
56 if( iat == "QG2" ){ iat = "CG2"; ub += 1.0; }
57 if( jat == "QG2" ){ jat = "CG2"; ub += 1.0; }
58 if( iat == "QD1" ){ iat = "CD1"; ub += 1.0; }
59 if( jat == "QD1" ){ jat = "CD1"; ub += 1.0; }
60 if( iat == "QD2" ){ iat = "ND2"; ub += 1.0; }
61 if( jat == "QD2" ){ jat = "ND2"; ub += 1.0; }

310
15.2 nab and Distance Geometry

62 if( iat == "QE2" ){ iat = "NE2"; ub += 1.0; }


63 if( jat == "QE2" ){ jat = "NE2"; ub += 1.0; }
64

65 aex1 = ":" + sprintf( "%d", ires) + ":" + iat;


66 aex2 = ":" + sprintf( "%d", jres) + ":" + jat;
67 andbounds( b, m, aex1, aex2, 0.0, ub );
68 }
69 fclose( boundsf );
70

71 // add in helical chirality constraints to force right-handed helices:


72 // (hardwire in locations 1-16, 36-43, 88-92)
73 for( i=1; i<=12; i++){
74 aex1 = ":" + sprintf( "%d", i ) + ":CA";
75 aex2 = ":" + sprintf( "%d", i+1 ) + ":CA";
76 aex3 = ":" + sprintf( "%d", i+2 ) + ":CA";
77 aex4 = ":" + sprintf( "%d", i+3 ) + ":CA";
78 setchivol( b, m, aex1, aex2, aex3, aex4, 7.0 );
79 }
80 for( i=36; i<=39; i++){
81 aex1 = ":" + sprintf( "%d", i ) + ":CA";
82 aex2 = ":" + sprintf( "%d", i+1 ) + ":CA";
83 aex3 = ":" + sprintf( "%d", i+2 ) + ":CA";
84 aex4 = ":" + sprintf( "%d", i+3 ) + ":CA";
85 setchivol( b, m, aex1, aex2, aex3, aex4, 7.0 );
86 }
87 for( i=88; i<=89; i++){
88 aex1 = ":" + sprintf( "%d", i ) + ":CA";
89 aex2 = ":" + sprintf( "%d", i+1 ) + ":CA";
90 aex3 = ":" + sprintf( "%d", i+2 ) + ":CA";
91 aex4 = ":" + sprintf( "%d", i+3 ) + ":CA";
92 setchivol( b, m, aex1, aex2, aex3, aex4, 7.0 );
93 }
94

95 // set up some options for the distance geometry calculation


96 // here use the random embed method:
97 dgopts = "ntpr=10000,rembed=1,rbox=300.,riter=250000,seed=8511135";
98 dg_options( b, dgopts );
99

100 // do triangle-smoothing on the bounds matrix, then embed:


101 geodesics( b ); embed( b, xyz );
102

103 // now do conjugate-gradient minimization on the resulting structures:


104

105 // first, weight the chirality constraints heavily:


106 dg_options( b, "ntpr=20, k4d=5.0, sqviol=0, kchi=50." );
107 conjgrad( xyz, 4*[Link], fret, db_viol, 0.02, 1000., 300 );
108

109 // next, squeeze out the fourth dimension, and increase penalties for
110 // distance violations:

311
15 NAB: Sample programs

111 dg_options( b, "k4d=10.0, sqviol=1, kchi=50." );


112 conjgrad( xyz, 4*[Link], fret, db_viol, 0.02, 100., 400 );
113

114 // transfer the coordinates from the "xyz" array to the molecule
115 // itself, and print out the violations:
116 setmol_from_xyzw( m, NULL, xyz );
117 dumpboundsviolations( stdout, b, 0.5 );
118

119 // do a final short molecular-mechanics "clean-up":


120 putpdb( m, "[Link]" );
121 m = getpdb_prm( "[Link]", "leaprc.ff99SB", "", 0 );
122 setxyz_from_mol( m, NULL, xyz );
123

124 mm_options( "cut=10.0" );


125 mme_init( m, NULL, "::ZZZ", xyz, NULL );
126 conjgrad( xyz, 3*[Link], fret, mme, 0.02, 100., 200 );
127 setmol_from_xyz( m, NULL, xyz );
128 putpdb( argv[3] + ".[Link]", m );
 
Once the covalent bounds are created, the the bounds matrix is modified by constraints
constructed from an NMR analysis program. This particular example uses the format of the
DYANA program, but NAB could be easily modified to read in other formats as well. Here are
a few lines from the mrf2.7col file:
1 ARG+ QB 2 ALA QB 7.0
4 GLU- HA 93 LYS+ QB 7.0
5 GLN QB 8 LEU QQD 9.9
5 GLN HA 9 VAL QQG 6.4
85 ILE HA 92 ILE QD1 6.0
5 GLN HN 1 ARG+ O 2.0
5 GLN N 1 ARG+ O 3.0
6 ALA HN 2 ALA O 2.0
6 ALA N 2 ALA O 3.0

The format should be self-explanatory, with the final number giving the upper bound. Code
in lines 31-69 reads these in, and translates pseudo-atom codes like "QQD" into atom names.
Lines 71-93 add in chirality constraints to ensure right-handed alpha-helices: distance con-
straints alone do not distinguish chirality, so additions like this are often necessary. The "actual"
distance geometry steps take place in line 101, first by triangle-smoothing the bounds, then by
embedding them into a three-dimensional object. The structures at this point are actually gen-
erally quite bad, so "real-space" refinement is carried out in lines 103-112, and a final short
molecular mechanics minimization in lines 119-126.
It is important to realize that many of the structures for the above scheme will get "stuck", and
not lead to good structures for the complex. Helical proteins are especially difficult for this sort
of distance geometry, since helices (or even parts of helices) start out left-handed, and it is not
always possible to easily convert these to right-handed structures. For this particular example,
(using different values for the seed in line 97), we find that about 30-40% of the structures are
"acceptable", in the sense that further refinement in Amber yields good structures.

312
15.3 Building Larger Structures

15.3 Building Larger Structures


While the DNA duplex is locally rather stiff, many DNA molecules are sufficiently long that
they can be bent into a wide variety of both open and closed curves. Some examples would be
simple closed circles, supercoiled closed circles that have relaxed into circles with twists and
the nucleosome core fragment where the duplex itself is wound into a short helix. This section
shows how nab can be used to “wrap” DNA around a curve. Three examples are provided: the
first produces closed circles with or without supercoiling, the second creates a simple model
of the nucleosome core fragment and the third shows how to wind a duplex around a more
arbitrary open curve specified as a set of points. The examples are fairly general but do require
that the curves be relatively smooth so that the deformation from a linear duplex at each step is
small.
Before discussing the examples and the general approach they use, it will be helpful to define
some terminology. The helical axis of a base pair is the helical axis defined by an ideal B-DNA
duplex that contains that base pair. The base pair plane is the mean plane of both bases. The
origin of a base pair is at the intersection the base pair’s helical axis and its mean plane. Finally
the rise is the distance between the origins of adjacent base pairs.
The overall strategy for wrapping DNA around a curve is to create the curve, find the points
on the curve that contain the base pair origins, place the base pairs at these points, oriented
so that their helical axes are tangent to the curve and finally rotate the base pairs so that they
have the correct helical twist. In all the examples below, the points are chosen so that the rise
is constant. This is by no means an absolute requirement, but it does simplify the calculations
needed to locate base pairs, and is generally true for the gently bending curves these examples
are designed for. In examples 1 and 2, the curve is simple, either a circle or a helix, so the points
that locate the base pairs are computed directly. In addition, the bases are rotated about their
original helical axes so that they have the correct helical orientation before being placed on the
curve.
However, this method is inadequate for the more complicated curves that can be handled by
example 3. Here each base is placed on the curve so that its helical axis is aligned correctly, but
its helical orientation with respect to the previous base is arbitrary. It is then rotated about its
helical axis so that it has the correct twist with respect to the previous base.

15.3.1 Closed Circular DNA


This section describes how to use nab to make closed circular duplex DNA with a uniform
rise of 3.38 Å. Since the distance between adjacent base pairs is fixed, the radius of the circle
that forms the axis of the duplex depends only on the number of base pairs and is given by this
rule:

rad=rise/(2sin(180/nbp))

where nbp is the number of base pairs. To see why this is so, consider the triangle below
formed by the center of the circle and the centers of two adjacent base pairs. The two long
sides are radii of the circle and the third side is the rise. Since the the base pairs are uniformly
distributed about the circle the angle between the two radii is 360/nbp. Now consider the right

313
15 NAB: Sample programs

triangle in the top half of the original triangle. The angle at the center is 180/nbp, the opposite
side is rise/2 and rad follows from the definition of sin.
base i+1
rad
rise/2
180/nbp
C

base i

In addition to the radius, the helical twist which is a function of the amount of supercoiling
must also be computed. In a closed circular DNA molecule, the last base of the duplex must be
oriented in such a way that a single helical step will superimpose it on the first base. In circles
based on ideal B-DNA, with 10 bases/turn, this requires that the number of base pairs in the
duplex be a multiple of 10. Supercoiling adds or subtracts one or more whole turns. The amount
of supercoiling is specified by the ∆linkingnumber which is the number of extra turns to add or
subtract. If the original circle had nbp/10 turns, the supercoiled circle will have nbp/10 + ∆lk
turns. As each turn represents 360o of twist and there are nbp base pairs, the twist between base
pairs is

(nbp/10+∆lk)×360/nbp

At this point, we are ready to create models of circular DNA. Bases are added to model in
three stages. Each base pair is created using the nab builtin wc_helix(). It is originally in the
XY plane with its center at the origin. This makes it convenient to create the DNA circle in the
XZ plane. After the base pair has been created, it is rotated around its own helical axis to give
it the proper twist, translated along the global X axis to the point where its center intersects the
circle and finally rotated about the Y axis to move it to its final location. Since the first base pair
would be both twisted about Z and rotated about Y 0o, those steps are skipped for base one. A
detailed description follows the code.
 
1 // Program 9 - Create closed circular DNA.
2 #define RISE 3.38
3

4 int b, nbp, dlk;


5 float rad, twist, ttw;
6 molecule m, m1;
7 matrix matdx, mattw, matry;
8 string sbase, abase;
9 int getbase();
10

11 if( argc != 3 ){
12 fprintf( stderr, "usage: %s nbp dlk\\n", argv[ 1 ] );
13 exit( 1 );

314
15.3 Building Larger Structures

14 }
15

16 nbp = atoi( argv[ 2 ] );


17 if( !nbp || nbp % 10 ){
18 fprintf( stderr,
19 "%s: Num. of base pairs must be multiple of 10\\n",
20 argv[ 1 ] );
21 exit( 1 );
22 }
23

24 dlk = atoi( argv[ 3 ] );


25

26 twist = ( nbp / 10 + dlk ) * 360.0 / nbp;


27 rad = 0.5 * RISE / sin( 180.0 / nbp );
28

29 matdx = newtransform( rad, 0.0, 0.0, 0.0, 0.0, 0.0 );


30

31 m = newmolecule();
32 addstrand( m, "A" );
33 addstrand( m, "B" );
34 ttw = 0.0;
35 for( b = 1; b <= nbp; b = b + 1 ){
36

37 getbase( b, sbase, abase );


38

39 m1 = wc_helix(
40 sbase, "", "dna", abase, "",
41 "dna", 2.25, -4.96, 0.0, 0.0 );
42

43 if( b > 1 ){
44 mattw = newtransform( 0.,0.,0.,0.,0.,ttw );
45 transformmol( mattw, m1, NULL );
46 }
47

48 transformmol( matdx, m1, NULL );


49

50 if( b > 1 ){
51 matry = newtransform(
52 0.,0.,0.,0.,-360.*(b-1)/nbp,0. );
53 transformmol( matry, m1, NULL );
54 }
55

56 mergestr( m, "A", "last", m1, "sense", "first" );


57 mergestr( m, "B", "first", m1, "anti", "last" );
58 if( b > 1 ){
59 connectres( m, "A", b - 1, "O3’", b, "P" );
60 connectres( m, "B", 1, "O3’", 2, "P" );
61 }
62

315
15 NAB: Sample programs

63 ttw = ttw + twist;


64 if( ttw >= 360.0 )
65 ttw = ttw - 360.0;
66 }
67

68 connectres( m, "A", nbp, "O3’", 1, "P" );


69 connectres( m, "B", nbp, "O3’", 1, "P" );
70

71 putpdb( "[Link]", m );
72 putbnd( "[Link]", m );
 

The code requires two integer arguments which specify the number of base pairs and the∆linkingnumberor
the amount of supercoiling. Lines 11-24 process the arguments making sure that they conform
to the model’s assumptions. In lines 11-14, the code checks that there are exactly three argu-
ments (the nab program’s name is argument one), and exits with a error message if the number
of arguments is different. Next lines 16-22 set the number of base pairs (nbp) and test to make
certain it is a nonzero multiple of 10, again exiting with an error message if it is not. Finally the
∆linkingnumber(dlk) is set in line 24. The helical twist and circle radius are computed in lines
26 and 27 in accordance with the formulas developed above. Line 29 creates a transformation
matrix, matdx, that is used to move each base from the global origin along the X-axis to the
point where its center intersects the circle.
The circular DNA is built in the molecule variable m, which is initialized and given two
strands, "A" and "B" in lines 30-32. The variable ttw in line 34 holds the total twist applied to
each base pair The molecule is created in the loop from lines 35-66. The base pair number (b)
is converted to the appropriate strings specifying the two nucleotides in this pair. This is done
by the function getbase(). This source of this function must be provided by the user who is
creating the circles as only he or she will know the actual DNA sequence of the circle. Once
the two bases are specified they are passed to the nab builtin wc_helix() which returns a single
base pair in the XY plane with its center at the origin. The helical axis of this base pair is on
the Z-axis with the 5’-3’ direction oriented in the positive Z-direction.
One or three transformations is required to position this base in its correct place in the circle.
It must be rotated about the Z-axis (its helical axis) so that it is one additional unit of twist
beyond the previous base. This twist is done in lines 43-46. Since the first base needs 0o twist,
this step is skipped for it. In line 48, the base pair is moved in the positive direction along the
X-axis to place the base pair’s origin on the circle. Finally, the base pair is rotated about the
Y-axis in lines 50-54 to bring it to its proper position on the circle. Again, since this rotation is
0o for base 1, this step is also skipped for the first base.
In lines 56-57, the newly positioned base pair in m1 is added to the growing molecule in m.
Note that since the two strands of DNA are antiparallel, the "sense" strand of m1 is added after
the last base of the "A" strand of m and the "anti" strand of m1 is added before the first base
of the "B" strand of m. For all but the first base, the newly added residues are bonded to the
residues they follow (or precede). This is done by the two calls to connectres() in lines 59-60.
Again, due to the antiparallel nature of DNA, the new residue in the "A" strand is residue b, but
is residue 1 in the "B" strand. In line 63-65, the total twist (ttw) is updated and adjusted to keep
in in the range [0,360). After all base pairs have been added the loop exits.

316
15.3 Building Larger Structures

After the loop exit, since this is a closed circular molecule the first and last bases of each
strand must be bonded and this is done with the two calls to connectres() in lines 67-68. The
last step is to save the molecule’s coordinates and connectivity in lines 71-72. The nab builtin
putpdb() writes the coordinate information in PDB format to the file "[Link]" and the nab
builtin putbnd() saves the bonding as pairs of integers, one pair/line in the file "[Link]", where
each integer in a pair refers to an ATOM record in the previously written PDB file.

15.3.2 Nucleosome Model


While the DNA duplex is locally rather stiff, many DNA molecules are sufficiently long that
they can be bent into a wide variety of both open and closed curves. Some examples would be
simple closed circles, supercoiled closed circles that have relaxed into circles with twists, and
the nucleosome core fragment, where the duplex itself is wound into a short helix.
The overall strategy for wrapping DNA around a curve is to create the curve, find the points
on the curve that contain the base pair origins, place the base pairs at these points, oriented so
that their helical axes are tangent to the curve, and finally rotate the base pairs so that they have
the correct helical twist. In the example below, the simplifying assumption is made that the rise
is constant at 3.38 Å.
The nucleosome core fragment is composed of duplex DNA wound in a left handed helix
around a central protein core. A typical core fragment has about 145 base pairs of duplex DNA
forming about 1.75 superhelical turns. Measurements of the overall dimensions of the core
fragment indicate that there is very little space between adjacent wraps of the duplex. A side
view of a schematic of core particle is shown below.

110 A

60 A

θ ≈ 5°

Computing the points at which to place the base pairs on a helix requires us to spiral an
inelastic wire (representing the helical axis of the bent duplex) around a cylinder (representing
the protein core). The system is described by four numbers of which only three are independent.
They are the number of base pairs n, the number of turns its makes around the protein core t,
the “winding” angle θ (which controls how quickly the the helix advances along the axis of the
core) and the helix radius r. Both the the number of base pairs and the number of turns around
the core can be measured. The leaves two choices for the third parameter. Since the relationship
of the winding angle to the overall particle geometry seems more clear than that of the radius,
this code lets the user specify the number of turns, the number of base pairs and the winding
angle, then computes the helical radius and the displacement along the helix axis for each base
pair:

317
15 NAB: Sample programs

d = 3.38 sin(θ ); φ = 360t/(n − 1) (15.1)

3.38(n − 1) cos(θ )
r= (15.2)
2πt
where d and φ are the displacement along and rotation about the protein core axis for each base
pair.
These relationships are easily derived. Let the nucleosome core particle be oriented so that
its helical axis is along the global Y-axis and the lower cap of the protein core is in the XZ
plane. Consider the circle that is the projection of the helical axis of the DNA duplex onto the
XZ plane. As the duplex spirals along the core particle it will go around the circle t times, for a
total rotation of 360to. The duplex contains (n − 1) steps, resulting in 360t/(n − 1)o of rotation
between successive base pairs.
 
1 // Program 10. Create simple nucleosome model.
2 #define PI 3.141593
3 #define RISE 3.38
4 #define TWIST 36.0
5 int b, nbp; int getbase();
6 float nt, theta, phi, rad, dy, ttw, len, plen, side;
7 molecule m, m1;
8 matrix matdx, matrx, maty, matry, mattw;
9 string sbase, abase;
10

11 nt = atof( argv[ 2 ] ); // number of turns


12 nbp = atoi( argv[ 3 ] ); // number of base pairs
13 theta = atof( argv[ 4 ] ); // winding angle
14

15 dy = RISE * sin( theta );


16 phi = 360.0 * nt / ( nbp-1 );
17 rad = (( nbp-1 )*RISE*cos( theta ))/( 2*PI*nt );
18

19 matdx = newtransform( rad, 0.0, 0.0, 0.0, 0.0, 0.0 );


20 matrx = newtransform( 0.0, 0.0, 0.0, -theta, 0.0, 0.0 );
21

22 m = newmolecule();
23 addstrand( m, "A" ); addstrand( m, "B" );
24 ttw = 0.0;
25 for( b = 1; b <= nbp; b = b + 1 ){
26 getbase( b, sbase, abase );
27 m1 = wc_helix( sbase, "", "dna", abase, "", "dna",
28 2.25, -4.96, 0.0, 0.0 );
29 mattw = newtransform( 0., 0., 0., 0., 0., ttw );
30 transformmol( mattw, m1, NULL );
31 transformmol( matrx, m1, NULL );
32 transformmol( matdx, m1, NULL );
33 maty = newtransform( 0.,dy*(b-1),0., 0.,-phi*(b-1),0.);
34 transformmol( maty, m1, NULL );

318
15.3 Building Larger Structures

35

36 mergestr( m, "A", "last", m1, "sense", "first" );


37 mergestr( m, "B", "first", m1, "anti", "last" );
38 if( b > 1 ){
39 connectres( m, "A", b - 1, "O3’", b, "P" );
40 connectres( m, "B", 1, "O3’", 2, "P" );
41 }
42 ttw += TWIST; if( ttw >= 360.0 ) ttw -= 360.0;
43 }
44 putpdb( "[Link]", m );
 
Finding the radius of the superhelix is a little tricky. In general a single turn of the helix will
not contain an integral number of base pairs. For example, using typical numbers of 1.75 turns
and 145 base pairs requires 82.9 base pairs to make one turn. An approximate solution can be
found by considering the ideal superhelix that the DNA duplex is wrapped around. Let L be
the arc length of this helix. Then L cos(θ ) is the arc length of its projection into the XZ plane.
Since this projection is an overwound circle, L is also equal to 2πrt, where t is the number
of turns and r is the unknown radius. Now L is not known but is approximately 3.38(n − 1).
Substituting and solving for rgives Eq. 15.2.
The resulting nab code is shown in Program 2. This code requires three arguments—the
number of turns, the number of base pairs and the winding angle. In lines 15-17, the helical rise
(dy), twist (phi) and radius (rad) are computed according to the formulas developed above.
Two constant transformation matrices, matdx and matrx are created in lines 19-20. matdx
is used to move the newly created base pair along the X-axis to the circle that is the helix’s
projection onto the XZ plane. matrx is used to rotate the new base pair about the X-axis so it
will be tangent to the local helix of spirally wound duplex. The model of the nucleosome will
be built in the molecule m which is created and given two strands "A" and "B" in line 23. The
variable ttw will hold the total local helical twist for each base pair.
The molecule is created in the loop in lines 25-43. The user specified function getbase()
takes the number of the current base pair (b) and returns two strings that specify the actual
nucleotides to use at this position. These two strings are converted into a single base pair using
the nab builtin wc_helix(). The new base pair is in the XY plane with its origin at the global
origin and its helical axis along Z oriented so that the 5’-3’ direction is positive.
Each base pair must be rotated about its Z-axis so that when it is added to the global helix
it has the correct amount of helical twist with respect to the previous base. This rotation is
performed in lines 29-30. Once the base pair has the correct helical twist it must rotated about
the X-axis so that its local origin will be tangent to the global helical axes (line 31).
The properly-oriented base is next moved into place on the global helix in two stages in lines
32-34. It is first moved along the X-axis (line 32) so it intersects the circle in the XZ plane that
is projection of the duplex’s helical axis. Then it is simultaneously rotated about and displaced
along the global Y-axis to move it to final place in the nucleosome. Since both these movements
are with respect to the same axis, they can be combined into a single transformation.
The newly positioned base pair in m1 is added to the growing molecule in m using two calls
to the nab builtin mergestr(). Note that since the two strands of a DNA duplex are antiparallel,
the base of the "sense" strand of molecule m1 is added after the last base of the "A" strand of
molecule m and the base of the "anti" strand of molecule m1 is before the first base of the "B"

319
15 NAB: Sample programs

strand of molecule m. For all base pairs except the first one, the new base pair must be bonded
to its predecessor. Finally, the total twist (ttw) is updated and adjusted to remain in the interval
[0,360) in line 42. After all base pairs have been created, the loop exits, and the molecule is
written out. The coordinates are saved in PDB format using the nab builtin putpdb().

15.4 Wrapping DNA Around a Path


This last code develops two nab programs that are used together to wrap B-DNA around a
more general open curve specified as a cubic spline through a set of points. The first program
takes the initial set of points defining the curve and interpolates them to produce a new set of
points with one point at the location of each base pair. The new set of points always includes
the first point of the original set but may or may not include the last point. These new points are
read by the second program which actually bends the DNA.
The overall strategy used in this example is slightly different from the one used in both the
circular DNA and nucleosome codes. In those codes it was possible to directly compute both
the orientation and position of each base pair. This is not possible in this case. Here only the
location of the base pair’s origin can be computed directly. When the base pair is placed at that
point its helical axis will be tangent to the curve and point in the right direction, but its rotation
about this axis will be arbitrary. It will have to be rotated about its new helical axis to give the
proper amount of helical twist to stack it properly on the previous base. Now if the helical twist
of a base pair is determined with respect to the previous base pair, either the first base pair is left
in an arbitrary orientation, or some other way must be devised to define the helical of it. Since
this orientation will depend both on the curve and its ultimate use, this code leaves this task to
the user with the result that the helical orientation of the first base pair is undefined.

15.4.1 Interpolating the Curve


This section describes the code that finds the base pair origins along the curve. This program
takes an ordered set of points

p 1 ,p 2 ,...,pn

and interpolates it to produce a new set of points

np 1 ,np 2 ,...,np m

such that the distance between each npi and npi+1 is constant, in this case equal to 3.38
which is the rise of an ideal B-DNA duplex. The interpolation begins by setting np1 to p1
and continues through the pi until a new point npm has been found that is within the constant
distance to pn without having gone beyond it.
The interpolation is done via spline() [45] and splint(), two routines that perform a cubic
spline interpolation on a tabulated function

yi = f (xi )

320
15.4 Wrapping DNA Around a Path

In order for spline()/splint() to work on this problem, two things must be done. These functions
work on a table of (xi , yi ) pairs, of which we have only the yi . However, since the only require-
ment imposed on the xi is that they be monotonically increasing we can simply use the sequence
1 , 2 , ... , n for the xi , producing the producing the table (i, yi ). The second difficulty is that
spline()/splint() interpolate along a one dimensional curve but we need an interpolation along a
three dimensional curve. This is solved by creating three different splines, one for each of the
three dimensions.
spline()/splint() perform the interpolation in two steps. The function spline() is called first with
the original table and computes the value of the second derivative at each point. In order to do
this, the values of the second derivative at two points must be specified. In this code these points
are the first and last points of the table, and the values chosen are 0 (signified by the unlikely
value of 1e30 in the calls to spline()). After the second derivatives have been computed, the
interpolated values are computed using one or more calls to splint().
What is unusual about this interpolation is that the points at which the interpolation is to be
performed are unknown. Instead, these points are chosen so that the distance between each
point and its successor is the constant value RISE, set here to 3.38 which is the rise of an ideal
B-DNA duplex. Thus, we have to search for the points and most of the code is devoted to doing
this search. The details follow the listing.
 
1 // Program 11 - Build DNA along a curve
2 #define RISE 3.38
3

4 #define EPS 1e-3


5 #define APPROX(a,b) (fabs((a)-(b))<=EPS)
6 #define MAXI 20
7

8 #define MAXPTS 150


9 int npts;
10 float a[ MAXPTS ];
11 float x[ MAXPTS ], y[ MAXPTS ], z[ MAXPTS ];
12 float x2[ MAXPTS ], y2[ MAXPTS ], z2[ MAXPTS ];
13 float tmp[ MAXPTS ];
14

15 string line;
16

17 int i, li, ni;


18 float dx, dy, dz;
19 float la, lx, ly, lz, na, nx, ny, nz;
20 float d, tfrac, frac;
21

22 int spline();
23 int splint();
24

25 for( npts = 0; line = getline( stdin ); ){


26 npts = npts + 1;
27 a[ npts ] = npts;
28 sscanf( line, "%lf %lf %lf",
29 x[ npts ], y[ npts ], z[ npts ] );

321
15 NAB: Sample programs

30 }
31

32 spline( a, x, npts, 1e30, 1e30, x2, tmp );


33 spline( a, y, npts, 1e30, 1e30, y2, tmp );
34 spline( a, z, npts, 1e30, 1e30, z2, tmp );
35

36 li = 1; la = 1.0; lx = x[1]; ly = y[1]; lz = z[1];


37 printf( "%8.3f %8.3f %8.3f\\n", lx, ly, lz );
38

39 while( li < npts ){


40 ni = li + 1;
41 na = a[ ni ];
42 nx = x[ ni ]; ny = y[ ni ]; nz = z[ ni ];
43 dx = nx - lx; dy = ny - ly; dz = nz - lz;
44 d = sqrt( dx*dx + dy*dy + dz*dz );
45 if( d > RISE ){
46 tfrac = frac = .5;
47 for( i = 1; i <= MAXI; i = i + 1 ){
48 na = la + tfrac * ( a[ni] - la );
49 splint( a, x, x2, npts, na, nx );
50 splint( a, y, y2, npts, na, ny );
51 splint( a, z, z2, npts, na, nz );
52 dx = nx - lx; dy = ny - ly; dz = nz - lz;
53 d = sqrt( dx*dx + dy*dy + dz*dz );
54 frac = 0.5 * frac;
55 if( APPROX( d, RISE ) )
56 break;
57 else if( d > RISE )
58 tfrac = tfrac - frac;
59 else if( d < RISE )
60 tfrac = tfrac + frac;
61 }
62 printf( "%8.3f %8.3f %8.3f\\n", nx, ny, nz );
63 }else if( d < RISE ){
64 li = ni;
65 continue;
66 }else if( d == RISE ){
67 printf( "%8.3f %8.3f %8.3f\\n", nx, ny, nz );
68 li = ni;
69 }
70 la = na;
71 lx = nx; ly = ny; lz = nz;
72 }
 
Execution begins in line 25 where the points are read from stdin one point or three number-
s/line and stored in the three arrays x, y and z. The independent variable for each spline, stored
in the array a is created at this time holding the numbers 1 to npts. The second derivatives for
the three splines, one each for interpolation along the X, Y and Z directions are computed in
lines 32-34. Each call to spline() has two arguments set to 1e30 which indicates that the sec-

322
15.4 Wrapping DNA Around a Path

ond derivative values should be 0 at the first and last points of the table. The first point of the
interpolated set is set to the first point of the original set and written to stdout in lines 36-37.
The search that finds the new points is lines 39-72. To see how it works consider the figure
below. The dots marked p1 , p2 , . . . , pn correspond to the original points that define the spline.
The circles marked np1 , np2 , np3 represent the new points at which base pairs will be placed.
The curve is a function of the parameter a, which as it ranges from 1 to npts sweeps out the
curve from (x1 , y1 , z1 ) to (xnpts , ynpts , znpts ). Since the original points will in general not be the
correct distance apart we have to find new points by interpolating between the original points.
np3
p3 p3 p3
np2 np2
p2 pn p2 pn p2 pn
np1 np1 np1
p1 p1 p1

The search works by first finding a point of the original table that is at least RISE distance
from the last point found. If the last point of the original table is not far enough from the last
point found, the search loop exits and the program ends. However, if the search does find a
point in the original table that is at least RISE distance from the last point found, it starts an
interpolation loop in lines 47-61 to zero on the best value of a that will produce a new point that
is the correct distance from the previous point. After this point is found, the new point becomes
the last point and the loop is repeated until the original table is exhausted.
The main search loop uses li to hold the index of the point in the original table that is closest
to, but does not pass, the last point found. The loop begins its search for the next point by
assuming it will be before the next point in the original table (lines 40-42). It computes the
distance between this point (nx,ny,nz) and the last point (lx,ly,lz) in lines 43-44 and then takes
one of three actions depending it the distance is greater than RISE (lines 46-62), less than RISE
(lines 64-65) or equal to RISE (lines 67-68).
If this distance is greater than RISE, then the desired point is between the last point found
which is the point generated by la and the point corresponding to a[ni]. Lines 46-61 perform a
bisection of the interval (la,a[ni]], a process that splits this interval in half, determines which half
contains the desired point, then splits that half and continues in this fashion until the either the
distance between the last and new points is close enough as determined by the macro APPROX()
or MAXI subdivisions have been at made, in which case the new point is taken to be the point
computed after the last subdivision. After the bisection the new point is written to stdout (line
62) and execution skips to line 70-71 where the new values na and (nx,ny,nz) become the last
values la and (lx,ly,lz) and then back to the top of the loop to continue the interpolation. The
macro APPROX() defined in line 4, tests to see if the absolute value of the difference between
the current distance and RISE is less than EPS, defined in line 3 as 10−3 . This more complicated
test is used instead of simply testing for equality because floating point arithmetic is inexact,
which means that while it will get close to the target distance, it may never actually reach it.
If the distance between the last and candidate points is less than RISE, the desired point lies
beyond the point at a[ni]. In this case the action is lines 64-65 is performed which advances the
candidate point to li+2 then goes back to the top of the loop (line 38) and tests to see that this
index is still in the table and if so, repeats the entire process using the point corresponding to
a[li+2]. If the points are close together, this step may be taken more than once to look for the

323
15 NAB: Sample programs

next candidate at a[li+2], a[li+3], etc. Eventually, it will find a point that is RISE beyond the last
point at which case it interpolates or it runs out points, indicating that the next point lies beyond
the last point in the table. If this happens, the last point found, becomes the last point of the
new set and the process ends.
The last case is if the distance between the last point found and the point at a[ni] is exactly
equal to RISE. If it is, the point at a[ni] becomes the new point and li is updated to ni. (lines
67-68). Then lines 70-71 are executed to update la and (lx,ly,lz) and then back to the top of the
loop to continue the process.

15.4.2 Driver Code


This section describes the main routine or driver of the second program which is the actual
DNA bender. This routine reads in the points, then calls putdna() (described in the next section)
to place base pairs at each point. The points are either read from stdin or from the file whose
name is the second command line argument. The source of the points is determined in lines
8-18, being stdin if the command line contained a single arguments or in the second argument if
it was present. If the argument count was greater than two, the program prints an error message
and exits. The points are read in the loop in lines 20-26. Any line with a # in column 1 is
a comment and is ignored. All other lines are assumed to contain three numbers which are
extracted from the string, line and stored in the point array pts by the nab builtin sscanf() (lines
23-24). The number of points is kept in npts. Once all points have been read, the loop exits and
the point file is closed if it is not stdin. Finally, the points are passed to the function putdna()
which will place a base pair at each point and save the coordinates and connectivity of the
resulting molecule in the pair of files [Link] and [Link].
 
1 // Program 12 - DNA bender main program
2 string line;
3 file pf;
4 int npts;
5 point pts[ 5000 ];
6 int putdna();
7

8 if( argc == 1 )
9 pf = stdin;
10 else if( argc > 2 ){
11 fprintf( stderr, "usage: %s [ path-file ]\\n",
12 argv[ 1 ], argv[ 2 ] );
13 exit( 1 );
14 }else if( !( pf = fopen( argv[ 2 ], "r" ) ) ){
15 fprintf( stderr, "%s: can’t open %s\\n",
16 argv[ 1 ], argv[ 2 ] );
17 exit( 1 );
18 }
19

20 for( npts = 0; line = getline( pf ); ){


21 if( substr( line, 1, 1 ) != "#" ){
22 npts = npts + 1;

324
15.4 Wrapping DNA Around a Path

23 sscanf( line, "%lf %lf %lf",


24 pts[ npts ].x, pts[ npts ].y, pts[ npts ].z );
25 }
26 }
27

28 if( pf != stdin )
29 fclose( pf );
30

31 putdna( "[Link]", pts, npts );


 

15.4.3 Wrap DNA


Every nab molecule contains a frame, a movable handle that can be used to position the
molecule. A frame consists of three orthogonal unit vectors and an origin that can be placed in
an arbitrary position and orientation with respect to its associated molecule. When the molecule
is created its frame is initialized to the unit vectors along the global X, Y and Z axes with the
origin at (0,0,0).
nab provides three operations on frames. They can be defined by atom expressions or abso-
lute points (setframe() and setframep()), one frame can be aligned or superimposed on another
(alignframe()) and a frame can be placed at a point on an axis (axis2frame()). A frame is defined
by specifying its origin, two points that define its X direction and two points that define its Y
direction. The Z direction is X×Y. Since it is convenient to not require the original X and Y be
orthogonal, both frame creation builtins allow the user to specify which of the original X or Y
directions is to be the true X or Y direction. If X is chosen then Y is recreated from Z×X; if Y
is chosen then X is recreated from Y×Z.
When the frame of one molecule is aligned on the frame of another, the frame of the first
molecule is transformed to superimpose it on the frame of the second. At the same time the
coordinates of the first molecule are also transformed to maintain their original position and
orientation with respect to their own frame. In this way frames provide a way to precisely
position one molecule with respect to another. The frame of a molecule can also be positioned
on an axis defined by two points. This is done by placing the frame’s origin at the first point of
the axis and aligning the frame’s Z-axis to point from the first point of the axis to the second.
After this is done, the orientation of the frame’s X and Y vectors about this axis is undefined.
Frames have two other properties that need to be discussed. Although the builtin align-
frame() is normally used to position two molecules by superimposing their frames, if the second
molecule (represented by the second argument to alignframe()) has the special value NULL, the
first molecule is positioned so that its frame is superimposed on the global X, Y and Z axes with
its origin at (0,0,0). The second property is that when nab applies a transformation to a molecule
(or just a subset of its atoms), only the atomic coordinates are transformed. The frame’s origin
and its orthogonal unit vectors remain untouched. While this may at first glance seem odd, it
makes possible the following three stage process of setting the molecule’s frame, aligning that
frame on the global frame, then transforming the molecule with respect to the global axes and
origin which provides a convenient way to position and orient a molecule’s frame at arbitrary
points in space. With all this in mind, here is the source to putdna() which bends a B-DNA
duplex about an open space curve.

325
15 NAB: Sample programs

 
1 // Program 13 - place base pairs on a curve.
2 point s_ax[ 4 ];
3 int getbase();
4

5 int putdna( string mname, point pts[ 1 ], int npts )


6 {
7 int p;
8 float tw;
9 residue r;
10 molecule m, m_path, m_ax, m_bp;
11 point p1, p2, p3, p4;
12 string sbase, abase;
13 string aex;
14 matrix mat;
15

16 m_ax = newmolecule();
17 addstrand( m_ax, "A" );
18 r = getresidue( "AXS", "[Link]" );
19 addresidue( m_ax, "A", r );
20 setxyz_from_mol( m_ax, NULL, s_ax );
21

22 m_path = newmolecule();
23 addstrand( m_path, "A" );
24

25 m = newmolecule();
26 addstrand( m, "A" );
27 addstrand( m, "B" );
28

29 for( p = 1; p < npts; p = p + 1 ){


30 setmol_from_xyz( m_ax, NULL, s_ax );
31 setframe( 1, m_ax,
32 "::ORG", "::ORG", "::SXT", "::ORG", "::CYT" );
33 axis2frame( m_path, pts[ p ], pts[ p + 1 ] );
34 alignframe( m_ax, m_path );
35 mergestr( m_path, "A", "last", m_ax, "A", "first" );
36 if( p > 1 ){
37 setpoint( m_path, sprintf( "A:%d:CYT",p-1 ), p1 );
38 setpoint( m_path, sprintf( "A:%d:ORG",p-1 ), p2 );
39 setpoint( m_path, sprintf( "A:%d:ORG",p ), p3 );
40 setpoint( m_path, sprintf( "A:%d:CYT",p ), p4 );
41 tw = 36.0 - torsionp( p1, p2, p3, p4 );
42 mat = rot4p( p2, p3, tw );
43 aex = sprintf( ":%d:", p );
44 transformmol( mat, m_path, aex );
45 setpoint( m_path, sprintf( "A:%d:ORG",p ), p1 );
46 setpoint( m_path, sprintf( "A:%d:SXT",p ), p2 );
47 setpoint( m_path, sprintf( "A:%d:CYT",p ), p3 );
48 setframep( 1, m_path, p1, p1, p2, p1, p3 );

326
15.4 Wrapping DNA Around a Path

49 }
50

51 getbase( p, sbase, abase );


52 m_bp = wc_helix( sbase, "", "dna",
53 abase, "", "dna",
54 2.25, -5.0, 0.0, 0.0 );
55 alignframe( m_bp, m_path );
56 mergestr( m, "A", "last", m_bp, "sense", "first" );
57 mergestr( m, "B", "first", m_bp, "anti", "last" );
58 if( p > 1 ){
59 connectres( m, "A", p - 1, "O3’", p, "P" );
60 connectres( m, "B", 1, "P", 1, "O3’" );
61 }
62 }
63

64 putpdb( mname + ".pdb", m );


65 putbnd( mname + ".bnd", m );
66 };
 
putdna() takes three arguments—name, a string that will be used to name the PDB and bond
files that hold the bent duplex, pts an array of points containing the origin of each base pair
and npts the number of points in the array. putdna() uses four molecules. m_ax holds a small
artificial molecule containing four atoms that is a proxy for the some of the frame’s used placing
the base pairs. The molecule m_path will eventually hold one copy of m_ax for each point in
the input array. The molecule m_bp holds each base pair after it is created by wc_helix() and m
will eventually hold the bent dna. Once again the function getbase() (to be defined by the user)
provides the mapping between the current point (p) and the nucleotides required in the base pair
at that point.
Execution of putdna() begins in line 16 with the creation of m_ax. This molecule is given
one strand "A", into which is added one copy of the special residue AXS from the standard nab
residue library "[Link]" (lines 17-19). This residue contains four atoms named ORG, SXT,
CYT and NZT. These atoms are placed so that ORG is at (0,0,0) and SXT, CYT and NZT are 1o
along the X, Y and Z axes respectively. Thus the residue AXS has the exact geometry as the
molecules initial frame—three unit vectors along the standard axes centered on the origin. The
initial coordinates of m_ax are saved in the point array s_ax. The molecules m_path and m are
created in lines 22-23 and 25-27 respectively.
The actual DNA bending occurs in the loop in lines 29-62. Each base pair is added in a two
stage process that uses m_ax to properly orient the frame of m_path, so that when the frame of
new the base pair in m_bp is aligned on the frame of m_path, the new base pair will be correctly
positioned on the curve.
Setting up the frame is done is lines 30-49. The process begins by restoring the original
coordinates of m_ax (line 30), so that the the atom ORG is at (0,0,0) and SXT, CYT and NZT are
each 1o along the global X, Y and Z axes. These atoms are then used to redefine the frame of
m_ax (line 32-33) so that it is equal to the three standard unit vectors at the global origin. Next
the frame of m_path is aligned so that its origin is at pts[p] and its Z-axis points from pts[p] to
pts[p+1] (line 34). The call to alignframe() in line 34 transforms m_ax to align its frame on the
frame of m_path, which has the effect of moving m_ax so that the atom ORG is at pts[p] and

327
15 NAB: Sample programs

the ORG—NZT vector points towards pts[p+1]. A copy of the newly positioned m_ax is merged
into m_path in line 35. The result of this process is that each time around the loop, m_path gets
a new residue that resembles a coordinate frame located at the point the new base pair is to be
added.
When nab sets a frame from an axis, the orientation of its X and Y vectors is arbitrary. While
this does not matter for the first base pair for which any orientation is acceptable, it does matter
for the second and subsequent base pairs which must be rotated about their Z axis so that they
have the proper helical twist with respect to the previous base pair. This rotation is done by the
code in lines 37-48. It does this by considering the torsion angle formed by the fours atoms—
CYT and ORG of the previous AXS residue and ORG and CYT of the current AXS residue. The
coordinates of these points are determined in lines 37-40. Since this torsion angle is a marker
for the helical twist between pairs of the bent duplex, it must be 36.0o. The amount of rotation
required to give it the correct twist is computed in line 41. A transformation matrix that will
rotate the new AXS residue about the ORG—ORG axis by this amount is created in line 42,
the atom expression that names the AXS residue is created in line 43 and the residue rotated in
line 44. Once the new residue is given the correct twist the frame m_path is moved to the new
residue in lines 45-48.
The base pair is added in lines 51-60. The user defined function getbase() converts the point
number (p) into the names of the nucleotides needed for this base pair which is created by the
nab builtin wc_helix(). It is then placed on the curve in the correct orientation by aligning its
frame on the frame of m_path that we have just created (line 55). The new pair is merged into
m and bonded with the previous base pair if it exists. After the loop exits, the bend DNA duplex
coordinates are saved as a PDB file and the connectivity as a bnd file in the calls to putpdb() and
putbnd() in lines 64-65, whereupon putdna() returns to the caller.

15.5 Other examples


There are several additional pedagogical (and useful!) examples in $AMBERHOME/exam-
ples. These can be consulted to gain ideas of how some useful molecular manipulation programs
can be constructed.

• The peptides example was created by Paul Beroza to construct peptides with given back-
bone torsion angles. The idea is to call linkprot to create a peptide in an extended con-
formation, then to set frames and do rotations to construct the proper torsions. This can
be used as just a stand-alone program to perform this task, or as a source for ideas for
constructing similar functionality in other nab programs.

• The suppose example was created by Jarrod Smith to provide a driver to carry out rms-
superpositions. It has a man page that shows how to use it.

328
Bibliography
[1] Pettersen, E.F.; Goddard, T.D.; Huang, C.C.; Couch, G.S.; Greenblatt, D.M.; Meng,
E.C.; Ferrin, T.E. UCSF Chimera - A visualization system for exploratory research and
analysis. J. Comput. Chem., 2004, 25, 1605–1612.

[2] Geney, R.; Layten, M.; Gomperts, R.; Simmerling, C. Investigation of salt bridge stabil-
ity in a generalized Born solvent model. J. Chem. Theory Comput., 2006, 2, 115–127.

[3] Okur, A.; Wickstrom, L.; Simmerling, C. Evaluation of salt bridge structure and ener-
getics in peptides using explicit, implicit and hybrid solvation models. J. Chem. Theory
Comput., 2008, 4, 488–498.

[4] Okur, A.; Wickstrom, L.; Layten, M.; Geney, R.; Song, K.; Hornak, V.; Simmerling, C.
Improved efficiency of replica exchange simulations through use of a hybrid explicit/im-
plicit solvation model. J. Chem. Theory Comput., 2006, 2, 420–433.

[5] Roe, D.R.; Okur, A.; Wickstrom, L.; Hornak, V.; Simmerling, C. Secondary Structure
Bias in Generalized Born Solvent Models: Comparison of Conformational Ensembles
and Free Energy of Solvent Polarization from Explicit and Implicit Solvation. J. Phys.
Chem. B, 2007, 111, 1846–1857.

[6] Ren, P.; Ponder, J.W. Consistent treatment of inter- and intramolecular polarization in
molecular mechanics calculations. J. Comput. Chem., 2002, 23, 1497–1506.

[7] Ren, P.Y.; Ponder, J.W. Polarizable atomic multipole water model for molecular me-
chanics simulation. J. Phys. Chem. B, 2003, 107, 5933–5947.

[8] Ren, P.; Ponder, J.W. Temperature and pressure dependence of the AMOEBA water
model. J. Phys. Chem. B, 2004, 108, 13427–13437.

[9] Ren, P.Y.; Ponder, J.W. Tinker polarizable atomic multipole force field for proteins. to
be published., 2006.

[10] Ponder, J.W.; Wu, C.; Ren, P.; Pande, V.S.; Chodera, J.D.; Schieders, M.J.; Haque, I.;
Mobley, D.L.; Lambrecht, D.S.; DiStasio, R.A. Jr.; Head-Gordon, M.; Clark, G.N.I.;
Johnson, M.E.; Head-Gordon, T. Current status of the AMOEBA polarizable force field.
J. Phys. Chem. B, 2010, 114, 2549–2564.

[11] Duan, Y.; Wu, C.; Chowdhury, S.; Lee, M.C.; Xiong, G.; Zhang, W.; Yang, R.; Cieplak,
P.; Luo, R.; Lee, T. A point-charge force field for molecular mechanics simulations of
proteins based on condensed-phase quantum mechanical calculations. J. Comput. Chem.,
2003, 24, 1999–2012.

329
BIBLIOGRAPHY

[12] Lee, M.C.; Duan, Y. Distinguish protein decoys by using a scoring function based on a
new Amber force field, short molecular dynamics simulations, and the generalized Born
solvent model. Proteins, 2004, 55, 620–634.

[13] Yang, L.; Tan, C.; Hsieh, M.-J.; Wang, J.; Duan, Y.; Cieplak, P.; Caldwell, J.; Kollman,
P.A.; Luo, R. New-generation Amber united-atom force field. J. Phys. Chem. B, 2006,
110, 13166–13176.

[14] Wang, J.; Cieplak, P.; Kollman, P.A. How well does a restrained electrostatic potential
(RESP) model perform in calculating conformational energies of organic and biological
molecules? J. Comput. Chem., 2000, 21, 1049–1074.

[15] Hornak, V.; Abel, R.; Okur, A.; Strockbine, B.; Roitberg, A.; Simmerling, C. Compar-
ison of multiple Amber force fields and development of improved. Proteins, 2006, 65,
712–725.

[16] García, A.E.; Sanbonmatsu, K.Y. α-helical stabilization by side chain shielding of back-
bone hydrogen bonds. Proc. Natl. Acad. Sci. USA, 2002, 99, 2782–2787.

[17] Sorin, E.J.; Pande, V.S. Exploring the helix-coil transition via all-atom equilibrium en-
semble simulations. Biophys. J., 2005, 88, 2472–2493.

[18] Perez, A.; Marchan, I.; Svozil, D.; Sponer, J.; Cheatham, T.E.; Laughton, C.A.; Orozco,
M. Refinement of the AMBER Force Field for Nucleic Acids: Improving the Description
of alpha/gamma Conformers. Biophys. J., 2007, 92, 3817–3829.

[19] Aduri, R.; Psciuk, B.T.; Saro, P.; Taniga, H.; Schlegel, H.B.; SantaLucia, J. Jr. AMBER
force field parameters for the naturally occurring modified nucleosides in RNA. J. Chem.
Theory Comput., 2007, 3, 1465–1475.

[20] Cieplak, P.; Cornell, W.D.; Bayly, C.; Kollman, P.A. Application of the multimolecule
and multiconformational RESP methodology to biopolymers: Charge derivation for
DNA, RNA and proteins. J. Comput. Chem., 1995, 16, 1357–1377.

[21] Cieplak, P.; Dupradeau, F.-Y.; Duan, Y.; Wang, J. Polarization effects in molecular
mechanical force fields. J. Phys.: Condens. Matter, 2009, 21, 333102.

[22] Cieplak, P.; Caldwell, J.; Kollman, P. Molecular mechanical models for organic and
biological systems going beyond the atom centered two body additive approximation:
Aqueous solution free energies of methanol and N-methyl acetamide, nucleic acid base,
and amide hydrogen bonding and chloroform/water partition coefficients of the nucleic
acid bases. J. Comput. Chem., 2001, 22, 1048–1057.

[23] Wang, Z.-X.; Zhang, W.; Wu, C.; Lei, H.; Cieplak, P.; Duan, Y. Strike a Balance:
Optimization of backbone torsion parameters of AMBER polarizable force field for sim-
ulations of proteins and peptides. J. Comput. Chem., 2006, 27, 781–790.

[24] Dixon, R.W.; Kollman, P.A. Advancing beyond the atom-centered model in additive and
nonadditive molecular mechanics. J. Comput. Chem., 1997, 18, 1632–1646.

330
BIBLIOGRAPHY

[25] Meng, E.; Cieplak, P.; Caldwell, J.W.; Kollman, P.A. Accurate solvation free energies
of acetate and methylammonium ions calculated with a polarizable water model. J. Am.
Chem. Soc., 1994, 116, 12061–12062.

[26] Wollacott, A.M.; Merz, K.M. Jr. Development of a parameterized force field to reproduce
semiempirical geometries. J. Chem. Theory Comput., 2006, 2, 1070–1077.

[27] Kirschner, K.N.; Yongye, A.B.; Tschampel, S.M.; González-Outeiriño, J.; Daniels, C.R.;
Foley, B.L.; Woods, R.J. GLYCAM06: A generalizable biomolecular force field. Carbo-
hydrates. J. Comput. Chem., 2008, 29, 622–655.

[28] Case, D.A.; Cheatham, T.; Darden, T.; Gohlke, H.; Luo, R.; Merz, K.M. Jr.; Onufriev, A.;
Simmerling, C.; Wang, B.; Woods, R. The Amber biomolecular simulation programs. J.
Computat. Chem., 2005, 26, 1668–1688.

[29] Kirschner, K.N.; Woods, R.J. Solvent interactions determine carbohydrate conformation.
Proc. Natl. Acad. Sci. USA, 2001, 98, 10541–10545.

[30] Woods, R.J. Restrained electrostatic potential charges for condensed phase simulations
of carbohydrates. J. Mol. Struct (Theochem), 2000, 527, 149–156.

[31] Woods, R.J. Derivation of net atomic charges from molecular electrstatic potentials. J.
Comput. Chem., 1990, 11, 29–310.

[32] Basma, M.; Sundara, S.; Calgan, D.; Venali, T.; Woods, R.J. Solvated ensemble averag-
ing in the calculation of partial atomic charges. J. Comput. Chem., 2001, 22, 1125–1137.

[33] Tschampel, S.M.; Kennerty, M.R.; Woods, R.J. TIP5P-consistent treatment of electro-
statics for biomolecular simulations. J. Chem. Theory Comput., 2007, 3, 1721–1733.

[34] DeMarco, M.L.; Woods, R.J. Bridging computational biology and glycobiology: A game
of snakes and ladders. Glycobiology, in press, 2008.

[35] Åqvist, J. Ion-water interaction potentials derived from free energy perturbation simula-
tions. J. Phys. Chem., 1990, 94, 8021–8024.

[36] Dang, L. Mechanism and thermodynamics of ion selectivity in aqueous solutions of 18-
crown-6 ether: A molecular dynamics study. J. Am. Chem. Soc., 1995, 117, 6954–6960.

[37] Auffinger, P.; Cheatham, T.E. III; Vaiana, A.C. Spontaneous formation of KCl aggregates
in biomolecular simulations: a force field issue? J. Chem. Theory Comput., 2007, 3,
1851–1859.

[38] Joung, S.; Cheatham, T.E. III. Determination of alkali and halide monovalent ion param-
eters for use in explicitly solvated biomolecular simulations. J. Chem. Phys. Bo, 2008,
112, 9020–9041.

[39] Jorgensen, W.L.; Chandrasekhar, J.; Madura, J.; Klein, M.L. Comparison of simple
potential functions for simulating liquid water. J. Chem. Phys., 1983, 79, 926–935.

331
BIBLIOGRAPHY

[40] Price, D.J.; Brooks, C.L. A modified TIP3P water potential for simulation with Ewald
summation. J. Chem. Phys., 2004, 121, 10096–10103.
[41] Jorgensen, W.L.; Madura, J.D. Temperature and size dependence for Monte Carlo simu-
lations of TIP4P water. Mol. Phys., 1985, 56, 1381–1392.
[42] Horn, H.W.; Swope, W.C.; Pitera, J.W.; Madura, J.D.; Dick, T.J.; Hura, G.L.; Head-
Gordon, T. Development of an improved four-site water model for biomolecular simula-
tions: TIP4P-Ew. J. Chem. Phys., 2004, 120, 9665–9678.
[43] Horn, H.W.; Swope, W.C.; Pitera, J.W. Characterization of the TIP4P-Ew water model:
Vapor pressure and boiling point. J. Chem. Phys., 2005, 123, 194504.
[44] Mahoney, M.W.; Jorgensen, W.L. A five-site model for liquid water and the reproduction
of the density anomaly by rigid, nonpolarizable potential functions. J. Chem. Phys., 2000,
112, 8910–8922.
[45] Caldwell, J.W.; Kollman, P.A. Structure and properties of neat liquids using nonadditive
molecular dynamics: Water, methanol and N-methylacetamide. J. Phys. Chem., 1995,
99, 6208–6219.
[46] Berendsen, H.J.C.; Grigera, J.R.; Straatsma, T.P. The missing term in effective pair
potentials. J. Phys. Chem., 1987, 91, 6269–6271.
[47] Wu, Y.; Tepper, H.L.; Voth, G.A. Flexible simple point-charge water model with im-
proved liquid-state properties. J. Chem. Phys., 2006, 124, 024503.
[48] Paesani, F.; Zhang, W.; Case, D.A.; Cheatham, T.E.; Voth, G.A. An accurate and simple
quantum model for liquid water. J. Chem. Phys., 2006, 125, 184507.
[49] Cornell, W.D.; Cieplak, P.; Bayly, C.I.; Gould, I.R.; Merz, K.M. Jr.; Ferguson, D.M.;
Spellmeyer, D.C.; Fox, T.; Caldwell, J.W.; Kollman, P.A. A second generation force
field for the simulation of proteins, nucleic acids, and organic molecules. J. Am. Chem.
Soc., 1995, 117, 5179–5197.
[50] Kollman, P.A.; Dixon, R.; Cornell, W.; Fox, T.; Chipot, C.; Pohorille, A. in Computer
Simulation of Biomolecular Systems, Vol. 3, Wilkinson, A.; Weiner, P.; van Gunsteren,
W.F., Eds., pp 83–96. Elsevier, 1997.
[51] Beachy, M.D.; Friesner, R.A. Accurate ab intio quantum chemical determination of the
relative energies of peptide conformations and assessment of empirical force fields. J.
Am. Chem. Soc., 1997, 119, 5908–5920.
[52] Wang, L.; Duan, Y.; Shortle, R.; Imperiali, B.; Kollman, P.A. Study of the stability and
unfolding mechanism of BBA1 by molecular dynamics simulations at different temper-
atures. Prot. Sci., 1999, 8, 1292–1304.
[53] Higo, J.; Ito, N.; Kuroda, M.; Ono, S.; Nakajima, N.; Nakamura, H. Energy landscape
of a peptide consisting of α-helix, 310 helix, β -turn, β -hairpin and other disordered
conformations. Prot. Sci., 2001, 10, 1160–1171.

332
BIBLIOGRAPHY

[54] Cheatham, T.E. III; Cieplak, P.; Kollman, P.A. A modified version of the Cornell et al.
force field with improved sugar pucker phases and helical repeat. J. Biomol. Struct. Dyn.,
1999, 16, 845–862.
[55] Weiner, S.J.; Kollman, P.A.; Case, D.A.; Singh, U.C.; Ghio, C.; Alagona, G.; Profeta,
S. Jr.; Weiner, P. A new force field for molecular mechanical simulation of nucleic acids
and proteins. J. Am. Chem. Soc., 1984, 106, 765–784.
[56] Weiner, S.J.; Kollman, P.A.; Nguyen, D.T.; Case, D.A. An all-atom force field for simu-
lations of proteins and nucleic acids. J. Comput. Chem., 1986, 7, 230–252.
[57] Singh, U.C.; Weiner, S.J.; Kollman, P.A. Molecular dynamics simulations of d(C-G-
C-G-A).d(T-C-G-C-G) with and without "hydrated" counterions. Proc. Nat. Acad. Sci.,
1985, 82, 755–759.
[58] Crowley, M.F.; Williamson, M.J.; Walker, R.C. CHAMBER: Comprehensive support for
CHARMM force fields within the AMBER software. Int. J. Quant. Chem., 2009, 109,
3767.
[59] MacKerell Jr., A.D.; Bashford, D.; Bellott, M.; Dunbrack, R.L.; Evanseck, J.D.; Field,
M.J.; Fischer, S.; Gao, J.; Guo, H.; Ha, S.; Joseph-McCarthy, D.; Kuchnir, L.; Kucz-
era, K.; Lau, F.T.K.; Mattos, C.; Michnick, S.; Ngo, T.; Nguyen, D.T.; Prodhom, B.;
Reiher, W.E.; Roux, B.; Schlenkrich, M.; Smith, J.C.; Stote, R.; Straub, J.; Watanabe,
M.; Wiorkiewicz-Kuczera, J.; Yin, D.; Karplus, M. All-Atom Empirical Potential for
Molecular Modeling and Dynamics Studies of Proteins. J. Phys. Chem. B, 1998, 102,
3586–3616.
[60] MacKerell Jr., A.D.; Banavali, N.; Foloppe, N. Development and current status of the
CHARMM force field for nucleic acids. Biopolymers, 2000, 56, 257–265.
[61] Brooks, B.R.; Bruccoleri, R.E.; Olafson, D.J.; States, D.J.; Swaminathan, S.; Karplus,
M. CHARMM: A Program for Macromolecular Energy, Minimization, and Dynamics
Calculations. J. Computat. Chem., 1983, 4, 187–217.
[62] Brooks, B. R.; Brooks, C. L.; Mackerell, A. D.; Nilsson, L.; Petrella, R. J.; Roux, B.;
Won, Y.; Archontis, G.; Bartels, C.; Boresch, S.; Caflisch, A.; Caves, L.; Cui, Q.; Dinner,
A. R.; Feig, M.; Fischer, S.; Gao, J.; Hodoscek, M.; Im, W.; Kuczera, K.; Lazaridis, T.;
Ma, J.; Ovchinnikov, V.; Paci, E.; Pastor, R. W.; Post, C. B.; Pu, J. Z.; Schaefer, M.;
Tidor, B.; Venable, R. M.; Woodcock, H. L.; Wu, X.; Yang, W.; York, D. M.; Karplus,
M. CHARMM: the biomolecular simulation program. J. Comput. Chem., 2009, 30,
1545–1614.
[63] MacKerell, A.D. Jr.; Feig, M.; Brooks III, C.L. Improved Treatment of the Protein
Backbone in Empirical Force Fields. J. Am. Chem. Soc., 2004, 126, 698–699.
[64] MacKerell, A.D. Jr.; Feig, M.; Brooks III, C.L. Extending the treatment of backbone
energetics in protein force fields: Limitations of gas-phase quantum mechanics in re-
producing protein conformational distributions in molecular dynamics simulations. J.
Computat. Chem., 2004, 25, 1400–1415.

333
BIBLIOGRAPHY

[65] Bondi, A. van der Waals volumes and radii. J. Phys. Chem., 1964, 68, 441–451.

[66] Tsui, V.; Case, D.A. Theory and applications of the generalized Born solvation model in
macromolecular simulations. Biopolymers (Nucl. Acid. Sci.), 2001, 56, 275–291.

[67] Onufriev, A.; Bashford, D.; Case, D.A. Exploring protein native states and large-scale
conformational changes with a modified generalized Born model. Proteins, 2004, 55,
383–394.

[68] Tsui, V.; Case, D.A. Molecular dynamics simulations of nucleic acids using a generalized
Born solvation model. J. Am. Chem. Soc., 2000, 122, 2489–2498.

[69] Wang, J.; Wolf, R.M.; Caldwell, J.W.; Kollamn, P.A.; Case, D.A. Development and
testing of a general Amber force field. J. Comput. Chem., 2004, 25, 1157–1174.

[70] Wang, B.; Merz, K.M. Jr. A fast QM/MM (quantum mechanical/molecular mechanical)
approach to calculate nuclear magnetic resonance chemical shifts for macromolecules.
J. Chem. Theory Comput., 2006, 2, 209–215.

[71] Jakalian, A.; Bush, B.L.; Jack, D.B.; Bayly, C.I. Fast, efficient generation of high-quality
atomic charges. AM1-BCC model: I. Method. J. Comput. Chem., 2000, 21, 132–146.

[72] Jakalian, A.; Jack, D.B.; Bayly, C.I. Fast, efficient generation of high-quality atomic
charges. AM1-BCC model: II. Parameterization and Validation. J. Comput. Chem., 2002,
23, 1623–1641.

[73] Wang, J.; Kollman, P.A. Automatic parameterization of force field by systematic search
and genetic algorithms. J. Comput. Chem., 2001, 22, 1219–1228.

[74] Graves, A.P.; Shivakumar, D.M.; Boyce, S.E.; Jacobson, M.P.; Case, D.A.; Shoichet,
B.K. Rescoring docking hit lists for model cavity sites: Predictions and experimental
testing. J. Mol. Biol., 2008, 377, 914–934.

[75] Jojart, B.; Martinek, T.A. Performance of the general amber force field in modeling
aqueous POPC membrane bilayers. J. Comput. Chem., 2007, 28, 2051–2058.

[76] Rosso, L.; Gould, I.R. Structure and dynamics of phospholipid bilayers using recently
developed general all-atom force fields. J. Comput. Chem., 2008, 29, 24–37.

[77] Stewart, J.J.P. Optimization of parameters for semiempirical methods I. Method. J.


Comput. Chem., 1989, 10, 209–220.

[78] Dewar, M.J.S.; Zoebisch, E.G.; Healy, E.F.; Stewart, J.J.P. AM1: A new general purpose
quantum mechanical molecular model. J. Am. Chem. Soc., 1985, 107, 3902–3909.

[79] Rocha, G.B.; Freire, R.O.; Simas, A.M.; Stewart, J.J.P. RM1: A Reparameterization of
AM1 for H, C, N, O, P, S, F, Cl, Br and I. J. Comp. Chem., 2006, 27, 1101–1111.

[80] Dewar, M.J.S.; Thiel, W. Ground states of molecules. 38. The MNDO method, approxi-
mations and parameters. J. Am. Chem. Soc., 1977, 99, 4899–4907.

334
BIBLIOGRAPHY

[81] Repasky, M.P.; Chandrasekhar, J.; Jorgensen, W.L. PDDG/PM3 and PDDG/MNDO:
Improved semiempirical methods. J. Comput. Chem., 2002, 23, 1601–1622.

[82] McNamara, J.P.; Muslim, A.M.; Abdel-Aal, H.; Wang, H.; Mohr, M.; Hillier, I.H.;
Bryce, R.A. Towards a quantum mechanical force field for carbohydrates: A reparame-
terized semiempirical MO approach. Chem. Phys. Lett., 2004, 394, 429–436.

[83] Seabra, G.M.; Walker, R.C.; Elstner, M.; Case, D.A.; Roitberg, A.E. Implementation of
the SCC-DFTB Method for Hybrid QM/MM Simulations within the Amber Molecular
Dynamics Package. J. Phys. Chem. A., 2007, 20, 5655–5664.

[84] Porezag, D.; Frauenheim, T.; Kohler, T.; Seifert, G.; Kaschner, R. Construction of tight-
binding-like potentials on the basis of density-functional-theory: Applications to carbon.
Phys. Rev. B, 1995, 51, 12947.

[85] Seifert, G.; Porezag, D.; Frauenheim, T. Calculations of molecules, clusters and solids
with a simplified LCAO-DFT-LDA scheme. Int. J. Quantum Chem., 1996, 58, 185.

[86] Elstner, M.; Porezag, D.; Jungnickel, G.; Elsner, J.; Haugk, M.; Frauenheim, T.; Suhai,
S.; Seifert, G. Self-consistent charge density functional tight-binding method for simu-
lation of complex material properties. Phys. Rev. B, 1998, 58, 7260.

[87] Elstner, M.; Hobza, P.; Frauenheim, T.; Suhai, S.; Kaxiras, E. Hydrogen bonding and
stacking interactions of nucleic acid base pairs: a density-functional-theory based treat-
ment. J. Chem. Phys., 2001, 114, 5149.

[88] Kalinowski, J.A.; Lesyng, B.; Thompson, J.D.; Cramer, C.J.; Truhlar, D.G. Class IV
charge model for the self-consistent charge density-functional tight-binding method. J.
Phys. Chem. A, 2004, 108, 2545–2549.

[89] Yang, Y.; Yu, H.; York, D.M.; Cui, Q.; Elstner, M. Extension of the self-consistent charge
density-functional tight-binding method: Third-order expansion of the density functional
theory total energy and introduction of a modified effective Coulomb interaction. J. Phys.
Chem. A, 2007, 111, 10861–10873.

[90] Walker, R.C.; Crowley, M.F.; Case, D.A. The implementation of a fast and efficient
hybrid QM/MM potential method within The Amber 9.0 sander module. J. Computat.
Chem., 2008, 29, 1019–1031.

[91] Pellegrini, E.; J. Field, M. A generalized-Born solvation model for macromolecular


hybrid-potential calculations. J. Phys. Chem. A., 2002, 106, 1316–1326.

[92] Kruger, T.; Elstner, M.; Schiffels, P.; Frauenheim, T. Validation of the density-functional
based tight-binding approximation. J. Chem. Phys., 2005, 122, 114110.

[93] Shao, J.; Tanner, S.W.; Thompson, N.; Cheatham, T.E. III. Clustering molecular dynam-
ics trajectories: 1. Characterizing the performance of different clustering algorithms. J.
Chem. Theory Comput., 2007, 3, 2312–2334.

335
BIBLIOGRAPHY

[94] Kabsch, W.; Sander, C. Dictionary of protein secondary structure: pattern recognition of
hydrogen-bonded and geometrical features. Biopolymers, 1983, 22, 2577–2637.
[95] Prompers, J.J.; Brüschweiler, R. General framework for studying the dynamics of folded
and nonfolded proteins by NMR relaxation spectroscopy and MD simulation. J. Am.
Chem. Soc., 2002, 124, 4522–4534.
[96] Prompers, J.J.; Brüschweiler, R. Dynamic and structural analysis of isotropically dis-
tributed molecular ensembles. Proteins, 2002, 46, 177–189.
[97] Luo, R.; David, L.; Gilson, M.K. Accelerated Poisson-Boltzmann calculations for static
and dynamic systems. J. Comput. Chem., 2002, 23, 1244–1253.
[98] Wang, J.; Luo, R. Assessment of Linear Finite-Difference Poisson-Boltzmann Solvers.
J. Comput. Chem., 2010, in press.
[99] Cai, Q.; Hsieh, M.-J.; Wang, J.; Luo, R. Performance of Nonlinear Finite-Difference
Poisson-Boltzmann Solvers. J. Chem. Theory Comput., 2010, in press.
[100] Honig, B.; Nicholls, A. Classical electrostatics in biology and chemistry. Science, 1995,
268, 1144–1149.
[101] Lu, Q.; Luo, R. A Poisson-Boltzmann dynamics method with nonperiodic boundary
condition. J. Chem. Phys., 2003, 119, 11035–11047.
[102] Gilson, M.K.; Sharp, K.A.; Honig, B.H. Calculating the electrostatic potential of
molecules in solution: method. J. Comput. Chem., 1988, 9, 327–35.
[103] Warwicker, J.; Watson, H.C. Calculation of the electric potential in the active site cleft
due to. J. Mol. Biol., 1982, 157, 671–679.
[104] Klapper, I.; Hagstrom, R.; Fine, R.; Sharp, K.; Honig, B. Focussing of electric fields in
the active stie of Cu, Zn superoxide dismutase. Proteins, 1986, 1, 47–59.
[105] Sitkoff, D.; Sharp, K.A.; Honig, B. Accurate calculation of hydration free energies using
macroscopic solvent models. J. Phys. Chem., 1994, 98, 1978–1988.
[106] Tan, C. H.; Tan, Y. H.; Luo, R. Implicit nonpolar solvent models. J. Phys. Chem. B,
2007, 111, 12263–12274.
[107] Gallicchio, E.; Kubo, M.M.; Levy, R.M. Enthalpy-entropy and cavity decomposition
of alkane hydration free energies: Numerical results and implications for theories of
hydrophobic solvation. J. Phys. Chem., 2000, 104, 6271–6285.
[108] Floris, F.; Tomasi, J. Evaluation of the dispersion contribution to the solvation energy. A
simple computational model in the continuum approximation. J. Comput. Chem., 1989,
10, 616–627.
[109] Davis, M.E.; McCammon, J.A. Solving the finite-difference linearized Poisson-
Boltzmann equation – a comparison of relaxation and conjugate gradient methods. J.
Comput. Chem., 1989, 10, 386–391.

336
BIBLIOGRAPHY

[110] Nicholls, A.; Honig, B. A rapid finite difference algorithm, utilizing successive over-
relaxation to solve the Poisson-Boltzmann equation. J. Comput. Chem., 1991, 12, 435–
445.

[111] Bashford, D. An object-oriented programming suite for electrostatic effects in biological


molecules. Lect. Notes Comput. Sci., 1997, 1343, 233–240.

[112] Luty, B.A.; Davis, M.E.; McCammon, J.A. Electrostatic energy calculations by a finite-
difference method: Rapid calculation of charge-solvent interaction energies. J. Comput.
Chem., 1992, 13, 768–771.

[113] Cai, Q.; Wang, J.; Zhao, H.; Luo, R. On removal of charge singularity in Poisson-
Boltzmann equation. J. Chem. Phys., 2009, 130, 145101.

[114] Davis, M.E.; McCammon, J.A. Dielectric boundary smoothing in finite difference so-
lutions of the Poisson equation: An approach to improve accuracy and convergence. J.
Comput. Chem., 1991, 12, 909–912.

[115] Davis, M.E.; McCammon, J.A. Electrostatics in biomolecular structure and dynamics.
Chem. Rev., 1990, 90, 509–521.

[116] Tan, C. H.; Yang, L. J.; Luo, R. How well does Poisson-Boltzmann implicit solvent agree
with explicit solvent? A quantitative analysis. J. Phys. Chem. B, 2006, 110, 18680–
18687.

[117] Gilson, M.K.; Davis, M.E; Luty, B.A.; McCammon, J.A. Computation of electrostatic
forces on solvated molecules using the Poisson-Boltzmann equation. J Phys Chem, 1993,
97(14), 3591–3600.

[118] Luchko, T.; Gusarov, S.; Roe, D. R.; Simmerling, C.; Case, D. A.; Tuszynski, J.; Ko-
valenko, A. Three-dimensional molecular theory of solvation coupled with molecular
dynamics in Amber. J. Chem. Theory Comput., 2010, 6, 607–624.

[119] Chandler, D.; Andersen, H. C. Optimized cluster expansions for classical fluids. ii. theory
of molecular liquids. J. Chem. Phys., 1972, 57(5), 1930–1937.

[120] Hirata, F.; Rossky, P. J. An extended RISM equation for molecular polar fluids. Chem.
Phys. Lett., 1981, pp 329–334.

[121] Hirata, F.; Pettitt, B. M.; Rossky, P. J. Application of an extended rism equation to dipolar
and quadrupolar fluids. J. Chem. Phys., 1982, 77(1), 509–520.

[122] Hirata, F.; Rossky, P. J.; Pettitt, B. M. The interionic potential of mean force in a molec-
ular polar solvent from an extended rism equation. J. Chem. Phys., 1983, 78(6), 4133–
4144.

[123] Chandler, D.; McCoy, J.; Singer, S. Density functional theory of nonuniform polyatomic
systems. i. general formulation. J. Chem. Phys., 1986, 85(10), 5971–5976.

337
BIBLIOGRAPHY

[124] Chandler, D.; McCoy, J.; Singer, S. Density functional theory of nonuniform polyatomic
systems. ii. rational closures for integral equations. J. Chem. Phys., 1986, 85(10), 5977–
5982.

[125] Beglov, D.; Roux, B. Numerical solution of the hypernetted chain equation for a solute
of arbitrary geometry in three dimensions. J. Chem. Phys., 1995, 103(1), 360–364.

[126] Beglov, D.; Roux, B. An integral equation to describe the solvation of polar molecules
in liquid water. J. Phys. Chem. B, 1997, 101(39), 7821–7826.

[127] Kovalenko, A.; Hirata, F. Three-dimensional density profiles of water in contact with a
solute of arbitrary shape: a RISM approach. Chem. Phys. Lett., 1998, 290(1-3), 237–244.

[128] Kovalenko, A.; Hirata, F. Self-consistent description of a metal–water interface by the


Kohn–Sham density functional theory and the three-dimensional reference interaction
site model. J. Chem. Phys., 1999, 110(20), 10095–10112.

[129] Kovalenko, A. In Hirata [188], chapter 4.

[130] Kovalenko, A.; Hirata, F. Potentials of mean force of simple ions in ambient aqueous
solution. i: Three-dimensional reference interaction site model approach. J. Chem. Phys.,
2000, 112, 10391–10402.

[131] Kovalenko, A.; Hirata, F. Potentials of mean force of simple ions in ambient aqueous so-
lution. ii: Solvation structure from the three-dimensional reference interaction site model
approach, and comparison with simulations. J. Chem. Phys., 2000, 112, 10403–10417.

[132] Hansen, J.-P.; McDonald, I. R. Theory of simple liquids. Academic Press, London, 1990.

[133] Hirata, F. In Molecular Theory of Solvation [188], chapter 1.

[134] Perkyns, J. S.; Pettitt, B. M. A site-site theory for finite concentration saline solutions. J.
Chem. Phys., 1992, 97(10), 7656–7666.

[135] Kovalenko, A.; Ten-No, S.; Hirata, F. Solution of three-dimensional reference interaction
site model and hypernetted chain equations for simple point charge water by modified
method of direct inversion in iterative subspace. J. Comput. Chem, 1999, 20(9), 928–936.

[136] Kaminski, J. W.; Gusarov, S.; Wesolowski, T. A.; Kovalenko, Andiry. Modeling solva-
tochromic shifts using the orbital-free embedding potential at statistically mechanically
averaged solvent density. J. Phys. Chem. A, 2010, in press.

[137] Frigo, M.; Johnson, S. G. FFTW: An adaptive software architecture for the FFT. in Proc.
1998 IEEE Intl. Conf. Acoustics Speech and Signal Processing, volume 3, pp 1381–1384.
IEEE, 1998.

[138] Frigo, M. A fast Fourier transform compiler. in Proc. 1999 ACM SIGPLAN Conf. on
Programming Language Design and Implementation, volume 34, pp 169–180. ACM,
May 1999.

338
BIBLIOGRAPHY

[139] Gusarov, S.; Ziegler, T.; Kovalenko, A. Self-consistent combination of the three-
dimensional RISM theory of molecular solvation with analytical gradients and the ams-
terdam density functional package. J. Phys. Chem. A, 2006, 110(18), 6083–6090.
[140] Miyata, T.; Hirata, F. Combination of molecular dynamics method and 3D-RISM theory
for conformational sampling of large flexible molecules in solution. J. Comput. Chem.,
Oct 2007, 29, 871–882.
[141] Genheden, S.; Luchko, T.; Gusarov, S.; Kovalenko, A.; Ryde, U. An MM/3D-RISM
approach for ligand-binding affinities. J. Phys. Chem., 2010. Accepted.
[142] Gohlke, H.; Kuhn, L. A.; Case, D. A. Change in protein flexibility upon complex for-
mation: Analysis of Ras-Raf using molecular dynamics and a molecular framework ap-
proach. Proteins, 2004, 56, 322–327.
[143] Ahmed, A.; Gohlke, H. Multiscale modeling of macromolecular conformational changes
combining concepts from rigidity and elastic network theory. Proteins, 2006, 63, 1038–
1051.
[144] Fulle, S.; Gohlke, H. Analyzing the flexibility of RNA structures by constraint counting.
Biophys. J., 2008, DOI:10.1529/biophysj.107.113415.
[145] Sigalov, G.; Fenley, A.; Onufriev, A. Analytical electrostatics for biomolecules: Beyond
the generalized Born approximation . J. Chem. Phys., 2006, 124, 124902.
[146] Major, F.; Turcotte, M.; Gautheret, D.; Lapalme, G.; Fillon, E.; Cedergren, R. The
Combination of Symbolic and Numerical Computation for Three-Dimensional Modeling
of RNA. Science, 1991, 253, 1255–1260.
[147] Gautheret, D.; Major, F.; Cedergren, R. Modeling the three-dimensional structure of
RNA using discrete nucleotide conformational sets. J. Mol. Biol., 1993, 229, 1049–1064.
[148] Turcotte, M.; Lapalme, G.; Major, F. Exploring the conformations of nucleic acids. J.
Funct. Program., 1995, 5, 443–460.
[149] Erie, D.A.; Breslauer, K.J.; Olson, W.K. A Monte Carlo Method for Generating Struc-
tures of Short Single-Stranded DNA Sequences. Biopolymers, 1993, 33, 75–105.
[150] Tung, C.-S.; Carter, E.S. II. Nucleic acid modeling tool (NAMOT): an interactive graphic
tool for modeling nucleic acid structures. CABIOS, 1994, 10, 427–433.
[151] Carter, E.S. II; Tung, C.-S. NAMOT2–a redesigned nucleic acid modeling tool: con-
struction of non-canonical DNA structures. CABIOS, 1996, 12, 25–30.
[152] Zhurkin, V.B.; P. Lysov, Yu.; Ivanov, V.I. Different Families of Double Stranded Con-
formations of DNA as Revealed by Computer Calculations. Biopolymers, 1978, 17,
277–312.
[153] Lavery, R.; Zakrzewska, K.; Skelnar, H. JUMNA (junction minimisation of nucleic
acids). Comp. Phys. Commun., 1995, 91, 135–158.

339
BIBLIOGRAPHY

[154] Gabarro-Arpa, J.; Cognet, J.A.H.; Le Bret, M. Object Command Language: a formalism
to build molecule models and to analyze structural parameters in macromolecules, with
applications to nucleic acids. J. Mol. Graph., 1992, 10, 166–173.

[155] Le Bret, M.; Gabarro-Arpa, J.; Gilbert, J.C.; Lemarechal, C. MORCAD an object-
oriented molecular modeling package. J. Chim. Phys., 1991, 88, 2489–2496.

[156] Crippen, G.M.; Havel, T.F. Distance Geometry and Molecular Conformation. Research
Studies Press, Taunton, England, 1988.

[157] Spellmeyer, D.C.; Wong, A.K.; Bower, M.J.; Blaney, J.M. Conformational analysis
using distance geometry methods. J. Mol. Graph. Model., 1997, 15, 18–36.

[158] Hodsdon, M.E.; Ponder, J.W.; Cistola, D.P. The NMR solution structure of intestinal
fatty acid-binding protein complexed with palmitate: Application of a novel distance
geometry algorithm. J. Mol. Biol., 1996, 264, 585–602.

[159] Macke, T.; Chen, S.-M.; Chazin, W.J. in Structure and Function, Volume 1: Nucleic
Acids, Sarma, R.H.; Sarma, M.H., Eds., pp 213–227. Adenine Press, Albany, 1992.

[160] Potts, B.C.M.; Smith, J.; Akke, M.; Macke, T.J.; Okazaki, K.; Hidaka, H.; Case, D.A.;
Chazin, W.J. The structure of calcyclin reveals a novel homodimeric fold S100 Ca2+ -
binding proteins. Nature Struct. Biol., 1995, 2, 790–796.

[161] Love, J.J.; Li, X.; Case, D.A.; Giese, K.; Grosschedl, R.; Wright, P.E. DNA recognition
and bending by the architectural transcription factor LEF-1: NMR structure of the HMG
domain complexed with DNA. Nature, 1995, 376, 791–795.

[162] Gurbiel, R.J.; Doan, P.E.; Gassner, G.T.; Macke, T.J.; Case, D.A.; Ohnishi, T.; Fee,
J.A.; Ballou, D.P.; Hoffman, B.M. Active site structure of Rieske-type proteins: Elec-
tron nuclear double resonance studies of isotopically labeled phthalate dioxygenase from
Pseudomonas cepacia and Rieske protein from Rhodobacter capsulatus and molecular
modeling studies of a Rieske center. Biochemistry, 1996, 35, 7834–7845.

[163] Macke, T.J. NAB, a Language for Molecular Manipulation. 1996.

[164] Dickerson, R.E. Definitions and Nomenclature of Nucleic Acid Structure Parameters. J.
Biomol. Struct. Dyn., 1989, 6, 627–634.

[165] Zhurkin, V.B.; Raghunathan, G.; Ulynaov, N.B.; Camerini-Otero, R.D.; Jernigan, R.L.
A Parallel DNA Triplex as a Model for the Intermediate in Homologous Recombination.
Journal of Molecular Biology, 1994, 239, 181–200.

[166] Tan, R.; Harvey, S. Molecular Mechanics Model of Supercoiled DNA. J. Mol. Biol.,
1989, 205, 573–591.

[167] Babcock, M.S.; Pednault, E.P.D.; Olson, W.K. Nucleic Acid Structure Analysis. J. Mol.
Biol., 1994, 237, 125–156.

340
BIBLIOGRAPHY

[168] Havel, T.F.; Kuntz, I.D.; Crippen, G.M. The theory and practice of distance geometry.
Bull. Math. Biol., 1983, 45, 665–720.
[169] Havel, T.F. An evaluation of computational strategies for use in the determination of pro-
tein structure from distance constraints obtained by nuclear magnetic resonance. Prog.
Biophys. Mol. Biol., 1991, 56, 43–78.
[170] Kuszewski, J.; Nilges, M.; Brünger, A.T. Sampling and efficiency of metric matrix
distance geometry: A novel partial metrization algorithm. J. Biomolec. NMR, 1992, 2,
33–56.
[171] deGroot, B.L.; van Aalten, D.M.F.; Scheek, R.M.; Amadei, A.; Vriend, G.; Berendsen,
H.J.C. Prediction of protein conformational freedom from distance constraints. Proteins,
1997, 29, 240–251.
[172] Agrafiotis, D.K. Stochastic Proximity Embedding. J. Computat. Chem., 2003, 24, 1215–
1221.
[173] Saenger, W. in Principles of Nucleic Acid Structure, p 120. Springer-Verlag, New York,
1984.
[174] Berendsen, H.J.C.; Postma, J.P.M.; van Gunsteren, W.F.; DiNola, A.; Haak, J.R. Molec-
ular dynamics with coupling to an external bath. J. Chem. Phys., 1984, 81, 3684–3690.
[175] Loncharich, R.J.; Brooks, B.R.; Pastor, R.W. Langevin dynamics of peptides: The fric-
tional dependence of isomerization rates of N-actylananyl-N’-methylamide. Biopoly-
mers, 1992, 32, 523–535.
[176] Brooks, C.; Brünger, A.; Karplus, M. Active site dynamics in protein molecules: A
stochastic boundary molecular-dynamics approach. Biopolymers, 1985, 24, 843–865.
[177] Onufriev, A.; Bashford, D.; Case, D.A. Modification of the generalized Born model
suitable for macromolecules. J. Phys. Chem. B, 2000, 104, 3712–3720.
[178] Weiser, J.; Shenkin, P.S.; Still, W.C. Approximate Atomic Surfaces from Linear Combi-
nations of Pairwise Overlaps (LCPO). J. Computat. Chem., 1999, 20, 217–230.
[179] Nguyen, D.T.; Case, D.A. On finding stationary states on large-molecule potential energy
surfaces. J. Phys. Chem., 1985, 89, 4020–4026.
[180] Kolossváry, I.; Guida, W.C. Low mode search. An efficient, automated computational
method for conformational analysis: Application to cyclic and acyclic alkanes and cyclic
peptides. J. Am. Chem. Soc., 1996, 118, 5011–5019.
[181] Kolossváry, I.; Guida, W.C. Low-mode conformatinoal search elucidated: Application to
C39 H80 and flexible docking of 9-deazaguanine inhibitors into PNP. J. Comput. Chem.,
1999, 20, 1671–1684.
[182] Kolossváry, I.; Keserü, G.M. Hessian-free low-mode conformational search for large-
scale protein loop optimization: Application to c-jun N-terminal kinase JNK3. J. Com-
put. Chem., 2001, 22, 21–30.

341
BIBLIOGRAPHY

[183] Keserü, G.M.; Kolossváry, I. Fully flexible low-mode docking: Application to induced
fit in HIV integrase. J. Am. Chem. Soc., 2001, 123, 12708–12709.
[184] Shi, Z.J.; Shen, J. New inexact line search method for unconstrained optimization. J.
Optim. Theory Appl., 2005, 127, 425–446.

[185] Press, W.H.; Flannery, B.P.; Teukolsky, S.A.; Vetterling, W.T. Numerical Recipes: The
Art of Scientific Computing. Cambridge University Press, New York, 1989.
[186] Liu, D.C.; Nocedal, J. On the limited memory method for large scale optimization. Math.
Programming B, 1989, 45, 503–528.
[187] Nocedal, J.; L. Morales, J. Automatic preconditioning by limited memory quasi-Newton
updating. SIAM J. Opt., 2000, 10, 1079–1096.
[188] Hirata, F., Ed. Molecular Theory of Solvation. Kluwer Academic Publishers, 2003.

342
Index
1D-RISM, 157, 159, 163 bdna, 200, 301
3D-RISM, 157, 160, 166 bdna(), 201
blocksize, 279
A bond, 52
accept, 275 bondByDistance, 52
acdoctor, 89 bondtype, 86
acos, 239 break, 234
adbcor, 165 bridge function, 158
add, 48 buffer, 277
addAtomTypes, 49
addIons, 50 C
addIons2, 50 ceil, 239
addPath, 50 centering, 278
addPdbAtomMap, 50 check, 52
addPdbResMap, 51 closur, 163
addresidue, 192, 243 closure, 277
addstrand, 192, 243 combine, 53
alias, 52 complement, 200
alignframe, 200, 251 conjgrad, 271
allatom_to_dna3, 245 connectres, 192, 243
allocate, 227 continue, 234
am1bcc, 85 copy, 53
andbounds, 260 copymolecule, 243
angle, 247 cos, 239
anglep, 248 cosh, 239
antechamber, 78 countmolatoms, 248
asin, 239 createAtom, 54
assert, 249 createResidue, 54
atan, 239 createUnit, 54
atan2, 239 cut, 273
atof, 239 cutfd, 148
atoi, 239 cutnb, 148
atomtype, 84 cutres, 148
cuvfile, 276
B
basepair, 200 D
bcopt, 147 database, 90

343
INDEX

date, 250 espgen, 87


dbfopt, 148 excess chemical potential, 160
deallocate, 227 exit, 240
debug, 249 exp, 239
decompopt, 149
del, 277 F
delete, 232 fabs, 239
deleteBond, 54 fclose, 240
delvv, 164 fd_helix, 244
density, 164 fillratio, 146, 275
desc, 54 floor, 239
dftb_3rd_order, 98 fmod, 239
dftb_chg, 99 fopen, 240
dftb_disper, 98 force, 278
dftb_maxiter, 99 fprintf, 240
dftb_telec, 99 frcopt, 148
dg_helix, 301 freemolecule, 243
dg_options, 261 freeresidue, 243
diag_routine, 100 fscanf, 240
diel, 274 ftime, 250
dielc, 274
dieps, 165 G
dim, 273 gamma_ln, 273
direct correlation function, 157 gauss, 239
dist, 248 gb, 274
distp, 248 gb2_debug, 273
dna3, 245 gb_debug, 273
dna3_to_allatom, 245 gbsa, 274
dprob, 146, 275 genmass, 274
dr, 163 geodesics, 261
dumpatom, 249 getchivol, 261
dumpbounds, 249 getchivolp, 261
dumpboundsviolations, 249 getcif, 246
dumpmatrix, 249 getline, 240
dumpmolecule, 249 getmatrix, 242
dumpresidue, 249 getpdb, 246
getpdb_prm, 244, 271
E getres, 193, 200
e_debug, 273 getresidue, 192, 193, 246
embed, 261 gettriad(), 217
eneopt, 147 getxv, 271
epsext, 274 getxyz, 271
epsin, 145, 275 grdspc, 277
epsout, 145, 275 grms_tol, 102
errconv, 102 groupSelectedAtoms, 55

344
INDEX

gsub, 238 M
guvfile, 276 match, 238
MAT_cube, etc, 253
H matextract, 258
helix, 200 MAT_fprint, etc, 254
helixanal, 248 matgen, 255
HNC, 158, 160 matmerge, 257
huvfile, 276 maxcyc, 101
hypernetted-chain approximation, 158 maxitn, 146, 275
maxsph, 146, 150
I maxste, 164
imin, 143 maxstep, 277
impose, 56 md, 271
index, 238 MDIIS, 160
inp, 144, 275 MDL, 167
intramolecular pair correlation matrix, 159 mean solvation force, 160
ipb, 275, 276 measureGeom, 59
iprob, 275 mergestr, 192, 243
irism, 276 method, 277
istrng, 145, 275 mk_dimer(), 217
itrmax, 101 mme, 271
mme2, 281
K mme_init, 271
k4d, 273 mme_rattle, 271
kappa, 274 mm_options, 271
KH, 158, 160 mm_set_checkpoint, 271
Kovalenko-Hirata, 158 model, 164
ksave, 164 modified direct inversion of the iterative sub-
kshow, 164 space, 159
molsurf, 248
L MPI, 187
length, 238
link_na, 244 N
linkprot, 243 NAB, 166, 167
list, 57 nbuffer, 147
lmod, 291 nchk, 273
loadAmberParams, 57 nchk2, 273
loadAmberPrep, 57 ndiis_attempts, 102
loadMol2, 58 ndiis_matrices, 102
loadOff, 57 newbounds, 260
loadPdb, 58 newmolecule, 192, 243
loadPdbUsingSeq, 58 newton, 281
log, 239 newtransform, 198, 251
log10, 239 nfocus, 275
logFile, 58 ng3, 277

345
INDEX

nis, 164 putmatrix, 242


nmode, 281 putpdb, 246
npbgrid, 147 putxv, 271
npbopt, 275 putxyz, 271
npbverb, 149
npopt, 149 Q
npropagate, 278 qmcharge, 99
nr, 163 qmqmdx, 99
nsnb, 273 qm_theory, 98
nsnba, 148
nsnbr, 148 R
nsp, 165 radiopt, 145, 275
ntpr, 101, 273 rand2, 239
ntpr_md, 273 rattle, 273
ntwrism, 278 readparm, 271
ntwx, 273 remove, 59
ntx, 144 residuegen, 90
respgen, 88
O rgbmax, 274
offset, 150 rhow_effect, 150
OMP_NUM_THREADS, 187 RISM, 157
OpenDX, 170 rism1d, 157, 163
orbounds, 260 rmsd, 247
Ornstein-Zernike, 157 rot4, 199, 251
outlst, 164 rot4p, 199, 251
routup, 164
P rseed, 239
pair-distribution function, 157
parmcal, 90 S
parmchk, 80 saveAmberParm, 60
pbtemp, 145 saveMol2, 60
peptide_corr, 101 saveOff, 60
phiform, 149 savePdb, 60
plane, 248 ScaLAPACK, 187
point, 237 scalec, 146, 148
pow, 239 scanf, 240
prepgen, 87 scfconv, 100
printcharges, 101 second, 250
printf, 240 sequence, 61
progress, 279 set, 61
pseudo_diag, 100 setbounds, 260
pseudo_diag_criteria, 100 setboundsfromdb, 261
putbnd, 246 setchiplane, 261
putcif, 246 setchivol, 261
putdist, 246 setframe, 199, 251

346
INDEX

setframep, 200, 251 thermodynamics, 160


setmol_from_xyz, 252 tight_p_conv, 100
setmol_from_xyzw, 252 timeofday, 250
setpoint, 252 tolerance, 277
setseed, 239 tolvv, 164
setxyz_from_mol, 252 torsion, 248
setxyzw_from_mol, 252 torsionp, 248
showbounds, 260 total correlation function, 157
sin, 239 toutup, 164
sinh, 239 trans4, 199
smear, 165 trans4p, 199
smoothopt, 144, 145, 275 transform, 64, 258
solvateBox, 63 transformmol, 199, 252
solvateCap, 63 transformres, 192, 193, 199, 252
solvateOct, 63 translate, 65, 91, 92
solvateShell, 64 tsmooth, 261
solvation, 157, 160
solvation free energy, 160 U
solvbox, 277 unlink, 240
solvcut, 277 useboundsfrom, 260
solvopt, 275 use_rmin, 149
space, 147, 275 use_sav, 150
spin, 99
V
split, 238
vec, 277
sprintf, 240
verbose, 279
sprob, 149
verbosity, 65, 99
sqrt, 239
vlimit, 273
sscanf, 240
vprob, 150
static_arrays, 279
sub, 238 W
substr, 238 wc_basepair, 301
sugarpuckeranal, 248 wc_basepair(), 203
superimpose, 247 wc_complement, 301
surften, 150, 274 wc_complement(), 201
system, 240 wc_helix, 301
wc_helix(), 206
T wcons, 273
t, 273
tan, 239 X
tanh, 239 xmin, 286
tautp, 273 XVV, 169
temp0, 273 xvvfile, 276
temper, 165
tempi, 274 Z
theory, 163 zerofrc, 278

347
INDEX

zerov, 273
zMatrix, 65

348

Common questions

Powered by AI

In Amber, Watson-Crick base pairing is achieved programmatically through functions such as 'wc_complement', 'wc_helix', and 'bdna'. 'wc_complement' generates the complementary sequence of DNA or RNA in standard IUPAC codes while maintaining opposite strand polarity . 'wc_helix' and 'bdna' utilize this complement to assemble double-stranded helices, where 'bdna' creates uniform B-form DNA duplexes and 'wc_helix' allows for more complex heteroduplexes . These functions allow for residue-level and sequence-level structural verification ensuring proper helix construction through predefined helico-geometric parameters .

The default temperature setting for the Poisson-Boltzmann (PB) equation in Amber simulations is 300 K, which is used to compute the Boltzmann factor relevant for salt effects . Altering this default temperature could be considered in situations involving simulations of systems functioning under conditions different from the standard room temperature or when studying temperature-sensitive phenomena . Temperature affects the reaction field and solvation dynamic calculations as it influences the dielectric properties and ionic strength, thereby impacting the PB equation's accuracy in simulating electrostatic interactions .

The Amber mask syntax aids in selecting atoms by utilizing characters and symbols to denote specific atom or residue selections. Key syntax features include: - "@" to select atom names or numbers . - ":" to select residues by names or numbers . - "-" for continuation, allowing specification of a range of atoms or residues . - "," for specifying multiple atom or residue selections . - "*" and "?" as wildcard matches for multiple or single characters respectively, providing flexibility in selection . - Double quotes are used to interpret spaces in masks . To validate atom selection, the "checkmask" command can be used . This syntax allows precise and complex selections within molecular systems for simulations or analysis .

To maintain backward compatibility in pbsa settings, parameters such as IPB and INP have equivalents like IGB = 10 and NPOPT in earlier versions. However, these will be phased out gradually. Ensuring backward compatibility ensures that users can transition between software versions without losing established workflows. Future releases aim to eliminate obsolete settings (e.g., IGB, NPOPT) in favor of more streamlined options, expecting users to adapt to updated parameter naming and functions for consistent performance and enhanced features. This shift requires careful transition strategy to guide users without hindering legacy system operations.

The wc_complement() function generates a complementary strand by iterating over the input sequence, applying Watson/Crick base pairing rules to convert each character (A, C, G, T/U) to its complement, regardless of case, and accumulates the results in a new string. When the function encounters an unexpected character—one that is not A, C, G, T, or U—it returns NULL, indicating an error, and outputs an error message to standard error. This ensures that only valid nucleic acid sequences are processed into their complements.

The 'truncoct' command in Amber is designed to create an old-style AMBER truncated octahedron, which is an obsolete command intended primarily for creating truncated octahedron restart files for simulations . Once the 'truncoct' command is used, subsequent operations may exhibit undefined behavior because the coordinate state will not remain consistent with the modified truncated octahedron coordinates . This inconsistency primarily arises because the coordinate changes are only applicable to the first configuration, and subsequent commands assume a different coordinate setup . Therefore, using 'truncoct' can lead to complications unless the subsequent operations and data structures are properly aligned to the modified coordinate state.

The solvent accessible surface area (SASA) is used in Amber non-polar solvation energy models to linearly relate non-polar solvation free energy to SASA, specifically in the context of the PARSE parameter set where the total non-polar solvation energy is modeled as a single term proportional to SASA . When the dispersion term is computed separately, SASA is used for the cavity term while a surface-integration approach computes the dispersion term . Setting RADIOPT incorrectly can lead to inconsistency between the non-polar implicit solvent model and explicit solvent models like TIP3P . In particular, not setting RADIOPT to 1 when using the second non-polar solvation model (INP = 2) results in inconsistent correlation with SASA and could lead to incorrect energy values, since this setting uses optimized radii to mimic the TIP3P explicit solvent . Incorrect settings could also issue warnings or affect the default calculation outputs .

The dielectric model in PBSA calculations defines the electrostatic interface between the solvent and solute. It incorporates the solvent excluded surface to represent this boundary, influencing the calculation of electrostatic solvation free energy . Altering the IPB parameter, which controls the dielectric model setup, impacts these calculations. Setting IPB to 1 uses the solvent excluded surface as the dielectric boundary, while setting IPB to 2 utilizes a level set function for improved stability and calculation simplification. This setup affects the electrostatic potential distribution and the stability of numerical solutions .

The 'watershell' command is used to determine solvation shells by counting water molecules within specific distances from selected atoms, representing first and second solvation shells. The distances defining these shells can be specified, with defaults of 3.4 Å for the first shell and 5.0 Å for the second shell if not provided . Imaging considerations are necessary because coordinates are output for a specific configuration, and imaging ensures the proper counting of solvent molecules within these distances despite periodic boundary conditions. This involves tracking the spatial distribution of solvent molecules relative to solute atoms and is done implicitly unless suppressed with the "noimage" option .

The 'truncoct' command is significant for creating truncated octahedron restart files for simulations in Amber, but it is considered largely obsolete because it relies on writing out prmtop files that are only consistent with the initial set of coordinates. Further usage involves undefined behavior since the state does not align with the modified coordinates . The command assumes all solvent is contiguous at the file's end, and its functionalities have likely been subsumed by more modern, reliable practices in trajectory processing and system setup .

You might also like