0% found this document useful (0 votes)
58 views11 pages

Gen Scan

GENSCAN is a general-purpose gene identification program. Program analyzes genomic DNA sequences from a variety of organisms. It determines the most likely "parse" (gene structure) under a probabilistic model. This set of exons / genes is then printed to an output file together with the corresponding predicted peptide sequences.

Uploaded by

Prateek Shetty
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
58 views11 pages

Gen Scan

GENSCAN is a general-purpose gene identification program. Program analyzes genomic DNA sequences from a variety of organisms. It determines the most likely "parse" (gene structure) under a probabilistic model. This set of exons / genes is then printed to an output file together with the corresponding predicted peptide sequences.

Uploaded by

Prateek Shetty
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd

**********************************************************************

**********************************************************************
** **
** DOCUMENTATION FOR COMMAND-LINE VERSION OF GENSCAN **
** **
** **
** Christopher Burge, PhD **
** **
** MIT **
** Department of Biology **
** 77 Massachusetts Ave., 68-222 **
** **
** cburge@[Link] **
** **
**********************************************************************
**********************************************************************

______________________________________________________________________

TABLE OF CONTENTS

1. OVERVIEW OF GENSCAN
2. INSTALLING GENSCAN
3. GENSCAN INPUT
4. GENSCAN OUTPUT
5. HOW GENSCAN WORKS
6. WEB PAGES
7. REFERENCES

______________________________________________________________________

1. OVERVIEW OF GENSCAN

GENSCAN is a general-purpose gene identification program which


analyzes genomic DNA sequences from a variety of organisms including
human, other vertebrates, invertebrates and plants. For each
sequence, the program determines the most likely "parse" (gene
structure) under a probabilistic model of the gene structural
and compositional properties of the genomic DNA for the
given organism. This set of exons/genes is then printed to an
output file (the text output) together with the corresponding
predicted peptide sequences. A graphical (PostScript) output
may also be created which displays the location and DNA strand
of each predicted exon. Unlike the majority of other currently
available gene prediction programs, the model treats the most
general case in which the sequence may contain no genes, one gene,
or multiple genes on either or both DNA strands and partial
genes as well as complete genes are considered. The most important
restrictions are that only protein coding genes are considered (and
not tRNA or rRNA genes, for example), and that transcription units
are assumed to be non-overlapping.

The probabilistic model used by GENSCAN accounts for many of the


essential gene structural properties of genomic sequences, e.g.,
typical gene density, the typical number of exons per gene,
the distribution of exon sizes for different types of exon; and
also many of the important compositional properties of genes,
e.g., the reading frame-specific hexamer composition of coding
regions vs the (reading frame-independent) hexamer composition
of introns and intergenic regions, and the position-specific
composition of the translation initiation (Kozak) and termination
signals, and of the TATA box, cap site and poly-adenylation signals.
Importantly, novel models of the donor and acceptor splice
sites are used which capture potentially important dependencies
(interactions) between positions in these signals. For human and
vertebrate sequences, separate sets of model parameters are used
which account for the many substantial differences in gene density
and structure observed in distinct C+G% compositional regions of the
human genome and the genomes of other vertebrates.

The program and the model that underlies are described in Burge &
Karlin, 1997 (see REFERENCES) and in greater detail in my thesis,
which is available by anonymous ftp in PostScript format
(see [Link]

______________________________________________________________________

INSTALLING GENSCAN

Make sure that you have requested the correct binary for the
computer system on which you intend to install GENSCAN. Also make
sure that the computer you have chosen has enough memory to run
the types of sequences you want to run efficiently. As a rule, to run
sequences of length N kilobases efficiently, your computer should have
at least N/2 Megabytes of RAM. Longer sequences can be tried, but
results may vary. For example, you might find that the program runs
much more slowly or that you may get a "memory fault" error message
for long sequences. In the latter case, it is probably best to break
up the sequence into two or more smaller pieces and run each one
separately.

Installing GENSCAN should be fairly easy. Here is a suggested


sequence of steps - feel free to modify it depending on the setup
of your system. The ">" symbol below represents the tcsh (or other
shell) prompt.

1. First, if you have not done so already, make a directory to store


files related to GENSCAN, insert the floppy disk provided into
the drive and extract the files on it using the Unix bar command:

> mkdir GENSCAN

> cd GENSCAN

> bar -xvf /dev/rfd0 .

(Here, /dev/rfd0 refers to the floppy disk drive: on some systems


it may have a different name.)
2. List this directory (ls). The following files should be present:

README (This file: GENSCAN documentation)


[Link] (Parameter file for human/vertebrates)
[Link] (Parameter file for Arabidopsis)
[Link] (Parameter file for maize)
HUMRASH (A sample human genomic sequence)
[Link] (GENSCAN output for the sample sequence)
genscan (The GENSCAN binary)

3. Make sure that you have permission to execute the binary


and to read the parameter files:

> chmod a+x genscan

> chmod a+r *.smat

4. Install the binary in a directory which is in your path, e.g.,

> mv genscan /usr/bin/genscan

(Must be superuser to write to /usr/bin on most systems.)

5. Now make a directory for the GENSCAN parameter files and put
them into this directory:

> mkdir /usr/lib/GENSCAN

> mv *.smat /usr/lib/GENSCAN

6. Type rehash and then try running the program (with no arguments):

> rehash

> genscan

What happened?

Hopefully, you got a message like:

*******************************************************************
*******************************************************************
** **
** N O T I C E **
** **
** This program is made available ...
...
yadda yadda yadda
...
** **
*******************************************************************
*******************************************************************

usage: genscan parfname seqfname [-v] [-cds] [-subopt cutoff] [-ps psfname
scale]
parfname : full pathname of parameter file
(for appropriate organism)

seqfname : full pathname of sequence file


(FastA or minimal GenBank format)

-v : verbose output (extra explanatory info)

-cds : print predicted coding sequences (nucleic acid)

-subopt : display suboptimal exons with P > cutoff (optional)


cutoff : suboptimal exon probability cutoff (minimum: 0.01)

-ps : create Postscript output (optional)


psfname : filename for PostScript output
scale : scale for PostScript output (bp per line)

If not, you might double-check your path to make sure it includes


the directory where you put genscan and make sure that all of the
permissions are set properly.

You have now successfully installed genscan.

______________________________________________________________________

3. GENSCAN INPUT

Typing "genscan" at the prompt displays the usage information


for the program (see above). In brief, the program takes two
essential command-line arguments, as well as one or more optional
arguments (the ones in square brackets above).
These arguments are described below.

OPTIONAL ARGUMENTS
__________________

-v Add some extra explanatory information to the text output.


This information may be helpful the first few times you run
the program but will soon become tiresome (that's why its optional).

-cds Print predicted CDS (coding sequences) as well as predicted


peptides.

-subopt Identify suboptimal exons. The default output of the program


is the optimal "parse" of the sequence, i.e. the highest
probability gene structure(s) which is present: the exons
in this optimal parse are referred to as "optimal exons" and
are always printed out by GENSCAN. Suboptimal exons, on the
other hand, are defined as potential exons which have probability
above a certian threshold but which are not contained in the
optimal parse of the sequence. Suboptimal exons have a variety
of potential uses. First, suboptimal exons sometimes correspond
to real exons which were missed for whatever reason by the optimal
parse of the sequence. Second, regions of a prediction which
contain multiple overlapping and/or incompatible optimal and
suboptimal exons may in some cases indicate alternatively spliced
regions of a gene (Burge & Karlin, in preparation).

The argument "cutoff" is the probability cutoff used to


determine which potential exons qualify as suboptimal exons.
This argument should be a number between 0.01 and 0.99.
For most applications, a cutoff value of about 0.10 is
recommended. Setting the value much lower than 0.10 will often
lead to an explosion in the number of suboptimal exons,
most of which will probably not be useful. On the other
hand, if the value is set much higher than 0.10, then
potentially interesting suboptimal exons may be missed.

-ps Create the PostScript (graphical) output, which is a diagram


of the locations and DNA strand of all predicted exons/genes.
Exons on the "forward" (input) strand of the sequence are
displayed above the sequence line; exons on the other strand
are displayed below this line. Optimal exons are displayed
as solid blue blocks (black on a black-and-white monitor or
printer); suboptimal exons are outlined in blue. (If many
overlapping suboptimal exons are present, the graphical
display may become somewhat cluttered.)

The argument "psfname" is the name of the file where you


want the PostScript output to go (should end in ".ps").
This argument is required whenever the "-ps" flag is used.

The "scale" argument tells the program what scale to make the
PostScript image, i.e. how many base pairs to represent per line.
This number must be no greater than one fourth of the length of
the sequence (because only four lines fit on a page).
If this argument is omitted, the program will choose a reasonable
scale for the image.

The PostScript output may be printed on any PostScript printer:


it can be viewed using any of several PostScript interpreters
such as ghostscript/ghostview, pageview, xpsview, etc. The
PostScript language was developed by Adobe Systems Inc. and
the name PostScript is a registered trademark of this company.

ESSENTIAL ARGUMENTS
___________________

1. The Parameter File

The parameter file must follow a very specific format to be read correctly
by GENSCAN and SHOULD NEVER BE MODIFIED. If you really have a good reason
for wanting to change some of the parameters, please send email to:

cburge@[Link]
and we can discuss the proposed changes.

Note that separate parameter files are provided for different organisms.
Currently available parameter files are:

[Link] for human/vertebrate sequences (also Drosophila)


[Link] for Arabidopsis thaliana sequences
[Link] for Zea mays sequences

The full path of the parameter file is the first (mandatory) command line
argument. You can either type the full path every time you run the program
or save some typing by using aliases. For example, assuming that the
parameter files have been installed in the directory /usr/lib/GENSCAN, you
could put the following aliases in your .cshrc file (normally located in
your home directory):

alias genvert genscan /usr/lib/GENSCAN/[Link]


alias genarab genscan /usr/lib/GENSCAN/[Link]
alias genmaiz genscan /usr/lib/GENSCAN/[Link]

That way (after you source .cshrc) you can simply type, for example,

> genvert SEQFILE

to run the program on SEQFILE with the human/vertebrate parameters.

2. The Sequence File

The sequence file may be in either FastA or minimal GenBank format.


These formats are described below, with examples of each.

A sequence in FastA format begins with a single-line description,


followed by lines of sequence data. The description line is
distinguished from the sequence data by a greater-than (">") symbol
in the first column. The sequence data may be upper or lower case.
All spaces, tabs, numbers or other non-alphabet characters are
ignored by GENSCAN, with the exception of asterisks ("*"), which
are treated as unknown nucleotides (N's). GENSCAN does not
distinguish between special symbols indicating purine or pyrimidine
nucleotides such as R, Y, etc., but treats all letters other than
A, C, G, T as unknowns (N). It is usually an easy task to convert
sequences stored in other formats such as Intelligenetics, EMBL, etc.
to FastA format either by hand or using any of several standard
utitilities. A sample FastA format sequence is shown below:

>HC2667A cosmid clone from human chromosome 5q22


GGATCCCAGCCTTTCCCCAGCCCGTAGCCCCGGGACCTCCGCGGTGGGCGGCGCCGCGCT
GCCGGCGCAGGGAGGGCCTCTGGTGCACCGGCACCGCTGAGTCGGGTTCTCTCGCCGGCC
TGTTCCCGGGAGAGCCCGGGGCCCTGCTCGGAGATGCCGCCCCGGGCCCCCAGACACCGG
......

GENSCAN may also be run on files in "minimal GenBank" format.


This includes files in proper GenBank format as well as files
(perhaps constructed by hand) which contain only partial GenBank
annotation (see below). The main reason why GENSCAN has been written
so as to accept GenBank annotated as well as unannotated (FastA) files
is so that the predictive accuracy of the program can be easily measured
on sequences with known gene locations. Thus, when run on a GenBank
file containing a feature table, the program automatically compares its
predictions to the annotated CDS (coding sequence) features, displays
a summary of the annotated as well as predicted exons, and calculates
some standard measures of predictive accuracy such as nucleotide- and
exon-level sensitivity, specificity and so on. (The conventions used
to calculate these statistics are those described in Burset and Guigo,
1996 - see REFERENCES). This makes it relatively easy to check the
program's accuracy for any particular set of sequences for which the
annotated CDS features are deemed to be reliable and complete.
Of course, the program does not actually use the annotation in any
way to make its predictions: that would be silly. Therefore, in
particular, the set of predicted genes/exons will be identical for
a sequence in GenBank format as for the same sequence converted to
FastA format, i.e. without the feature annotation.

In general, GenBank format files must follow an elaborate set of


formatting conventions devised by the National Center for Biotechnology
Information (NCBI) in Washington. However, GENSCAN needs only a
fraction (described below) of the complete GenBank annotation for its
purposes, so only these lines need be present (in the proper order)
in an input file which is to be read by the program. This "minimal
GenBank" format is as follows.

The LOCUS and ORIGIN lines must be present. The first line of the
file must be the LOCUS line and this line must be in proper GenBank
format (see below). The ORIGIN line must begin with the word ORIGIN
but has no other special restrictions. The sequence must begin on the
line immediately after the ORIGIN line. All other lines normally
present in GenBank files (e.g., ACCESSION, KEYWORDS, etc.) are optional.
However, if a feature table is present, it must begin with a line:

FEATURES Location/Qualifiers

(with exactly the same spacing/capitalization/etc. as in a GenBank file)


and must end with a BASE COUNT line (as in a real GenBank file) followed
by an ORIGIN line, and then the sequence. The feature table must be
in correct GenBank feature table format (including spacing) -- consult
the NCBI GenBank format description or look at some real GenBank files
if in doubt. All features other than those labeled "CDS" are ignored.
All CDS features are read and the complete set of annotated coding
exons are compared to the complete set of predicted coding exons.

The format for the LOCUS line is:

LOCUS SEQNAME seqlen bp seqtype taxgroup date

where SEQNAME is the name of the sequence (any string), seqlen is


the length of the sequence in base pairs (must match the actual number
of sequence characters in the file), and the last three strings
describe the type of sequence (e.g., ds-DNA, cDNA), the taxonomic group
code, and the date. Again, the sequence may be upper or lower case
and all spaces, tabs, numbers, etc. occurring after the ORIGIN line
are ignored. An example of a sequence in minimal GenBank format is
given below:
LOCUS HUMRASH 6453 bp ds-DNA PRI 15-MAR-1988
DEFINITION Human c-Ha-ras1 proto-oncogene, complete coding sequence.
ACCESSION J00277 J00206 J00276 K00954
FEATURES Location/Qualifiers
prim_transcript <1664..3744
/note="c-Ha-ras1 mRNA"
CDS join(1664..1774,2042..2220,2374..2533,3231..3350)
/note="c-Ha-ras1 p21 protein; NCBI gi: 190891."
/codon_start=1
/translation="MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRK
QV
VIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQI
KR
VKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYT
LV
REIRQHKLRKLNPPDESGPGCMSCKCVLS"
source 1..6453
/organism="Homo sapiens"
BASE COUNT 946 a 2287 c 2113 g 1107 t
ORIGIN 1 bp upstream of BamHI site.
1 ggatcccagc ctttccccag cccgtagccc cgggacctcc gcggtgggcg gcgccgcgct
61 gccggcgcag ggagggcctc tggtgcaccg gcaccgctga gtcgggttct ctcgccggcc
121 tgttcccggg agagcccggg gccctgctcg gagatgccgc cccgggcccc cagacaccgg
... ..........

______________________________________________________________________

4. GENSCAN OUTPUT

By default, the text output of the program is directed to stdout,


which means that if you simply run the program without redirecting
or piping the output, it will be printed to the screen. The purpose
of printing the text output to stdout is so that you (the user) have
the option of either redirecting the output to a file, e.g.,

> genscan [Link] SEQFILE > [Link]

or piping the text output through some sort of filtering program to


put it in a form which is more convenient for your purposes, e.g.,

> genscan [Link] SEQFILE | gsfilter > SEQFILE.fil_out

Of course, it is your responsibility to create the filtering program.

At this point, you may wish to test GENSCAN by running the program
on the sample sequence HUMRASH which was provided and redirecting the
output to a file, e.g. (assuming you set up the recommended aliases)
type:

> genvert HUMRASH > [Link]

While running, the program should print out the "notice" message
and then the following (everything between the rows of stars):
*************************************************************************

reading sequence file HUMRASH... 6453 bp

reading parameter file /usr/lib/GENSCAN/[Link]... 14 matrices

scoring sequence... done

running Viterbi/forward algorithms... done

running backward algorithm... done

printing results... 1 predicted genes

processing features...

done

Run time 5 seconds : 0.8 s / kb

*************************************************************************

Of course, the run time may vary depending on what type of computer
you are using and what other processes were running at the same time.
Other than that, the output should be similar to that shown above.
If not, then there may have been a problem with the installation.
(Check the steps listed above.) These messages are designed to give you
an idea of what the program is doing at each particular time so that if
a problem occurs you have some idea of what might have gone wrong.
They should be fairly self-explanatory (see next section).

Now compare the output [Link] to the output [Link]


which was provided using the Unix diff command:

> diff [Link] [Link]

Only one line should differ between the two files: the line
beginning GENSCAN 1.0 and containing the date and time the
program was run.

If any problems occurred up to this point (or in subsequent use of


the program), send email to Chris Burge at:

cburge@[Link]

Include in the email the type of computer system you have, the exact
syntax of the command used to invoke the program, a description
of the problem which occurred while running the program, and any
error messages which appeared.

In addition, if any bugs are found in GENSCAN, please notify me


promptly so that I can fix them as soon as possible.

Happy gene hunting!!!


______________________________________________________________________

5. HOW GENSCAN WORKS

This section gives an indication of the sequence of steps which the


program carries out when run on a sequence.

1) The sequence and parameters are read and stored in dynamically


allocated arrays.

2) The sequence is scored using the probabilistic models of


coding/non-coding regions, donor and acceptor splice sites, etc.
given in the parameter file and the resulting scores are also
stored in dynamically allocated arrays.

3) Modified Viterbi, forward and backward recursions are performed


which allow determination of the most likely gene structure in
the sequence, probability of each predicted exon, and (optionally)
all suboptimal exons with probability above a given cutoff.

4) The predicted gene structure(s), suboptimal exons, associated score


information and the corresponding predicted peptides are then printed
to stdout (the text output). Optionally, a PostScript output file
which displays the locations of all predicted exons is also created
(the graphical output).

5) The program indicates the amount of time it took to run and exits.

______________________________________________________________________

6. WEB PAGES

GENSCAN web server

[Link]

(Contains links to other GENSCAN-related pages)

GENSCAN email server instructions

[Link]

My home page:

[Link]

______________________________________________________________________

7. REFERENCES

Burge, C. & Karlin, S. (1997) Prediction of complete gene structures


in human genomic DNA. J. Mol. Biol. 268, 78-94.

Burge, C. & Karlin, S. (1997) Gene structure, exon prediction, and


alternative splicing. (in preparation).

Burge, C. (1997) Identification of genes in human genomic DNA. PhD


thesis, Stanford University, Stanford, CA.

Burset, M. & Guigo, R. (1996) Evaluation of gene structure prediction


programs. Genomics 34, 353-367.

______________________________________________________________________

Copyright 1997-2002 Christopher Burge

______________________________________________________________________

You might also like