Scribd
Upload
9 views3 pages

Fasta Format of RBP4 mRNA Sequence

The document contains the FASTA format sequence of the retinol binding protein 4 (RBP4) gene from Homo sapiens. It is 941 base pairs in length and consists entirely of exons with no introns. The sequence encodes a 201 amino acid precursor protein for RBP4, which is a plasma protein that binds retinol and transports it to tissues. The gene references several studies that examined the role of RBP4 in insulin resistance, obesity, and metabolic disease risk.

Uploaded by

Idil Saputra
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd
9 views3 pages

Fasta Format of RBP4 mRNA Sequence

The document contains the FASTA format sequence of the retinol binding protein 4 (RBP4) gene from Homo sapiens. It is 941 base pairs in length and consists entirely of exons with no introns. The sequence encodes a 201 amino acid precursor protein for RBP4, which is a plasma protein that binds retinol and transports it to tissues. The gene references several studies that examined the role of RBP4 in insulin resistance, obesity, and metabolic disease risk.

Uploaded by

Idil Saputra
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd

Fasta format RB4 (retinol binding protein 4)

>gi|55743121|ref|NM_006744.3| Homo sapiens retinol binding protein 4,


plasma (RBP4), mRNA
CGCCTCCCTCGCTCCACGCGCGCCCGGACTCGGCGGCCAGGCTTGCGCGCGGTTCCCCTCCCGGTGGGCG
GATTCCTGGGCAAGATGAAGTGGGTGTGGGCGCTCTTGCTGTTGGCGGCGCTGGGCAGCGGCCGCGCGGA
GCGCGACTGCCGAGTGAGCAGCTTCCGAGTCAAGGAGAACTTCGACAAGGCTCGCTTCTCTGGGACCTGG
TACGCCATGGCCAAGAAGGACCCCGAGGGCCTCTTTCTGCAGGACAACATCGTCGCGGAGTTCTCCGTGG
ACGAGACCGGCCAGATGAGCGCCACAGCCAAGGGCCGAGTCCGTCTTTTGAATAACTGGGACGTGTGCGC
AGACATGGTGGGCACCTTCACAGACACCGAGGACCCTGCCAAGTTCAAGATGAAGTACTGGGGCGTAGCC
TCCTTTCTCCAGAAAGGAAATGATGACCACTGGATCGTCGACACAGACTACGACACGTATGCCGTGCAGT
ACTCCTGCCGCCTCCTGAACCTCGATGGCACCTGTGCTGACAGCTACTCCTTCGTGTTTTCCCGGGACCC
CAACGGCCTGCCCCCAGAAGCGCAGAAGATTGTAAGGCAGCGGCAGGAGGAGCTGTGCCTGGCCAGGCAG
TACAGGCTGATCGTCCACAACGGTTACTGCGATGGCAGATCAGAAAGAAACCTTTTGTAGCAATATCAAG
AATCTAGTTTCATCTGAGAACTTCTGATTAGCTCTCAGTCTTCAGCTCTATTTATCTTAGGAGTTTAATT
TGCCCTTCTCTCCCCATCTTCCCTCAGTTCCCATAAAACCTTCATTACACATAAAGATACACGTGGGGGT
CAGTGAATCTGCTTGCCTTTCCTGAAAGTTTCTGGGGCTTAAGATTCCAGACTCTGATTCATTAAACTAT
AGTCACCCGTGTCCTGTGAAAAAAAAAAAAA

Sequence gi : 55743121
Length : 941 bp

Homo sapiens retinol binding protein merupakan m-RNA karena memiliki polyA
tail yang dimana intronnya telah di buang jadi yang tersisa adalah exon,
berasal dari homo sapiens (manusia, eukariot, mamalia) sehingga m-RNA nya
bersifat linear

Referensi 1 (1-941 bp) Association among retinol-binding protein 4, small


dense LDL cholesterol and oxidized LDL levels in dyslipidemia subjects

Referensi 2 (1-941 bp) RBP4 level reflects visceral body fat content in
non-polycystic ovary syndrome women.

Referensi 3 (1-941 bp) the increase of apo-/holo-RBP4 concentration may


influence STRA6 signaling, finally causing apoptosis.

Referensi 4 (1-941 bp) RBP4 may have a role in insulin resistance and risk
for type 2 diabetes and metabolic syndrome

Referensi 5 (1-941 bp) In early- to mid-adolescents, circulating


concentrations of RBP4 are correlated with multiple risk factors for
adiposity-related co-morbidities.

Poly A signal attaaa


Poly A tail aa aaaaaaaaaa a
Genscan results

Predicted peptide sequence(s):

>/tmp/09_22_12-02:23:[Link]|GENSCAN_predicted_peptide_1|201_aa

MKWVWALLLLAALGSGRAERDCRVSSFRVKENFDKARFSGTWYAMAKKDPEGLFLQDNIV

AEFSVDETGQMSATAKGRVRLLNNWDVCADMVGTFTDTEDPAKFKMKYWGVASFLQKGND

DHWIVDTDYDTYAVQYSCRLLNLDGTCADSYSFVFSRDPNGLPPEAQKIVRQRQEELCLA

RQYRLIVHNGYCDGRSERNLL

Homo Sapiens Retinol Binding Protein 4 consist of exon and no intron inside
the gene, the length of the gene is 941 bp and all consist of exon. Strand
plus leading strand (5-3) and no strand minus lagging strand (3-5)

Green color shows the length gene of RBP4 gene


Red color shows the length RBP4 precursor
PolyA signal shows how length the signal of PolyA where the length is 6 bp
PolyA site shows the site of Polyadenilation where the length is 6 bp

You might also like