0% found this document useful (0 votes)
58 views71 pages

Java Programs for Beginners

The document contains summaries of 9 programming problems and their solutions in Java. Each problem has the aim, algorithm, code and output sections outlined. The problems cover printing text, mathematical operations on user-input numbers, checking prime and Armstrong numbers, object instantiation counting, array sorting, constructor and method overloading, and method overriding for shapes.

Uploaded by

nizamibilal1064
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
58 views71 pages

Java Programs for Beginners

The document contains summaries of 9 programming problems and their solutions in Java. Each problem has the aim, algorithm, code and output sections outlined. The problems cover printing text, mathematical operations on user-input numbers, checking prime and Armstrong numbers, object instantiation counting, array sorting, constructor and method overloading, and method overriding for shapes.

Uploaded by

nizamibilal1064
Copyright
© Attribution Non-Commercial (BY-NC)
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as DOCX, PDF, TXT or read online on Scribd

PROGRAM-1

AIM: Write a program to print Hello World. ALGORITHM: Step 1- Define a main class HelloWorld. Step 2- Within HelloWord print Hello !! world Hold On.. by using printf method. CODE: //Program for Printing a statement// //......................................// class HelloWord { public static void main(String args[]) { [Link]("Hello !!! World Hold On.."); } }

OUTPUT:

PROGRAM-2

AIM: Write a program to accept two numbers from user and display the summation, difference, product and division of these two numbers. ALGORITHM: 1. Define a class MyMath. 2. Under the MyMath Define a method Addition, this will take two integer arguments. Return the addition of two numbers. 3. In the same manner define method for Subtraction, multiplication, and division. 4. Define a main class DemoMath. 5. Create the object of class MyMath in main class CODE: class MyMath { int num1,num2; int addition(int num1, int num2) { this.num1=num1; this.num2=num2; return num1+num2; } int subtraction(int num1, int num2) {

this.num1=num1; this.num2=num2; return num1-num2; } int multiplication(int num1, int num2) { this.num1=num1; this.num2=num2; return num1*num2; } double division(int num1, int num2) { this.num1=num1; this.num2=num2; double ans= (double)num1/num2; return ans; } }

class DemoMath {

public static void main(String args[]) { int a= [Link]( args[0] ); int b= [Link]( args[1] ); MyMath mm=new MyMath(); double ans=[Link](a,b); [Link]("Addition "+ans); ans=[Link](a,b); [Link]("Subtraction "+ans); ans=[Link](a,b); [Link]("Multiplication "+ans); ans=[Link](a,b); [Link]("division "+ans); } }

OUTPUT:

PROGRAM-3

AIM: Write a program to find if a given number is prime number or not. ALGORITHM: 1. Define a class main class Prime. 2. Receive an integer from console by using parseInt method. 3. Initialize a loop where counter is set to zero and increment the counter by one. Inside the loop check for the condition whether number is divisible by counter. 4. If yes then print Not a prime Number and break. 5. If Counter is equal to number print Prime number. 6. Stop. CODE: class Prime { public static void main(String args[]) { int i; int num=[Link](args[0]); for(i=2;i<num;i++) { if (num%i==0) { [Link]("Not a Prime number !!");

break; } } if(num==i) { [Link]("Prime number"); } } }

OUTPUT:

PROGRAM-4 AIM: Write a program to find if a given number is an Armstrong number or not. ALGORITHM: 1. Start 2. Initialize a main class Armstrong. Receive a number from console in num. 3. Initialize another class A inside this define a method void Armstrong. 4. Declare an integer variable a and store the last digit of num in it by int a=num%10. 5. Declare an integer variable b and store the remaining digits (excluding last) int it. int b=num/10; 6. Like this get each digit of the number. 7. Check for the condition if sum of cube of all digit is equal to the num, then its a Armstrong number else not. CODE: class Armstrong { public static void main(String[] args) { int num=[Link](args[0]); A mya=new A (); [Link](num); } } class A {

void armstrong(int num) { int a=num%10; int b=num/10; int c=b%10; int d=b/10; int ans=(a*a*a)+(c*c*c)+(d*d*d); if (ans==num) { [Link]("Armstrong Number !!"); } else { [Link]("Not an Armstrong Number !"); } } } OUTPUT:

PROGRAM-5

AIM: Write a class for entity Box and count how many objects have been created for the same class. (Use new and static keywords). ALGORITHM: 1. Initialize a class Box1. 2. Inside Box1 initialize a static integer and dimensions of a box. 3. Declare a constructor for class Box1 which accept height, length and breadth. Inside constructor increment the static integer by one. 4. Define a method which will return the volume of box. 5. Define another main class ObjectCount. 6. Inside ObjectCount call the object of class Box1 and pass the value of length, breadth and height. 7. Call the method volume on this object. 8. Print the static integer i. This will give the number of times the object is called. CODE: class Box1 { static int i=0; double hight,bredth,length; Box1(double a, double b, double c) { hight=a; bredth=b;

length=c; i++; } double volume() { return length*bredth*hight; } } class ObjectCount { public static void main(String arg[]) { Box1 mybox=new Box1(3,5,10); double ans=[Link](); [Link]("Volume "+ans); Box1 mybox1=new Box1(6,5,13); ans=[Link](); [Link]("Volume "+ans); [Link]("Object is created"+Box1.i+" times"); } }

OUTPUT:

PROGRAM-6

AIM: Write a program to sort a set of numbers stored in an array using Bubble Sort. ALGORITHM: 1. Define a class MyBubble. Inside MyBubble initialize an array of integer and integer variable len. 2. Initialize a method sort and print the array of integer. 3. Initialize two nested loop which will iterate over the array index. 4. Compare the first number of the array with second number, if first is smaller than the second number; swap them using a temp variable. 5. At end of the loop array element is arranged in decreasing order. 6. Print the array elements. CODE: class MyBubble { int num[]={3,65,3,14,2,9,10,76,72,90,34}; int len=[Link]; void sort() { [Link]("Before sort !!"); for (int i=0;i<len ;i++ ) { [Link](num[i]);

// bubble sort//

for(int a=0;a<len;a++) { for (int j=0;j<len-1 ;j++ ) { if (num[j]<num[j+1]) { int temp=0; temp=num[j]; num[j]=num[j+1]; num[j+1]=temp; } } } [Link]("After sort !!"); for (int i=0;i<len ;i++ ) { [Link](num[i]);

} } } class BubbleSort { public static void main(String args[]) { MyBubble myb = new MyBubble(); [Link](); } }

OUTPUT:

PROGRAM-7 AIM: Write a program to define a class for the entity Car and demonstrate Constructor Overloading. ALGORITHM: 1. Initialize a class Car. 2. Inside Car declare variable of type double for speed, acceleration distance and time. 3. Define a constructor for class Car which takes speed, acceleration, distance and time as argument, define 2nd constructor which takes distance and time as argument. 3rd constructor takes speed, acceleration and time as argument. 4. Define three void methods. 1st method calculates average speed, 2nd method calculates speed after timet, and 3rd method calculate distance covered in timet. All the methods display outcome inside the method body only. 5. Define a main class DemoConstOver and call three object of class Car mycar1, mycar2, and mycar3. Car1 takes distance and time as argument, Car2 takes distance and time as argument and Car3 takes speed, acceleration and time as argument. 6. Call the methods on three objects. 7. Stop. CODE: class Car { double sp,acl,dist,t;

// 1st constructor// Car(double speed, double accel, double distance, double time) {

sp=speed; acl=accel; dist=distance; t=time; }

//2nd constructor//

Car(double distance, double time) { dist=distance; t=time; }

//3rd constructor// Car(double speed, double accel, double time) { sp=speed; acl=accel; t=time; }

//method to calculate average speed// void speed() { double u=dist/t; [Link]("Speed of car "+u);

//method to calculate speed after t time// void speedt() { double v=sp+(ac*t); [Link]("speed after time "+t+" is "+v); }

//method to calculate distance covered after time t// void distance() { double s=(sp*t)+(0.5*ac*t*t); [Link]("Distance covered by car "+s);

} }

class DemoConstOver { public static void main(String args[]) { Car mycar1=new Car(70, 2, 500, 50); Car mycar2=new Car(1000, 20); Car mycar3=new Car(60, 3, 40); [Link](); [Link](); [Link](); } } OUTPUT:

PROGRAM-8 AIM: Write a program to demonstrate Method Overloading by defining a class for Bank Account for calculating Simple Interest and Compound Interest. ALGORITHM: 1. Within class MyAccount initialize integer for principle, time, rate, year, and no of year of type double. 2. Define two methods with name interest, they will accept different arguments. One method will return simple interest and another will return compound interest. 3. Define a main class. Initialize class object and call the two methods on these objects. 4. Display the output on the console. 5. Stop. CODE: import [Link]; class MyAccount { double p, intrst, r, t, year, no_times; //method for simple interest// double interest(double p1, double r1, double t1) { r1=r1/100; intrst=p1*r1*t1; return intrst; }

// method for compound interest// double interest(double p2, double r2, double t2, double no_times1 ) { r2=r2/100; double a=(1+(r2/no_times1)); double b= [Link](a,2); double fin_amnt=b*p2; return fin_amnt; } } class Bank { public static void main(String args[]) { MyAccount ma=new MyAccount(); double ans=[Link](3000, 5.5, 3); [Link]("Simple interest is "+ans); ans=[Link](3000, 4.7, 3, 2); [Link]("Compound interest is "+ans); } }

OUTPUT:

PROGRAM-9 AIM: Write a program to demonstrate Method Over-riding by define a class Shape and inherit two classes from it i.e. Circle and Rectangle. ALGORITHM: 1. Define an abstract super class MyShape. Inside MyShape initialize variables for area, perimeter, length, breadth and radius. 2. Define two abstract classes area and perimeter with void return type and one concrete method void display (). Display() will takes the two string arguments and one double and display them. 3. Define a subclass circle of MyShape, which will accept value of radius through the user defined constructor. Define the method area which will return the area of circle. Define another method perimeter which will return the perimeter of circle. 4. Define a subclass rectangle of MyShape, which accepts the value of breadth and length. Define the method area and perimeter which will return area and perimeter of rectangle respectively. 5. Define a main class DemoMethOver and initialize object of child class circle and rectangle, with appropriate arguments. 6. Call the methods area and perimeter on the object of circle and rectangle. 7. Call the method display() defined in super class. It will print the output on console. 8. Stop. CODE: abstract class MyShape { double area,peri,len,brd,r; double ans=0; abstract double area();

abstract double perimeter(); void display(double ans1, String name1, String name2) { [Link](name1+ "of "+name2+" "+ans1); } } //class circle// class Circle extends MyShape { Circle(double myr)// constructor { r=myr; } double area() //method for area of circle { ans=r*r*3.141; return ans; } double perimeter() //method for perimeter of circle { ans=2*3.141*r;

return ans; } }

//class rectangle// class Rect extends MyShape { Rect(double mylen, double mybrd) //constructor { len=mylen; brd=mybrd; } double area() //method for area of rectangle { ans=len*brd; return ans; } double perimeter() //method for perimeter of rectangle { ans=2*(len+brd); return ans;

} } class DemoMethOver { public static void main(String args[]) { Circle mycircle=new Circle(4.7); Rect myrect=new Rect(3,8); double ans=[Link](); [Link](ans ,"Area" ,"Circle"); ans=[Link](); [Link](ans , "Perimeter " ,"Circle"); ans=[Link](); [Link](ans ,"Area" ,"Rectangle"); ans=[Link](); [Link](ans ,"Perimeter" ,"Circle"); } }

OUTPUT:

PROGRAM-10 AIM: Write a program by defining an Abstract class Gene and inherit three Concrete classes from it one for protein encoding gene, one for tRNA gene and one for rRNA gene. Within the same program, write a Final method in abstract class and display the error. ALGORITHM: 1. Declare an abstract class Gene and declare two methods within this abstract class i.e. one abstract method and one method declared as final. 2. Now, declare three subclasses that inherit the abstract class each named as ProEncGene, Trna and Rrna. Define the abstract and final methods in these subclasses. 3. Now declare the main class and create the objects for each subclass. 4. Call the methods in the subclasses using these object and see for the output. 5. When the final method is called from the objects of the subclasses, error is displayed that the method that is defined as final cannot be over-ridden. 6. Once the call for this final method is removed, the method over-riding is performed successfully and displays the output. 7. Stop CODE: abstract class Gene { String gene="AACGTGTGAGTATCAACGT"; abstract void display(); final void mymethod() {

[Link]("From super class "+gene); }

} class ProEncGene extends Gene { void display() { [Link](" From child class ProEncGene "+ gene); } }

class Trna extends Gene { void display() { [Link](" From Child class tRna "+gene); } } class Rrna extends Gene {

void display() { [Link](" From Child class rRna "+gene); } void mymethod() { [Link](" From child Class Rrna "); } } class DemoFinal { public static void main(String[] args) { ProEncGene a1=new ProEncGene(); Trna a2=new Trna(); Rrna a3=new Rrna(); [Link](); [Link](); [Link](); [Link](); }

} OUTPUT:

PROGRAM-11 AIM: Write a program to calculate molecular weight of a given peptide sequence. ALGORITHM: 1. Define a class ProMolWt and inside it initialize a string for peptide sequence. Define the constructor of this class which takes the peptide sequence when object is called and store it in string pep. 2. Declare a character array and double array which hold the single letter code of amino acid and there corresponding molecular weight respectively. 3. Initialize a variable molwt of type double and another variable i of type int. 4. Define a method for molecular weight calculation. 5. Inside the body of method molwt extract first letter of peptide sequence and compare it with all the elements of array holding single letter code in a cyclic manner. Each time element of peptide string is matched with single letter code takes the corresponding mol wt from molwtdata[] array and add them. Write the statement to print the output. 6. From main class MolWt initialize the object of class ProMolwt and call the method molecularwt() on it.

CODE: class ProMolWt {

String pep; ProMolWt(String pep1 ) {

pep=pep1; } char aa[]={'A','C','D','E','F','G','H','I','K','L','M','N','P','Q','R','S','T','V','W','Y'}; double molwtdata[]={71.0789,103.1386,115.0886,129.115,147.1766,57.0519,137.141,113.1594,128.17 41,113.1594,131.1986,114.1039,97.1167,128.1307,156.1875,87.0752,101.1051,99.13326,186.21 32, 163.06333 }; double molwt=0; int i=0;

//method for molecular weight// void molecularwt() { int len=[Link](); while(i<len) { char amino=[Link](i); for(int j=0;j<20;j++) { if (amino==aa[j]) {

molwt=molwt+molwtdata[j]; } } i++; } molwt=molwt+18.0152;// wt of H and OH [Link]("Molecular "+molwt); } } class MolWeight { public static void main(String args[] ) { ProMolWt ProMolWt("ADHILKMNMVCDHIKL"); [Link](); } } mypro=new Weight of peptide

OUTPUT:

PROGRAM-12

AIM: Write a program to implement Dynamic Method Dispatch. ALGORITHM: 1. Define a super class MyClass, inside it initialize two integer num1 and num2. Define a void method mult(), which will print the multiplication of two numbers. 2. Define a child class YourClass, inside it define a method for multiplication of two numbers and print the output. 3. Define a child class HisClass, inside it define a method for multiplication of two numbers and print the output. 4. Define a main class DemoDyanamic and initialize the object of super class and two child class 5. Create the reference r of super class object and refer it to the object of super class. Call the method on it. It will display the output of method of super class. 6. Refer r to object of two child class and call the methods on it. It will display the output of methods of respective child classes. 7. Stop. CODE: class MyClass { int num1=21; int num2=61; void mult() {

int ans= num1*num2; [Link]("From My class "+ans); } }

class YourClass extends MyClass {

void mult() { int ans= num1*num2; [Link]("From Your class "+ans); } } class HisClass extends MyClass { void mult() { int ans= num1*num2; [Link]("From His class "+ans); }

} class DemoDyanamic { public static void main(String args[]) { MyClass mc=new MyClass(); YourClass yc=new YourClass(); HisClass hc=new HisClass(); MyClass r; r=mc; [Link](); r=yc; [Link](); r=hc; [Link](); } }

OUTPUT:

PROGRAM-13

AIM: Write a program to convert a genomic DNA to its corresponding mRNA sequence using String Buffers. ALGORITHM: 1. Define a main class DnaToRna, initialize a buffer String dna. 2. Get the length of the buffer string by using length() method and store in variable len. 3. Initialize a loop which will run for number of times equivalent to len. Get the index of each nucleotide in the dna string and replace T with A, A with U, G with C, C with G. Store it in rna 4. Reverse the rna and print the output. 5. Stop. CODE: //Program to convert genomic DNA into its corresponding rna// // Main class// class DnaToRnaSts { public static void main(String args[]) { StringBuffer StringBuffer("AATTGATGCGCGTCG"); [Link]("Orignal gDNA :- "+gdna); [Link](""); int len=[Link](); gdna=new

int cap=[Link](); for(int i=0;i<len;i++) {

int post=[Link]("T",i); if(post>=0) [Link] (post, post+1,"a"); int posa=[Link]("A",i); if(posa>=0) [Link] (posa, posa+1,"u"); int posg=[Link]("G",i); if(posg>=0) [Link] (posg, posg+1,"c"); int posc=[Link]("C",i); if(posc>=0) [Link] (posc, posc+1,"g"); } for(int i=0;i<=len;i++) { int post=[Link]("t",i); if(post>=0)

[Link] (post, post+1,"T"); int posa=[Link]("a",i); if(posa>=0) [Link] (posa, posa+1,"A"); int posg=[Link]("g",i); if(posg>=0) [Link] (posg, posg+1,"G"); int posc=[Link]("c",i); if(posc>=0) [Link] (posc, posc+1,"C"); int posu=[Link]("u",i); if(posu>=0) [Link] (posu, posu+1,"U"); } [Link](); [Link]("RNA :- "+gdna); [Link](""); [Link]("Length of gDNA is " +len+" and capacity is "+cap);

} }

OUTPUT:

PROGRAM-14

AIM: Write a program to demonstrate the use of all Package Specifiers in cross-package scenario. ALGORITHM: 1. Define two different packages p1 and p2. 2. In p1, store 4 files named Protection, Derived, Samepackage, Demo wherein extends Derived the properties of Derived. 3. In the Protection, initiate 4 variables having different specifiers and print them. 4. In the Demo again try printing the variables of the Protection. 5. Declare the Demo class public and under the main create objects of each of the classes of p1. Similarly in p2 create 3 files named Protection2, Otherpackage and Demop2 for cross package inherited file , non-inherited file and main class containing file respectively. 6. Now compile the main class containing files of each package in one directory above the package containing directory. 7. Move the .class files of each in the respective packages and then run the code again at 1 directory above the package directory by calling them with the respective package names. CODE: package p1; public class Protection { private int n1=10; int n2=20; protected int n3=30;

public int n4=40; public Protection() { [Link]("In the base class constructor"); [Link]("The private Data member : "+n1); [Link]("The default Data member : "+n2); [Link]("The protected Data Member : "+n3); [Link]("The public data member :"+n4); } } package p1; class Derived extends Protection { Derived() { [Link]("In the same package derived class constructor"); //[Link]("The private Data member : "+n1); [Link]("The default Data member : "+n2); [Link]("The protected Data Member : "+n3); [Link]("The public data member :"+n4); }

} // save following code under file name [Link] package p1; class SamePackage { Protection p=new Protection(); SamePackage() { [Link]("In the same package uninherited class constructor"); //[Link]("The private Data member : "+p.n1); [Link]("The default Data member : "+p.n2); [Link]("The protected Data Member : "+p.n3); [Link]("The public data member :"+p.n4); } }

// save it in under file name [Link] package p1; class Demo { public static void main(String args[])

{ Protection x=new Protection(); Derived y=new Derived(); SamePackage z=new SamePackage(); } } package p2; class Protection2 extends [Link] { Protection2() { [Link]("In the base class constructor"); //[Link]("The private Data member : "+n1); //[Link]("The default Data member : "+n2); [Link]("The protected Data Member : "+n3); [Link]("The public data member :"+n4); } } package p2; class OtherPackage {

[Link] a=new [Link]();

OtherPackage() { [Link]("In the other package uninherited class constructor"); //[Link]("The private Data member : "+a.n1); //[Link]("The default Data member : "+a.n2); //[Link]("The protected Data Member : "+a.n3); [Link]("The public data member :"+a.n4); } } package p2; class Demop2 { public static void main(String args[]) { Protection2 a1=new Protection2(); OtherPackage a2=new OtherPackage(); } }

OUTPUT:

PROGRAM-15 AIM: Write a program by declaring an interface with constant for counting votes with appropriate method declarations. Implement this interface in vote counter class (use Util interfaces). ALGORITHM: 1. Import [Link] package. Define an interface Votes. Initialize integers YES, NO and DONTKNOW. 2. Define a class Election which implements the interface Votes. Generate the random numbers and store them in variable p. 3. If p is greater than 50 return yes, if p is less than 50 return no else return dont know. 4. Define a main class. Within it initialize a method which will print suitable output by utilizing switch-case control statement. 5. Within main initialize the objects of defined classes and call the methods on them. 6. Stop CODE: import [Link]; interface Votes { int YES=0; int NO=1; int DONTKNOW=2; } class Election implements Votes {

Random r=new Random(); int ask() { int p=(int)(100 * [Link]()); if (p<50) return NO; else if (p>50) return YES; else return DONTKNOW; } } class Results implements Votes { static void Answer(int R) { switch(R) { case NO: [Link]("The candidate...!!"); Election result said NO to the

break; case YES: [Link]("The Election Result said YES to the Candidate..!!!"); break; case DONTKNOW: [Link]("The Election Result said DON'T KNOW if the candidate is good or bad...!!"); break; } } public static void main(String args[]) { Election e=new Election(); Answer([Link]()); Answer([Link]()); Answer([Link]()); Answer([Link]()); Answer([Link]()); } } OUTPUT:

PROGRAM-16

AIM: Write a program to accept a Biological sequence from user. If its a peptide sequence; accept it, else throw an error (Use throw and try-catch and make user-defined exceptions). ALGORITHM: 1. Accept a string from the user and store it in a variable. 2. Check each character in this string to match with B, J, O, U, X, Z within a try block. And also check whether it is having only A, T, G, C or not. 3. If each of the characters does not match with the entered string, it is a valid peptide sequence else throw an exception handled by the catch block which is of the user defined category which displays the message that the entered string is an invalid peptide sequence. 4. Thus a user defined exception is thrown and handled.

CODE: class ValidException extends Exception { String msg; ValidException (String s) {msg=s;} } class ValidatePeptide { String pep;

ValidatePeptide(String p) {pep=p;} void validate()throws ValidException { char residues[]=[Link](); int flag=0; for(int x=0;x<[Link];x++) {

if((residues[x]=='B')||(residues[x]=='J')||(residues[x]=='O')||(residues[x]=='U')||(residues[x ]=='X') ||(residues[x]=='Z')) { throw new ValidException("Invalid peptide"); } if ((residues[x]=='A')||(residues[x]=='T')||(residues[x]=='G')||(residues[x]=='C')) { flag++; }

else continue; }

if (flag==[Link]) { [Link]("DNA seq entered"); throw new ValidException("Invalid peptide"); } else { [Link]("valid peptide entered... :) !!! "); } } } class DemoValid { public static void main(String a[]) { String x=a[0]; ValidatePeptide pt=new ValidatePeptide(x); try { [Link](); }

catch(ValidException e) { [Link]("Invalid string entered... :( not a peptide :( "); } } } OUTPUT

PROGRAM-17

AIM:

Write

program

to

demonstrate

the

use

of

ArithmeticException

and

ArrayIndexOutOfBoundException. ALGORITHM: 1. Define a class MyException, inside it initialize two integer variables and an aray of character. 2. Define a method void division(). Write the statement which divides the tow numbers inside the try block. Catch the arithmetic exception with appropriate message. 3. Define another method mymethod() and iterate over the a string using for loop. Write this inside try block. Catch the ArrayIndexOutOfBound exception with appropriate message. 4. Define a main class DemoException and initialize object of class MyException. Call the methods on this object. 5. Stop. CODE: // program for demonstrating Exception handling// class MyException { int num1,num2; char name[]={'b','i','l','a','l'}; MyException(int num3, int num4) //constructor { num1=num3; num2=num4;

} void division() { try { int ans=num1/num2; [Link]("division = "+ans); } catch (ArithmeticException e) { [Link]("Hey cant divide by zero ! "); } } void mymethod() { try { for (int i=-1;i<5 ;i++ )// trying to acssess index -1 { [Link](name[i]); }

} catch (ArrayIndexOutOfBoundsException ai) { [Link]("I am not capable "); } } } class DemoException { public static void main(String[] args) { MyException myex=new MyException(78,0); [Link](); [Link](); }} OUTPUT:

PROGRAM-18

AIM: Write a program by setting an ArithmeticException as a causer exception for the NullPointException and display the necessary data or errors. ALGORITHM: 1. Define a class demoChainedException within it define a static method demoproc of return type void. Within the method initialize the object of class NullPointerException. Call the method initCuase on this object. 2. Within main start a try and catch bloc. Within try call the method demoproc and catch nullPointerException in catch. 3. Display output on the console. 4. Stop CODE: class demoChainedException { static void demoproc() { NullPointerException ne=new NullPointerException("Top Layer Exception"); [Link](new ArithmeticException("Causer Layer Exception")); throw ne; } public static void main(String args[]) {

try { demoproc(); } catch(NullPointerException ane) { [Link]("Caught : "+ane); [Link]("Caught "+[Link]()); } [Link]("Demonstartion od Chained Exceptions "); } }

OUTPUT:

PROGRAM-19

AIM: Write a program to implement -helix detection part of the Chau-Fasman Algorithm ALGORITHM: 1. Declare an string containing amino acid sequence in the main class (psvm). 2. Store all the parameter values of amino acid i.e code, P(a), P(b),P(turn) ,f(i),f(i+1),f(i+2) , f(i+3) Associated with 20 amino acid in 20 different array or 2D array. 3. Iterate over the string starting from index i=0 until the i<=5, check whether any 4 residue has p(a)>100. 4. If step 4 return false repeat the step 3 again starting from i=i+1 index until i<=i+5. 5. Repeat step 3 and 4 until it return true. 6. If step 3 return true, for i=i-1 untill i=i+3, return the average of p(a) of all 4 amino acid. 7. If step 6 return p(a)avg >100, repeat step 6, and 7. [Link] the appropriate message whether core alpha is detected. CODE: // Program for implementation of chaufasman algorithm// class PredictAlpha { String pep; char aa[ ]={'A','R','D','N','C','E','Q','G','H','I','L','K','M','F','P','S','T','W','Y','V'}; doubleparam[ ][ ] = {{142.0,83.0,66.0,0.06,0.076,0.035,0.058},{98,93,95,0.070,0.106,0.099,0.085}, {101,54,146,0.147,0.110,0.179,0.081},{67,89,156,0.161,0.083,0.191,0.091},{70,119,119,0.149, 0.050,0.117,0.128},{151,037,74,0.056,0.060,0.077,0.064},{111,110,98,0.074,0.098,0.037,0.098 },{57,75,156,0.102,0.085,0.190,0.152},{100,87,95,0.140,0.047,0.093,0.054},{108,160,47,0.043, 0.034,0.013,

0.056},{121,130,59,0.061,0.025,0.036,0.070},{114,74,101,0.055,0.115,0.072,0.095},{145,105,6 0,0.068, 0.082 , 0.014 , 0.055},{113 , 138 , 60 , 0.059 , 0.041 , 0.065 , 0.065},{57 , 55 , 152 , 0.102 , 0.301 , 0.034 , 0.068},{77 , 75 , 143 , 0.120 , 0.139 , 0.125 , 0.106 },{83 , 119 , 96 , 0.086 , 0.108 , 0.065 , 0.079},{108 , 137 , 96 , 0.077 , 0.013 , 0.064 , 0.167},{69 , 147 , 114 , 0.082 , 0.065 , 0.114 , 0.125},{106 , 170 , 50 , 0.062 , 0.048 , 0.028 , 0.053}}; PredictAlpha(String pep) { [Link]=pep; } //method to detect core of alpha helix void corealpha(int pos) { int i=0; int counter=0; int len=[Link](); //[Link]("length "+len); for (i=0;pos<=len-6;pos++) { while(i<pos+6) { char amino=[Link](i); for(int a=0; a<20;a++)

{ if (amino==aa[a]) { if(param[a][0]>=100) { counter++; //[Link](amino); } } } i++; } } [Link](""); if(counter>=4) [Link]("core of alpha helix found: "); else [Link]("Core not found"); } } class ChauFasman1

{ public static void main(String args[]) { PredictAlpha myalpha=new PredictAlpha ("PGSIELMQVIEDFIHIVGMGMMDFQNSYLMTGNVVAS"); [Link](0); //[Link](result); } }

OUTPUT:

PROGRAM-20 AIM: Write a program to detect ORF region in a given nucleotide sequence for prokaryotic organism. ALGORITHM: 1. Declare a main class and within it declare a string containing the nucleotide sequence. 2. Now, search for the position of -35 element TTGACA within the nucleotide sequence string using indexOf method. 3. If the -35 element is found, check for the position of -10 element TATAAT downstream of the -35 element again using the indexOf method. 4. Once the position of -10 and -35 elements are found, check for distance between the two which should be of 25 bases exactly. If the condition is not satisfied declare that pseudo promoters were found. 5. Once the condition is satisfied, check for the position of Start codon downstream of the -10 element such that the distance between the -10 element and the Start codon should be exactly 10 bases. 6. If the above condition is satisfied, check for the positions of stop codons downstream of the start codon. 7. Once the position of stop codon is also found, check for the length between the start and stop codon. For a valid ORF to be detected the length should be divisible by 3. Else the valid ORF region in the nucleotide sequence is not found. 8. Display the appropriate results.

CODE: class OrfDemo { public static void main(String[] args) {

String dna = "CGTGTCGTCTTGACACGTGCATGCGTAGTAGTGGTATAATGCTTATGTGCUGUTGA GCGGGGTATGTTTACGTAGTTAGCGTAGCT"; //search for the position of -35 element int pos1=[Link]("TTGACA"); [Link]("TTGACA pos"+pos1); if(pos1>=0) { //check for -10 element downstream to -35 element int pos2=[Link]("TATAAT",pos1+6); [Link]("TATAAT pos"+pos2); //check for the distance between two promoter elements if((pos2-pos1)==25) { //check for the starter codon downstream to -10 element int pos3=[Link]("ATG",pos2+6); [Link]("ATG position "+pos3); if((pos3-pos2)==10) { //check for stopper codon downstream to starter codon int pos4=[Link]("TAG",pos3+3); int pos5=[Link]("TGA",pos3+3);

int pos6=[Link]("TAA",pos3+3); [Link]("TAG pos "+pos4); [Link]("TGA pos "+pos5); [Link]("TAA pos "+pos6); //check for stopper codon position if((pos4>=-1)||(pos5>=-1)||(pos6>=-1)) { //check for the valid length of ORF int i= pos4-pos3; int j=pos5-pos3; int k=pos6-pos3; int li=i%3; int lj=j%3; int lk=k%3; if (i>0) { if (li==0) { [Link]("ORF Found"); } }

if (j>0) { if (lj==0) { [Link]("ORF Found"); } }

if (k>0) { if (lk==0) { [Link]("ORF Found"); } } } else { [Link]("Stopper codon not detected"); }

} else { [Link]("Psuedo promoter elements found"); } } else { [Link]("True promoter elements not found"); } } else { [Link]("Promoter not found");} } } OUTPUT:

You might also like