0% found this document useful (0 votes)
2 views369 pages

HTML 4.0 Specification

The HTML 4.0 Specification defines version 4.0 of the HyperText Markup Language, enhancing multimedia support, accessibility, and internationalization compared to previous versions. It is a W3C Recommendation, endorsed for widespread use, and emphasizes the importance of producing HTML 4.0 documents over older versions for better functionality and interoperability. The document is available in multiple formats and serves as a normative reference for web development.

Uploaded by

okololucas
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd
0% found this document useful (0 votes)
2 views369 pages

HTML 4.0 Specification

The HTML 4.0 Specification defines version 4.0 of the HyperText Markup Language, enhancing multimedia support, accessibility, and internationalization compared to previous versions. It is a W3C Recommendation, endorsed for widespread use, and emphasizes the importance of producing HTML 4.0 documents over older versions for better functionality and interoperability. The document is available in multiple formats and serves as a normative reference for web development.

Uploaded by

okololucas
Copyright
© All Rights Reserved
We take content rights seriously. If you suspect this is your content, claim it here.
Available Formats
Download as PDF, TXT or read online on Scribd

HTML 4.

0 Specification

REC-html40-19980424

HTML 4.0 Specification


W3C Recommendation, revised on 24-Apr-1998

This version:
[Link]
Latest version:
[Link]
Previous version:
[Link]
Editors:
Dave Raggett <dsr@[Link]>
Arnaud Le Hors <lehors@[Link]>
Ian Jacobs <ij@[Link]>

Abstract
This specification defines the HyperText Markup Language (HTML), version 4.0, the publishing language
of the World Wide Web. In addition to the text, multimedia, and hyperlink features of the previous
versions of HTML, HTML 4.0 supports more multimedia options, scripting languages, style sheets, better
printing facilities, and documents that are more accessible to users with disabilities. HTML 4.0 also takes
great strides towards the internationalization of documents, with the goal of making the Web truly World
Wide.

HTML 4.0 is an SGML application conforming to International Standard ISO 8879 -- Standard
Generalized Markup Language [ISO8879] [p.327] .

Status of this document


This document has been reviewed by W3C Members and other interested parties and has been endorsed
by the Director as a W3C Recommendation. It is a stable document and may be used as reference material
or cited as a normative reference from another document. W3C’s role in making the Recommendation is
to draw attention to the specification and to promote its widespread deployment. This enhances the
functionality and interoperability of the Web.

W3C recommends that user agents and authors (and in particular, authoring tools) produce HTML 4.0
documents rather than HTML 3.2 documents (see [HTML32] [p.329] ). For reasons of backwards
compatibility, W3C also recommends that tools interpreting HTML 4.0 continue to support HTML 3.2
and HTML 2.0 as well.

1
Available formats

A list of current W3C Recommendations and other technical documents can be found at
[Link]

Public discussion on HTML features takes place on www-html@[Link].

This document is a revised version of the document first released on 18 December 1997. Changes from the
original version [p.304] are only editorial in nature.

Available formats
The HTML 4.0 W3C Recommendation is also available in the following formats:

A plain text file:


[Link] (735Kb),
A gzip’ed tar file containing HTML documents:
[Link] (357Kb),
A zip file containing HTML documents (this is a ’.zip’ file not an ’.exe’):
[Link] (389Kb),
A gzip’ed Postscript file:
[Link] (600Kb, 367 pages),
A PDF file:
[Link] (2.1Mb) file.

In case of a discrepancy between electronic and printed forms of the specification, the electronic version is
the definitive version.

Available languages
The English version of this specification is the only normative version. However, for translations of this
document, see [Link]

Errata
The list of known errors in this specification is available at:
[Link]

Please report errors in this document to www-html-editor@[Link].

2
Table of Contents

Table of Contents
1. About the HTML 4.0 Specification . . . . . . . . . . . . . . 13
.
1. How the specification is organized . . . . . . . . . . . . . 13
.
2. Document conventions . . . . . . . . . . . . . . . 14
.
1. Elements and attributes . . . . . . . . . . . . . . 14
.
2. Notes and examples . . . . . . . . . . . . . . . 15
.
3. Acknowledgments . . . . . . . . . . . . . . . . 15
.
4. Copyright Notice . . . . . . . . . . . . . . . . . 16
.
2. Introduction to HTML 4.0 . . . . . . . . . . . . . . . . 17
.
1. What is the World Wide Web? . . . . . . . . . . . . . 17
.
1. Introduction to URIs . . . . . . . . . . . . . . . 17
.
2. Fragment identifiers . . . . . . . . . . . . . . . 18
.
3. Relative URIs . . . . . . . . . . . . . . . . 18
.
2. What is HTML? . . . . . . . . . . . . . . . . . 19
.
1. A brief history of HTML . . . . . . . . . . . . . . 19
.
3. HTML 4.0 . . . . . . . . . . . . . . . . . . 20
.
1. Internationalization . . . . . . . . . . . . . . . 20
.
2. Accessibility . . . . . . . . . . . . . . . . 20
.
3. Tables . . . . . . . . . . . . . . . . . . 21
.
4. Compound documents . . . . . . . . . . . . . . 21
.
5. Style sheets . . . . . . . . . . . . . . . . . 21
.
6. Scripting . . . . . . . . . . . . . . . . . 22
.
7. Printing . . . . . . . . . . . . . . . . . . 22
.
4. Authoring documents with HTML 4.0 . . . . . . . . . . . . 22
.
1. Separate structure and presentation . . . . . . . . . . . 22
.
2. Consider universal accessibility to the Web . . . . . . . . . . 22
.
3. Help user agents with incremental rendering . . . . . . . . . 22
.
3. On SGML and HTML . . . . . . . . . . . . . . . . 23
.
1. Introduction to SGML . . . . . . . . . . . . . . . 23
.
2. SGML constructs used in HTML . . . . . . . . . . . . . 24
.
1. Elements . . . . . . . . . . . . . . . . . 24
.
2. Attributes . . . . . . . . . . . . . . . . . 25
.
3. Character references . . . . . . . . . . . . . . . 26
.
4. Comments . . . . . . . . . . . . . . . . . 26
.
3. How to read the HTML DTD . . . . . . . . . . . . . . 27
.
1. DTD Comments . . . . . . . . . . . . . . . . 27
.
2. Parameter entity definitions . . . . . . . . . . . . . 27
.
3. Element declarations . . . . . . . . . . . . . . . 28
.
Content model definitions . . . . . . . . . . . . 28
.
4. Attribute declarations . . . . . . . . . . . . . . 30
.
DTD entities in attribute definitions . . . . . . . . . . 30
.
Boolean attributes . . . . . . . . . . . . . . 31
.

3
Table of Contents

4. Conformance: requirements and recommendations . . . . . . . . . . 33


.
1. Definitions . . . . . . . . . . . . . . . . . . 33
.
2. SGML . . . . . . . . . . . . . . . . . . . 34
.
3. The text/html content type . . . . . . . . . . . . . . . 35
.
5. HTML Document Representation - Character sets, character encodings, and entities . . . 37
.
1. The Document Character Set . . . . . . . . . . . . . . 37
.
2. Character encodings . . . . . . . . . . . . . . . . 38
.
1. Choosing an encoding . . . . . . . . . . . . . . 38
.
Notes on specific encodings . . . . . . . . . . . . 39
.
2. Specifying the character encoding . . . . . . . . . . . . 39
.
3. Character references . . . . . . . . . . . . . . . . 40
.
1. Numeric character references . . . . . . . . . . . . . 41
.
2. Character entity references . . . . . . . . . . . . . 41
.
4. Undisplayable characters . . . . . . . . . . . . . . . 42
.
6. Basic HTML data types - Character data, colors, lengths, URIs, content types, etc. . . . 43
.
1. Case information . . . . . . . . . . . . . . . . 43
.
2. SGML basic types . . . . . . . . . . . . . . . . 44
.
3. Text strings . . . . . . . . . . . . . . . . . . 44
.
4. URIs . . . . . . . . . . . . . . . . . . . 44
.
5. Colors . . . . . . . . . . . . . . . . . . . 45
.
1. Notes on using colors . . . . . . . . . . . . . . . 45
.
6. Lengths . . . . . . . . . . . . . . . . . . . 46
.
7. Content types (MIME types) . . . . . . . . . . . . . . 46
.
8. Language codes . . . . . . . . . . . . . . . . . 47
.
9. Character encodings . . . . . . . . . . . . . . . . 47
.
10. Single characters . . . . . . . . . . . . . . . . . 47
.
11. Dates and times . . . . . . . . . . . . . . . . . 47
.
12. Link types . . . . . . . . . . . . . . . . . . 48
.
13. Media descriptors . . . . . . . . . . . . . . . . 49
.
14. Script data . . . . . . . . . . . . . . . . . . 50
.
15. Style sheet data . . . . . . . . . . . . . . . . . 51
.
16. Frame target names . . . . . . . . . . . . . . . . 51
.
7. The global structure of an HTML document - The HEAD and BODY of a document . . . 53
.
1. Introduction to the structure of an HTML document . . . . . . . . . 53
.
2. HTML version information . . . . . . . . . . . . . . 54
.
3. The HTML element . . . . . . . . . . . . . . . . 55
.
4. The document head . . . . . . . . . . . . . . . . 55
.
1. The HEAD element . . . . . . . . . . . . . . . 55
.
2. The TITLE element . . . . . . . . . . . . . . . 56
.
3. The title attribute . . . . . . . . . . . . . . . 57
.
4. Meta data . . . . . . . . . . . . . . . . . 57
.
Specifying meta data . . . . . . . . . . . . . 58
.
The META element . . . . . . . . . . . . . . 58
.

4
Table of Contents

Meta data profiles . . . . . . . . . . . . . . 61


.
5. The document body . . . . . . . . . . . . . . . . 62
.
1. The BODY element . . . . . . . . . . . . . . . 62
.
2. Element identifiers: the id and class attributes . . . . . . . . 65
.
3. Block-level and inline elements . . . . . . . . . . . . 66
.
4. Grouping elements: the DIV and SPAN elements . . . . . . . . 67
.
5. Headings: The H1, H2, H3, H4, H5, H6 elements . . . . . . . . 68
.
6. The ADDRESS element . . . . . . . . . . . . . . 70
.
8. Language information and text direction - International considerations for text . . . . 71
.
1. Specifying the language of content: the lang attribute . . . . . . . . 71
.
1. Language codes . . . . . . . . . . . . . . . . 72
.
2. Inheritance of language codes . . . . . . . . . . . . . 72
.
3. Interpretation of language codes . . . . . . . . . . . . 73
.
2. Specifying the direction of text and tables: the dir attribute . . . . . . . 73
.
1. Introduction to the bidirectional algorithm . . . . . . . . . . 74
.
2. Inheritance of text direction information . . . . . . . . . . 75
.
3. Setting the direction of embedded text . . . . . . . . . . . 75
.
4. Overriding the bidirectional algorithm: the BDO element . . . . . . . 76
.
5. Character references for directionality and joining control . . . . . . 78
.
6. The effect of style sheets on bidirectionality . . . . . . . . . . 79
.
9. Text - Paragraphs, Lines, and Phrases . . . . . . . . . . . . . 81
.
1. White space . . . . . . . . . . . . . . . . . . 81
.
2. Structured text . . . . . . . . . . . . . . . . . 82
.
1. Phrase elements: EM, STRONG, DFN, CODE, SAMP, KBD, VAR, CITE, ABBR, and
ACRONYM . . . . . . . . . . . . . . . . . 82
.
2. Quotations: The BLOCKQUOTE and Q elements . . . . . . . . . 84
.
Rendering quotations . . . . . . . . . . . . . 85
.
3. Subscripts and superscripts: the SUB and SUP elements . . . . . . . 86
.
3. Lines and Paragraphs . . . . . . . . . . . . . . . . 86
.
1. Paragraphs: the P element . . . . . . . . . . . . . 87
.
2. Controlling line breaks . . . . . . . . . . . . . . 87
.
Forcing a line break: the BR element . . . . . . . . . . 87
.
Prohibiting a line break . . . . . . . . . . . . . 88
.
3. Hyphenation . . . . . . . . . . . . . . . . 88
.
4. Preformatted text: The PRE element . . . . . . . . . . . 88
.
5. Visual rendering of paragraphs . . . . . . . . . . . . 90
.
4. Marking document changes: The INS and DEL elements . . . . . . . . 91
.
10. Lists - Unordered, Ordered, and Definition Lists . . . . . . . . . . . 93
.
1. Introduction to lists . . . . . . . . . . . . . . . . 93
.
2. Unordered lists (UL), ordered lists (OL), and list items (LI) . . . . . . . 94
.
3. Definition lists: the DL, DT, and DD elements . . . . . . . . . . 96
.
1. Visual rendering of lists . . . . . . . . . . . . . . 97
.
4. The DIR and MENU elements . . . . . . . . . . . . . . 99
.

5
Table of Contents

11. Tables . . . . . . . . . . . . . . . . . . . . 101


.
1. Introduction to tables . . . . . . . . . . . . . . . . 101
.
2. Elements for constructing tables . . . . . . . . . . . . . 103
.
1. The TABLE element . . . . . . . . . . . . . . . 103
.
Table directionality . . . . . . . . . . . . . . 105
.
2. Table Captions: The CAPTION element . . . . . . . . . . 105
.
3. Row groups: the THEAD, TFOOT, and TBODY elements . . . . . . . 106
.
4. Column groups: the COLGROUP and COL elements . . . . . . . . 108
.
The COLGROUP element . . . . . . . . . . . . . 108
.
The COL element . . . . . . . . . . . . . . 110
.
Calculating the number of columns in a table . . . . . . . . 111
.
Calculating the width of columns . . . . . . . . . . . 112
.
5. Table rows: The TR element . . . . . . . . . . . . . 114
.
6. Table cells: The TH and TD elements . . . . . . . . . . . 114
.
Cells that span several rows or columns . . . . . . . . . 117
.
3. Table formatting by visual user agents . . . . . . . . . . . . 119
.
1. Borders and rules . . . . . . . . . . . . . . . 119
.
2. Horizontal and vertical alignment . . . . . . . . . . . . 121
.
Inheritance of alignment specifications . . . . . . . . . . 123
.
3. Cell margins . . . . . . . . . . . . . . . . 124
.
4. Table rendering by non-visual user agents . . . . . . . . . . . 125
.
1. Associating header information with data cells . . . . . . . . . 125
.
2. Categorizing cells . . . . . . . . . . . . . . . 128
.
3. Algorithm to find heading information . . . . . . . . . . . 131
.
5. Sample table . . . . . . . . . . . . . . . . . . 132
.
12. Links - Hypertext and Media-Independent Links . . . . . . . . . . . 135
.
1. Introduction to links and anchors . . . . . . . . . . . . . 135
.
1. Visiting a linked resource . . . . . . . . . . . . . 135
.
2. Other link relationships . . . . . . . . . . . . . . 137
.
3. Specifying anchors and links . . . . . . . . . . . . . 137
.
4. Link titles . . . . . . . . . . . . . . . . . 138
.
5. Internationalization and links . . . . . . . . . . . . . 138
.
2. The A element . . . . . . . . . . . . . . . . . 138
.
1. Syntax of anchor names . . . . . . . . . . . . . . 141
.
2. Nested links are illegal . . . . . . . . . . . . . . 142
.
3. Anchors with the id attribute . . . . . . . . . . . . . 142
.
4. Unavailable and unidentifiable resources . . . . . . . . . . 143
.
3. Document relationships: the LINK element . . . . . . . . . . . 143
.
1. Forward and reverse links . . . . . . . . . . . . . 144
.
2. Links and external style sheets . . . . . . . . . . . . 144
.
3. Links and search engines . . . . . . . . . . . . . . 145
.
4. Path information: the BASE element . . . . . . . . . . . . 146
.
1. Resolving relative URIs . . . . . . . . . . . . . . 147
.

6
Table of Contents

13. Objects, Images, and Applets . . . . . . . . . . . . . . . 149


.
1. Introduction to objects, images, and applets . . . . . . . . . . . 149
.
2. Including an image: the IMG element . . . . . . . . . . . . 150
.
3. Generic inclusion: the OBJECT element . . . . . . . . . . . 152
.
1. Rules for rendering objects . . . . . . . . . . . . . 154
.
2. Object initialization: the PARAM element . . . . . . . . . . 156
.
3. Global naming schemes for objects . . . . . . . . . . . 158
.
4. Object declarations and instantiations . . . . . . . . . . . 158
.
4. Including an applet: the APPLET element . . . . . . . . . . . 160
.
5. Notes on embedded documents . . . . . . . . . . . . . 162
.
6. Image maps . . . . . . . . . . . . . . . . . . 162
.
1. Client-side image maps: the MAP and AREA elements . . . . . . . 163
.
Client-side image map examples . . . . . . . . . . . 165
.
2. Server-side image maps . . . . . . . . . . . . . . 167
.
7. Visual presentation of images, objects, and applets . . . . . . . . . 168
.
1. Width and height . . . . . . . . . . . . . . . 168
.
2. White space around images and objects . . . . . . . . . . 168
.
3. Borders . . . . . . . . . . . . . . . . . 168
.
4. Alignment . . . . . . . . . . . . . . . . . 169
.
8. How to specify alternate text . . . . . . . . . . . . . . 169
.
14. Style Sheets - Adding style to HTML documents . . . . . . . . . . . 171
.
1. Introduction to style sheets . . . . . . . . . . . . . . 171
.
2. Adding style to HTML . . . . . . . . . . . . . . . 173
.
1. Setting the default style sheet language . . . . . . . . . . . 173
.
2. Inline style information . . . . . . . . . . . . . . 174
.
3. Header style information: the STYLE element . . . . . . . . . 174
.
4. Media types . . . . . . . . . . . . . . . . . 177
.
3. External style sheets . . . . . . . . . . . . . . . . 177
.
1. Preferred and alternate style sheets . . . . . . . . . . . 178
.
2. Specifying external style sheets . . . . . . . . . . . . 178
.
4. Cascading style sheets . . . . . . . . . . . . . . . 179
.
1. Media-dependent cascades . . . . . . . . . . . . . 180
.
2. Inheritance and cascading . . . . . . . . . . . . . . 180
.
5. Hiding style data from user agents . . . . . . . . . . . . . 181
.
6. Linking to style sheets with HTTP headers . . . . . . . . . . . 181
.
15. Alignment, font styles, and horizontal rules . . . . . . . . . . . . 183
.
1. Formatting . . . . . . . . . . . . . . . . . . 183
.
1. Background color . . . . . . . . . . . . . . . 183
.
2. Alignment . . . . . . . . . . . . . . . . . 183
.
3. Floating objects . . . . . . . . . . . . . . . . 185
.
Float an object . . . . . . . . . . . . . . . 185
.
Float text around an object . . . . . . . . . . . . 186
.
2. Fonts . . . . . . . . . . . . . . . . . . . 187
.

7
Table of Contents

1. Font style elements: the TT, I, B, BIG, SMALL, STRIKE, S, and U elements . . 187
.
2. Font modifier elements: FONT and BASEFONT . . . . . . . . . 188
.
3. Rules: the HR element . . . . . . . . . . . . . . . . 190
.
16. Frames - Multi-view presentation of documents . . . . . . . . . . . 193
.
1. Introduction to frames . . . . . . . . . . . . . . . 193
.
2. Layout of frames . . . . . . . . . . . . . . . . 194
.
1. The FRAMESET element . . . . . . . . . . . . . . 194
.
Rows and columns . . . . . . . . . . . . . . 195
.
Nested frame sets . . . . . . . . . . . . . . 196
.
Sharing data among frames . . . . . . . . . . . . 196
.
2. The FRAME element . . . . . . . . . . . . . . . 197
.
Setting the initial contents of a frame . . . . . . . . . . 198
.
Visual rendering of a frame . . . . . . . . . . . . 199
.
3. Specifying target frame information . . . . . . . . . . . . 200
.
1. Setting the default target for links . . . . . . . . . . . . 201
.
2. Target semantics . . . . . . . . . . . . . . . . 202
.
4. Alternate content . . . . . . . . . . . . . . . . 202
.
1. The NOFRAMES element . . . . . . . . . . . . . . 202
.
2. Long descriptions of frames . . . . . . . . . . . . . 203
.
5. Inline frames: the IFRAME element . . . . . . . . . . . . . 204
.
17. Forms - User-input Forms: Text Fields, Buttons, Menus, and more . . . . . . . 207
.
1. Introduction to forms . . . . . . . . . . . . . . . . 207
.
2. Controls . . . . . . . . . . . . . . . . . . 208
.
1. Control types . . . . . . . . . . . . . . . . 208
.
3. The FORM element . . . . . . . . . . . . . . . . 210
.
4. The INPUT element . . . . . . . . . . . . . . . . 211
.
1. Control types created with INPUT . . . . . . . . . . . . 213
.
2. Examples of forms containing INPUT controls . . . . . . . . . 214
.
5. The BUTTON element . . . . . . . . . . . . . . . 215
.
6. The SELECT, OPTGROUP, and OPTION elements . . . . . . . . . 217
.
1. Preselected options . . . . . . . . . . . . . . . 218
.
7. The TEXTAREA element . . . . . . . . . . . . . . . 221
.
8. The ISINDEX element . . . . . . . . . . . . . . . 223
.
9. Labels . . . . . . . . . . . . . . . . . . . 223
.
1. The LABEL element . . . . . . . . . . . . . . . 224
.
10. Adding structure to forms: the FIELDSET and LEGEND elements . . . . . . 225
.
11. Giving focus to an element . . . . . . . . . . . . . . 227
.
1. Tabbing navigation . . . . . . . . . . . . . . . 228
.
2. Access keys . . . . . . . . . . . . . . . . . 229
.
12. Disabled and read-only controls . . . . . . . . . . . . . 230
.
1. Disabled controls . . . . . . . . . . . . . . . 230
.
2. Read-only controls . . . . . . . . . . . . . . . 231
.
13. Form submission . . . . . . . . . . . . . . . . 231
.

8
Table of Contents

1. Form submission method . . . . . . . . . . . . . . 231


.
2. Successful controls . . . . . . . . . . . . . . . 232
.
3. Processing form data . . . . . . . . . . . . . . . 233
.
Step one: Identify the successful controls . . . . . . . . . 233
.
Step two: Build a form data set . . . . . . . . . . . 233
.
Step three: Encode the form data set . . . . . . . . . . 233
.
Step four: Submit the encoded form data set . . . . . . . . 233
.
4. Form content types . . . . . . . . . . . . . . . 234
.
application/x-www-form-urlencoded . . . . . . . . . . 234
.
multipart/form-data . . . . . . . . . . . . . . 234
.
18. Scripts - Animated Documents and Smart Forms . . . . . . . . . . . 237
.
1. Introduction to scripts . . . . . . . . . . . . . . . 237
.
2. Designing documents for user agents that support scripting . . . . . . . 238
.
1. The SCRIPT element . . . . . . . . . . . . . . 238
.
2. Specifying the scripting language . . . . . . . . . . . . 239
.
The default scripting language . . . . . . . . . . . 239
.
Local declaration of a scripting language . . . . . . . . . 239
.
References to HTML elements from a script . . . . . . . . 240
.
3. Intrinsic events . . . . . . . . . . . . . . . . 240
.
4. Dynamic modification of documents . . . . . . . . . . . 243
.
3. Designing documents for user agents that don’t support scripting . . . . . . 244
.
1. The NOSCRIPT element . . . . . . . . . . . . . . 244
.
2. Hiding script data from user agents . . . . . . . . . . . . 245
.
19. SGML reference information for HTML - Formal definition of HTML and validation . . 247
.
1. Document Validation . . . . . . . . . . . . . . . . 247
.
2. Sample SGML catalog . . . . . . . . . . . . . . . 248
.
20. SGML Declaration of HTML 4.0 . . . . . . . . . . . . . . 249
.
1. SGML Declaration . . . . . . . . . . . . . . . . 249
.
21. Document Type Definition . . . . . . . . . . . . . . . 251
.
22. Transitional Document Type Definition . . . . . . . . . . . . . 267
.
23. Frameset Document Type Definition . . . . . . . . . . . . . 287
.
24. Character entity references in HTML 4.0 . . . . . . . . . . . . 289
.
1. Introduction to character entity references . . . . . . . . . . . 289
.
2. Character entity references for ISO 8859-1 characters . . . . . . . . 289
.
1. The list of characters . . . . . . . . . . . . . . . 290
.
3. Character entity references for symbols, mathematical symbols, and Greek letters . . 293
.
1. The list of characters . . . . . . . . . . . . . . . 294
.
4. Character entity references for markup-significant and internationalization characters . 298
.
1. The list of characters . . . . . . . . . . . . . . . 298
.

A. Changes . . . . . . . . . . . . . . . . . . . . 301
.
1. Changes between HTML 3.2 and HTML 4.0 . . . . . . . . . . 301
.
1. Changes to elements . . . . . . . . . . . . . . . 301
.
New elements . . . . . . . . . . . . . . . 301
.

9
Table of Contents

Deprecated elements . . . . . . . . . . . . . 301


.
Obsolete elements . . . . . . . . . . . . . . 302
.
2. Changes to attributes . . . . . . . . . . . . . . . 302
.
3. Changes for accessibility . . . . . . . . . . . . . . 302
.
4. Changes for meta data . . . . . . . . . . . . . . 302
.
5. Changes for text . . . . . . . . . . . . . . . . 302
.
6. Changes for links . . . . . . . . . . . . . . . 302
.
7. Changes for tables . . . . . . . . . . . . . . . 302
.
8. Changes for images, objects, and image maps . . . . . . . . . 303
.
9. Changes for forms . . . . . . . . . . . . . . . 303
.
10. Changes for style sheets . . . . . . . . . . . . . . 304
.
11. Changes for frames . . . . . . . . . . . . . . . 304
.
12. Changes for scripting . . . . . . . . . . . . . . 304
.
13. Changes for internationalization . . . . . . . . . . . . 304
.
2. Changes from the 18 December 1997 specification . . . . . . . . . 304
.
1. Errors that were corrected . . . . . . . . . . . . . 305
.
2. Minor typographical errors that were corrected . . . . . . . . . 307
.
B. Performance, Implementation, and Design Notes . . . . . . . . . . . 309
.
1. Notes on invalid documents . . . . . . . . . . . . . . 310
.
2. Special characters in URI attribute values . . . . . . . . . . . 310
.
1. Non-ASCII characters in URI attribute values . . . . . . . . . 310
.
2. Ampersands in URI attribute values . . . . . . . . . . . 311
.
3. SGML implementation notes . . . . . . . . . . . . . . 311
.
1. Line breaks . . . . . . . . . . . . . . . . . 311
.
2. Specifying non-HTML data . . . . . . . . . . . . . 312
.
Element content . . . . . . . . . . . . . . 312
.
Attribute values . . . . . . . . . . . . . . . 313
.
3. SGML features with limited support . . . . . . . . . . . 313
.
4. Boolean attributes . . . . . . . . . . . . . . . 313
.
5. Marked Sections . . . . . . . . . . . . . . . 313
.
6. Processing Instructions . . . . . . . . . . . . . . 314
.
7. Shorthand markup . . . . . . . . . . . . . . . 314
.
4. Notes on helping search engines index your Web site . . . . . . . . . 315
.
1. Search robots . . . . . . . . . . . . . . . . 316
.
The [Link] file . . . . . . . . . . . . . . 316
.
Robots and the META element . . . . . . . . . . . 317
.
5. Notes on tables . . . . . . . . . . . . . . . . . 317
.
1. Design rationale . . . . . . . . . . . . . . . . 317
.
Dynamic reformatting . . . . . . . . . . . . . 318
.
Incremental display . . . . . . . . . . . . . . 318
.
Structure and presentation . . . . . . . . . . . . 318
.
Row and column groups . . . . . . . . . . . . . 319
.
Accessibility . . . . . . . . . . . . . . . 319
.

10
Table of Contents

2. Recommended Layout Algorithms . . . . . . . . . . . 319


.
Fixed Layout Algorithm . . . . . . . . . . . . . 320
.
Autolayout Algorithm . . . . . . . . . . . . . 320
.
6. Notes on forms . . . . . . . . . . . . . . . . . 322
.
1. Incremental display . . . . . . . . . . . . . . . 322
.
2. Future projects . . . . . . . . . . . . . . . . 322
.
7. Notes on scripting . . . . . . . . . . . . . . . . 323
.
1. Reserved syntax for future script macros . . . . . . . . . . 323
.
Current Practice for Script Macros . . . . . . . . . . . 323
.
8. Notes on frames . . . . . . . . . . . . . . . . . 324
.
9. Notes on accessibility . . . . . . . . . . . . . . . 325
.
10. Notes on security . . . . . . . . . . . . . . . . 325
.
1. Security issues for forms . . . . . . . . . . . . . . 325
.

References . . . . . . . . . . . . . . . . . . . 327
.
1. Normative references . . . . . . . . . . . . . . . . 327
.
2. Informative references . . . . . . . . . . . . . . . 329
.
Index of Elements . . . . . . . . . . . . . . . . . 333
.
Index of Attributes . . . . . . . . . . . . . . . . . 337
.
Index . . . . . . . . . . . . . . . . . . . . 353
.

Copyright [p.16] © 1997 W3C (MIT, INRIA, Keio ), All Rights Reserved.

11
Table of Contents

12
1 About the HTML 4.0 Specification

1 About the HTML 4.0 Specification


Contents

1. How the specification is organized . . . . . . . . . . . . . . 13


.
2. Document conventions . . . . . . . . . . . . . . . . 14
.
1. Elements and attributes . . . . . . . . . . . . . . . 14
.
2. Notes and examples . . . . . . . . . . . . . . . . 15
.
3. Acknowledgments . . . . . . . . . . . . . . . . . 15
.
4. Copyright Notice . . . . . . . . . . . . . . . . . . 16
.

1.1 How the specification is organized


This specification is divided into the following sections:

Sections 2 and 3: Introduction to HTML 4.0


The introduction describes HTML’s place in the scheme of the World Wide Web, provides a brief
history of the development of HTML, highlights what can be done with HTML 4.0, and provides
some HTML authoring tips.

The brief SGML tutorial gives readers some understanding of HTML’s relationship to SGML and
gives summary information on how to read the HTML Document Type Definition (DTD).
Sections 4 - 24: HTML 4.0 reference manual
The bulk of the reference manual consists of the HTML language reference, which defines all
elements and attributes of the language.

This document has been organized by topic rather than by the grammar of HTML. Topics are
grouped into three categories: structure, presentation, and interactivity. Although it is not easy to
divide HTML constructs perfectly into these three categories, the model reflects the HTML Working
Group’s experience that separating a document’s structure from its presentation produces more
effective and maintainable documents.

The language reference consists of the following information:

What characters [p.37] may appear in an HTML document.

Basic data types [p.43] of an HTML document.

Elements that govern the structure of an HTML document, including text [p.81] , lists [p.93] ,
tables [p.101] , links [p.135] , and included objects, images, and applets [p.149] .

Elements that govern the presentation of an HTML document, including style sheets [p.171] ,
fonts, colors, rules, and other visual presentation [p.183] , and frames for multi-windowed
presentations [p.193] .

13
1.2 Document conventions

Elements that govern interactivity with an HTML document, including forms for user input
[p.207] and scripts for active documents [p.237] .

The SGML formal definition of HTML:


The SGML declaration of HTML [p.249] .
Three DTDs: strict [p.251] , transitional [p.267] , and frameset [p.287] .
The list of character references [p.289] .
Appendixes
The first appendix contains information about changes from HTML 3.2 [p.301] to help authors and
implementors with the transition to HTML 4.0, and changes from the 18 December 1997
specification [p.304] . The second appendix contains performance and implementation notes [p.309] ,
and is primarily intended to help implementors create user agents for HTML 4.0.
References
A list of normative and informative references.
Indexes
Three indexes give readers rapid access to the definition of key concepts [p.353] , elements [p.333]
and attributes [p.337] .

1.2 Document conventions


This document has been written with two types of readers in mind: authors and implementors. We hope
the specification will provide authors with the tools they need to write efficient, attractive, and accessible
documents, without over-exposing them to HTML’s implementation details. Implementors, however,
should find all they need to build conforming user agents.

The specification may be approached in several ways:

Read from beginning to end. The specification begins with a general presentation of HTML and
becomes more and more technical and specific towards the end.
Quick access to information. In order to get information about syntax and semantics as quickly as
possible, the online version of the specification includes the following features:
1. Every reference to an element or attribute is linked to its definition in the specification. Each
element or attribute is defined in only one location.
2. Every page includes links to the indexes, so you never are more than two links away from
finding the definition of an element [p.333] or attribute [p.337] .

3. The front pages of the three sections of the language reference manual extend the initial table of
contents with more detail about each section.

1.2.1 Elements and attributes


Element names are written in uppercase letters (e.g., BODY). Attribute names are written in lowercase
letters (e.g., lang, onsubmit). Recall that in HTML, element and attribute names are case-insensitive; the
convention is meant to encourage readability.

14
1.3 Acknowledgments

Element and attribute names in this document have been marked up and may be rendered specially by
some user agents.

Each attribute definition specifies the type of its value. If the type allows a small set of possible values, the
definition lists the set of values, separated by a bar (|).

After the type information, each attribute definition indicates the case-sensitivity of its values, between
square brackets ("[]"). See the section on case information [p.43] for details.

1.2.2 Notes and examples


Informative notes are emphasized to stand out from surrounding text and may be rendered specially by
some user agents.

All examples illustrating deprecated [p.34] usage are marked as "DEPRECATED EXAMPLE".
Deprecated examples also include recommended alternate solutions. All examples that illustrates illegal
usage are clearly marked "ILLEGAL EXAMPLE".

Examples and notes have been marked up and may be rendered specially by some user agents.

1.3 Acknowledgments
Thanks to everyone who has helped to author the working drafts that went into the HTML 4.0
specification, and to all those who have sent suggestions and corrections.

Many thanks to the Web Accessibility Initiative task force (WAI HC group) for their work on improving
the accessibility of HTML and to T.V. Raman (Adobe) for his early work on developing accessible forms.

The authors of this specification, the members of the W3C HTML Working Group, deserve much
applause for their diligent review of this document, their constructive comments, and their hard work:
John D. Burger (MITRE), Steve Byrne (JavaSoft), Martin J. Dürst (University of Zurich), Daniel Glazman
(Electricité de France), Scott Isaacs (Microsoft), Murray Maloney (GRIF), Steven Pemberton (CWI),
Robert Pernett (Lotus), Jared Sorensen (Novell), Powell Smith (IBM), Robert Stevahn (HP), Ed Tecot
(Microsoft), Jeffrey Veen (HotWired), Mike Wexler (Adobe), Misha Wolf (Reuters), and Lauren Wood
(SoftQuad).

Thank you Dan Connolly (W3C) for rigorous and bountiful input as part-time editor and thoughtful
guidance as chairman of the HTML Working Group. Thank you Sally Khudairi (W3C) for your
indispensable work on press releases.

Thanks to David M. Abrahamson and Roger Price for their careful reading of the specification and
constructive comments.

Thanks to Jan Kärrman, author of html2ps for helping so much in creating the Postscript version of the
specification.

15
1.4 Copyright Notice

Of particular help from the W3C at Sophia-Antipolis were Janet Bertot, Bert Bos, Stephane Boyera,
Daniel Dardailler, Yves Lafon, Håkon Lie, Chris Lilley, and Colas Nahaboo (Bull).

Lastly, thanks to Tim Berners-Lee without whom none of this would have been possible.

1.4 Copyright Notice


Copyright © 1997 World Wide Web Consortium, (Massachusetts Institute of Technology, Institut
National de Recherche en Informatique et en Automatique, Keio University). All Rights Reserved.

Documents on the W3C site are provided by the copyright holders under the following license. By
obtaining, using and/or copying this document, or the W3C document from which this statement is linked,
you agree that you have read, understood, and will comply with the following terms and conditions:

Permission to use, copy, and distribute the contents of this document, or the W3C document from which
this statement is linked, in any medium for any purpose and without fee or royalty is hereby granted,
provided that you include the following on ALL copies of the document, or portions thereof, that you use:

1. A link or URI to the original W3C document.


2. The pre-existing copyright notice of the original author, if it doesn’t exist, a notice of the form:
"Copyright © World Wide Web Consortium, (Massachusetts Institute of Technology, Institut
National de Recherche en Informatique et en Automatique, Keio University). All Rights Reserved."
3. If it exists, the STATUS of the W3C document.

When space permits, inclusion of the full text of this NOTICE should be provided. In addition, credit
shall be attributed to the copyright holders for any software, documents, or other items or products that
you create pursuant to the implementation of the contents of this document, or any portion thereof.

No right to create modifications or derivatives is granted pursuant to this license.

THIS DOCUMENT IS PROVIDED "AS IS," AND COPYRIGHT HOLDERS MAKE NO


REPRESENTATIONS OR WARRANTIES, EXPRESS OR IMPLIED, INCLUDING, BUT NOT
LIMITED TO, WARRANTIES OF MERCHANTABILITY, FITNESS FOR A PARTICULAR
PURPOSE, NON-INFRINGEMENT, OR TITLE; THAT THE CONTENTS OF THE
DOCUMENT ARE SUITABLE FOR ANY PURPOSE; NOR THAT THE IMPLEMENTATION
OF SUCH CONTENTS WILL NOT INFRINGE ANY THIRD PARTY PATENTS,
COPYRIGHTS, TRADEMARKS OR OTHER RIGHTS.

COPYRIGHT HOLDERS WILL NOT BE LIABLE FOR ANY DIRECT, INDIRECT, SPECIAL
OR CONSEQUENTIAL DAMAGES ARISING OUT OF ANY USE OF THE DOCUMENT OR
THE PERFORMANCE OR IMPLEMENTATION OF THE CONTENTS THEREOF.

The name and trademarks of copyright holders may NOT be used in advertising or publicity pertaining to
this document or its contents without specific, written prior permission. Title to copyright in this
document will at all times remain with copyright holders.

16
2 Introduction to HTML 4.0

2 Introduction to HTML 4.0


Contents

1. What is the World Wide Web? . . . . . . . . . . . . . . . 17


.
1. Introduction to URIs . . . . . . . . . . . . . . . . 17
.
2. Fragment identifiers . . . . . . . . . . . . . . . . 18
.
3. Relative URIs . . . . . . . . . . . . . . . . . 18
.
2. What is HTML? . . . . . . . . . . . . . . . . . . 19
.
1. A brief history of HTML . . . . . . . . . . . . . . . 19
.
3. HTML 4.0 . . . . . . . . . . . . . . . . . . . 20
.
1. Internationalization . . . . . . . . . . . . . . . . 20
.
2. Accessibility . . . . . . . . . . . . . . . . . 20
.
3. Tables . . . . . . . . . . . . . . . . . . . 21
.
4. Compound documents . . . . . . . . . . . . . . . 21
.
5. Style sheets . . . . . . . . . . . . . . . . . . 21
.
6. Scripting . . . . . . . . . . . . . . . . . . 22
.
7. Printing . . . . . . . . . . . . . . . . . . . 22
.
4. Authoring documents with HTML 4.0 . . . . . . . . . . . . . 22
.
1. Separate structure and presentation . . . . . . . . . . . . . 22
.
2. Consider universal accessibility to the Web . . . . . . . . . . . 22
.
3. Help user agents with incremental rendering . . . . . . . . . . . 22
.

2.1 What is the World Wide Web?


The World Wide Web (Web) is a network of information resources. The Web relies on three mechanisms
to make these resources readily available to the widest possible audience:

1. A uniform naming scheme for locating resources on the Web (e.g., URIs).
2. Protocols, for access to named resources over the Web (e.g., HTTP).
3. Hypertext, for easy navigation among resources (e.g., HTML).

The ties between the three mechanisms are apparent throughout this specification.

2.1.1 Introduction to URIs


Every resource available on the Web -- HTML document, image, video clip, program, etc. -- has an
address that may be encoded by a Universal Resource Identifier, or "URI".

URIs typically consist of three pieces:

1. The naming scheme of the mechanism used to access the resource.


2. The name of the machine hosting the resource.
3. The name of the resource itself, given as a path.

17
2.1.2 Fragment identifiers

Consider the URI that designates the current HTML specification:


[Link]

This URI may be read as follows: There is a document available via the HTTP protocol (see [RFC2068]
[p.328] ), residing on the machine [Link], accessible via the path "/TR/REC-html4/". Other schemes
you may see in HTML documents include "mailto" for email and "ftp" for FTP.

Here is another example of a URI. This one refers to a user’s mailbox:


...this is text...
For all comments, please send email to
<A href="[Link] Cool</A>.

Note. Most readers may be familiar with the term "URL" and not the term "URI". URLs form a subset of
the more general URI naming scheme.

2.1.2 Fragment identifiers


Some URIs refer to a location within a resource. This kind of URI ends with "#" followed by an anchor
identifier (called the fragment identifier). For instance, here is a URI pointing to an anchor named
section_2:
[Link]

2.1.3 Relative URIs


A relative URI doesn’t contain any naming scheme information. Its path generally refers to a resource on
the same machine as the current document. Relative URIs may contain relative path components (e.g., ".."
means one level up in the hierarchy defined by the path), and may contain fragment identifiers [p.18] .

Relative URIs are resolved to full URIs [p.147] using a base URI. As an example of relative URI
resolution, assume we have the base URI "[Link] The relative URI in
the following markup for a hypertext link:
<A href="[Link]">Suppliers</A>

would expand to the full URI "[Link] while the relative URI in
the following markup for an image
<IMG src="../icons/[Link]" alt="logo">

would expand to the full URI "[Link]

In HTML, URIs are used to:

Link to another document or resource, (see the A and LINK elements).


Link to an external style sheet or script (see the LINK and SCRIPT elements).
Include an image, object, or applets in a page, (see the IMG, OBJECT, APPLET and INPUT
elements).

18
2.2 What is HTML?

Create an image map (see the MAP and AREA elements).


Submit a form (see FORM).
Create a frame document (see the FRAME and IFRAME elements).
Cite an external reference (see the Q, BLOCKQUOTE, INS and DEL elements).
Refer to metadata conventions describing a document (see the HEAD element).

Please consult the section on the URI [p.44] type for more information about URIs.

2.2 What is HTML?


To publish information for global distribution, one needs a universally understood language, a kind of
publishing mother tongue that all computers may potentially understand. The publishing language used by
the World Wide Web is HTML (from HyperText Markup Language).

HTML gives authors the means to:

Publish online documents with headings, text, tables, lists, photos, etc.
Retrieve online information via hypertext links, at the click of a button.
Design forms for conducting transactions with remote services, for use in searching for information,
making reservations, ordering products, etc.
Include spread-sheets, video clips, sound clips, and other applications directly in their documents.

2.2.1 A brief history of HTML


HTML was originally developed by Tim Berners-Lee while at CERN, and popularized by the Mosaic
browser developed at NCSA. During the course of the 1990s it has blossomed with the explosive growth
of the Web. During this time, HTML has been extended in a number of ways. The Web depends on Web
page authors and vendors sharing the same conventions for HTML. This has motivated joint work on
specifications for HTML.

HTML 2.0 (November 1995, see [RFC1866] [p.330] ) was developed under the aegis of the Internet
Engineering Task Force (IETF) to codify common practice in late 1994. HTML+ (1993) and HTML 3.0
(1995, see [HTML30] [p.329] ) proposed much richer versions of HTML. Despite never receiving
consensus in standards discussions, these drafts led to the adoption of a range of new features. The efforts
of the World Wide Web Consortium’s HTML Working Group to codify common practice in 1996
resulted in HTML 3.2 (January 1997, see [HTML32] [p.329] ). Changes from HTML 3.2 are summarized
in Appendix A [p.301]

Most people agree that HTML documents should work well across different browsers and platforms.
Achieving interoperability lowers costs to content providers since they must develop only one version of a
document. If the effort is not made, there is much greater risk that the Web will devolve into a proprietary
world of incompatible formats, ultimately reducing the Web’s commercial potential for all participants.

Each version of HTML has attempted to reflect greater consensus among industry players so that the
investment made by content providers will not be wasted and that their documents will not become
unreadable in a short period of time.

19
2.3 HTML 4.0

HTML has been developed with the vision that all manner of devices should be able to use information on
the Web: PCs with graphics displays of varying resolution and color depths, cellular telephones, hand held
devices, devices for speech for output and input, computers with high or low bandwidth, and so on.

2.3 HTML 4.0


HTML 4.0 extends HTML with mechanisms for style sheets, scripting, frames, embedding objects,
improved support for right to left and mixed direction text, richer tables, and enhancements to forms,
offering improved accessibility for people with disabilities.

2.3.1 Internationalization
This version of HTML has been designed with the help of experts in the field of internationalization, so
that documents may be written in every language and be transported easily around the world. This has
been accomplished by incorporating [RFC2070] [p.330] , which deals with the internationalization of
HTML.

One important step has been the adoption of the ISO/IEC:10646 standard (see [ISO10646] [p.327] ) as the
document character set for HTML. This is the world’s most inclusive standard dealing with issues of the
representation of international characters, text direction, punctuation, and other world language issues.

HTML now offers greater support for diverse human languages within a document. This allows for more
effective indexing of documents for search engines, higher-quality typography, better text-to-speech
conversion, better hyphenation, etc.

2.3.2 Accessibility
As the Web community grows and its members diversify in their abilities and skills, it is crucial that the
underlying technologies be appropriate to their specific needs. HTML has been designed to make Web
pages more accessible to those with physical limitations. HTML 4.0 developments inspired by concerns
for accessibility include:

Better distinction between document structure and presentation, thus encouraging the use of style
sheets instead of HTML presentation elements and attributes.
Better forms, including the addition of access keys, the ability to group form controls semantically,
the ability to group SELECT options semantically, and active labels.
The ability to markup a text description of an included object (with the OBJECT element).
A new client-side image map mechanism (the MAP element) that allows authors to integrate image
and text links.
The requirement that alternate text accompany images included with the IMG element and image
maps included with the AREA element.
Support for the title and lang attributes on all elements.
Support for the ABBR and ACRONYM elements.
A wider range of target media (tty, braille, etc.) for use with style sheets.
Better tables, including captions, column groups, and mechanisms to facilitate non-visual rendering.
Long descriptions of tables, images, frames, etc.

20
2.3.3 Tables

Authors who design pages with accessibility issues in mind will not only receive the blessings of the
accessibility community, but will benefit in other ways as well: well-designed HTML documents that
distinguish structure and presentation will adapt more easily to new technologies.

Note. For more information about designing accessible HTML documents, please consult [WAIGUIDE]
[p.331] .

2.3.3 Tables
The new table model in HTML is based on [RFC1942] [p.330] . Authors now have greater control over
structure and layout (e.g., column groups). The ability of designers to recommend column widths allows
user agents to display table data incrementally (as it arrives) rather than waiting for the entire table before
rendering.

Note. At the time of writing, some HTML authoring tools rely extensively on tables for formatting, which
may easily cause accessibility problems.

2.3.4 Compound documents


HTML now offers a standard mechanism for embedding generic media objects and applications in HTML
documents. The OBJECT element (together with its more specific ancestor elements IMG and APPLET)
provides a mechanism for including images, video, sound, mathematics, specialized applications, and
other objects in a document. It also allows authors to specify a hierarchy of alternate renderings for user
agents that don’t support a specific rendering.

2.3.5 Style sheets


Style sheets simplify HTML markup and largely relieve HTML of the responsibilities of presentation.
They give both authors and users control over the presentation of documents -- font information,
alignment, colors, etc.

Style information can be specified for individual elements or groups of elements. Style information may
be specified in an HTML document or in external style sheets.

The mechanisms for associating a style sheet with a document is independent of the style sheet language.

Before the advent of style sheets, authors had limited control over rendering. HTML 3.2 included a
number of attributes and elements offering control over alignment, font size, and text color. Authors also
exploited tables and images as a means for laying out pages. The relatively long time it takes for users to
upgrade their browsers means that these features will continue to be used for some time. However, since
style sheets offer more powerful presentation mechanisms, the World Wide Web Consortium will
eventually phase out many of HTML’s presentation elements and attributes. Throughout the specification
elements and attributes at risk are marked as "deprecated [p.34] ". They are accompanied by examples of
how to achieve the same effects with other elements or style sheets.

21
2.4 Authoring documents with HTML 4.0

2.3.6 Scripting
Through scripts, authors may create dynamic Web pages (e.g., "smart forms" that react as users fill them
out) and use HTML as a means to build networked applications.

The mechanisms provided to include scripts in an HTML document are independent of the scripting
language.

2.3.7 Printing
Sometimes, authors will want to make it easy for users to print more than just the current document. When
documents form part of a larger work, the relationships between them can be described using the HTML
LINK element or using W3C’s Resource Description Language (RDF) (see [RDF] [p.330] ).

2.4 Authoring documents with HTML 4.0


We recommend that authors and implementors observe the following general principles when working
with HTML 4.0.

2.4.1 Separate structure and presentation


HTML has its roots in SGML which has always been a language for the specification of structural
markup. As HTML matures, more and more of its presentational elements and attributes are being
replaced by other mechanisms, in particular style sheets. Experience has shown that separating the
structure of a document from its presentational aspects reduces the cost of serving a wide range of
platforms, media, etc., and facilitates document revisions.

2.4.2 Consider universal accessibility to the Web


To make the Web more accessible to everyone, notably those with disabilities, authors should consider
how their documents may be rendered on a variety of platforms: speech-based browsers, braille-readers,
etc. We do not recommend that authors limit their creativity, only that they consider alternate renderings
in their design. HTML offers a number of mechanisms to this end (e.g., the alt attribute, the
accesskey attribute, etc.)

Furthermore, authors should keep in mind that their documents may be reaching a far-off audience with
different computer configurations. In order for documents to be interpreted correctly, authors should
include in their documents information about the natural language and direction of the text, how the
document is encoded, and other issues related to internationalization.

2.4.3 Help user agents with incremental rendering


By carefully designing their tables and making use of new table features in HTML 4.0, authors can help
user agents render documents more quickly. Authors can learn how to design tables for incremental
rendering (see the TABLE element). Implementors should consult the notes on tables [p.317] in the
appendix for information on incremental algorithms.

22
3 On SGML and HTML

3 On SGML and HTML


Contents

1. Introduction to SGML . . . . . . . . . . . . . . . . 23
.
2. SGML constructs used in HTML . . . . . . . . . . . . . . 24
.
1. Elements . . . . . . . . . . . . . . . . . . 24
.
2. Attributes . . . . . . . . . . . . . . . . . . 25
.
3. Character references . . . . . . . . . . . . . . . . 26
.
4. Comments . . . . . . . . . . . . . . . . . . 26
.
3. How to read the HTML DTD . . . . . . . . . . . . . . . 27
.
1. DTD Comments . . . . . . . . . . . . . . . . . 27
.
2. Parameter entity definitions . . . . . . . . . . . . . . 27
.
3. Element declarations . . . . . . . . . . . . . . . . 28
.
Content model definitions . . . . . . . . . . . . . . 28
.
4. Attribute declarations . . . . . . . . . . . . . . . 30
.
DTD entities in attribute definitions . . . . . . . . . . . 30
.
Boolean attributes . . . . . . . . . . . . . . . 31
.

This section of the document introduces SGML and discusses its relationship to HTML. A complete
discussion of SGML is left to the standard (see [ISO8879] [p.327] ).

3.1 Introduction to SGML


SGML is a system for defining markup languages. Authors mark up their documents by representing
structural, presentational, and semantic information alongside content. HTML is one example of a markup
language. Here is an example of an HTML document:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>My first HTML document</TITLE>
</HEAD>
<BODY>
<P>Hello world!
</BODY>
</HTML>

An HTML document is divided into a head section (here, between <HEAD> and </HEAD>) and a body
(here, between <BODY> and </BODY>). The title of the document appears in the head (along with other
information about the document), and the content of the document appears in the body. The body in this
example contains just one paragraph, marked up with <P>.

Each markup language defined in SGML is called an SGML application. An SGML application is
generally characterized by:

23
3.2 SGML constructs used in HTML

1. An SGML declaration [p.249] . The SGML declaration specifies which characters and delimiters
may appear in the application.
2. A document type definition (DTD) [p.251] . The DTD defines the syntax of markup constructs. The
DTD may include additional definitions such as character entity references [p.26] .
3. A specification that describes the semantics to be ascribed to the markup. This specification also
imposes syntax restrictions that cannot be expressed within the DTD.
4. Document instances containing data (content) and markup. Each instance contains a reference to the
DTD to be used to interpret it.

The HTML 4.0 specification includes an SGML declaration [p.249] , three document type definitions (see
the section on HTML version information [p.53] for a description of the three), and a list of character
references [p.26] .

3.2 SGML constructs used in HTML


The following sections introduce SGML constructs that are used in HTML.

The appendix lists some SGML features [p.313] that are not widely supported by HTML tools and user
agents and should be avoided.

3.2.1 Elements
An SGML document type definition [p.251] declares element types that represent structures or desired
behavior. HTML includes element types that represent paragraphs, hypertext links, lists, tables, images,
etc.

Each element type declaration generally describes three parts: a start tag, content, and an end tag.

The element’s name appears in the start tag (written <element-name>) and the end tag (written
</element-name>); note the slash before the element name in the end tag. For example, the start and
end tags of the UL element type delimit the items in a list:
<UL>
<LI><P>...list item 1...
<LI><P>...list item 2...
</UL>

Some HTML element types allow authors to omit end tags (e.g., the P and LI element types). A few
element types also allow the start tags to be omitted; for example, HEAD and BODY. The HTML DTD
indicates for each element type whether the start tag and end tag are required.

Some HTML element types have no content. For example, the line break element BR has no content; its
only role is to terminate a line of text. Such empty elements never have end tags. The document type
definition [p.251] and the text of the specification indicate whether an element type is empty (has no
content) or, if it can have content, what is considered legal content.

24
3.2.2 Attributes

Element names are always case-insensitive.

Please consult the SGML standard for information about rules governing elements (e.g., they must be
properly nested, an end tag closes all omitted start tags up to the matching start tag (section 7.5.1), etc.).

For example, the following paragraph:


<P>This is the first paragraph.</P>
...a block element...

may be rewritten without its end tag:


<P>This is the first paragraph.
...a block element...

since the <P> start tag is closed by the following block element. Similarly, if a paragraph is enclosed by a
block element, as in:
<DIV>
<P>This is the paragraph.
</DIV>

the end tag of the enclosing block element (here, </DIV>) implies the end tag of the open <P> start tag.

Elements are not tags. Some people refer to elements as tags (e.g., "the P tag"). Remember that the
element is one thing, and the tag (be it start or end tag) is another. For instance, the HEAD element is
always present, even though both start and end HEAD tags may be missing in the markup.

All the element types declared in this specification are listed in the element index [p.333] .

3.2.2 Attributes
Elements may have associated properties, called attributes, which may have values (by default, or set by
authors or scripts). Attribute/value pairs appear before the final ">" of an element’s start tag. Any number
of (legal) attribute value pairs, separated by spaces, may appear in an element’s start tag. They may appear
in any order.

In this example, the id attribute is set for an H1 element:


<H1 id="section1">
This is an identified heading thanks to the id attribute
</H1>

By default, SGML requires that all attribute values be delimited using either double quotation marks
(ASCII decimal 34) or single quotation marks (ASCII decimal 39). Single quote marks can be included
within the attribute value when the value is delimited by double quote marks, and vice versa. Authors may
also use numeric character references [p.26] to represent double quotes (&#34;) and single quotes
(&#39;). For double quotes authors can also use the character entity reference [p.26] &quot;.

25
3.2.3 Character references

In certain cases, authors may specify the value of an attribute without any quotation marks. The attribute
value may only contain letters (a-z and A-Z), digits (0-9), hyphens (ASCII decimal 45), and periods
(ASCII decimal 46). We recommend using quotation marks even when it is possible to eliminate them.

Attribute names are always case-insensitive

Attribute values are generally case-insensitive. The definition of each attribute in the reference manual
indicates whether its value is case-insensitive.

All the attributes defined by this specification are listed in the attribute index [p.337] .

3.2.3 Character references


Character references are numeric or symbolic names for characters that may be included in an HTML
document. They are useful for referring to rarely used characters, or those that authoring tools make it
difficult or impossible to enter. You will see character references throughout this document; they begin
with a "&" sign and end with a semi-colon (;). Some common examples include:

"&lt;" represents the < sign.


"&gt;" represents the > sign.
"&quot;" represents the " mark.
"&#229;" (in decimal) represents the letter "a" with a small circle above it.
"&#1048;" (in decimal) represents the Cyrillic capital letter "I".
"&#x6C34;" (in hexadecimal) represents the Chinese character for water.

We discuss HTML character references [p.40] in detail later in the section on the HTML document
character set [p.37] . The specification also contains a list of character references [p.289] that may appear
in HTML 4.0 documents.

3.2.4 Comments
HTML comments have the following syntax:
<!-- this is a comment -->
<!-- and so is this one,
which occupies more than one line -->

White space is not permitted between the markup declaration open delimiter("<!") and the comment open
delimiter ("--"), but is permitted between the comment close delimiter ("--") and the markup declaration
close delimiter (">"). A common error is to include a string of hyphens ("---") within a comment. Authors
should avoid putting two or more adjacent hyphens inside comments.

Information that appears between comments has no special meaning (e.g., character references [p.26] are
not interpreted as such).

26
3.3 How to read the HTML DTD

3.3 How to read the HTML DTD


Each element and attribute declaration in this specification is accompanied by its document type definition
[p.251] fragment. We have chosen to include the DTD fragments in the specification rather than seek a
more approachable, but longer and less precise means of describing an element’s properties. The
following tutorial should allow readers unfamiliar with SGML to read the DTD and understand the
technical details of the HTML specification.

3.3.1 DTD Comments


In DTDs, comments may spread over one or more lines. In the DTD, comments are delimited by a pair of
"--" marks, e.g.
<!ELEMENT PARAM - O EMPTY -- named property value -->

Here, the comment "named property value" explains the use of the PARAM element type. Comments in the
DTD are informative only.

3.3.2 Parameter entity definitions


The HTML DTD [p.251] begins with a series of parameter entity definitions. A parameter entity
definition defines a kind of macro that may be referenced and expanded elsewhere in the DTD. These
macros may not appear in HTML documents, only in the DTD. Other types of macros, called character
references [p.26] , may be used in the text of an HTML document or within attribute values.

When the parameter entity is referred to by name in the DTD, it is expanded into a string.

A parameter entity definition begins with the keyword <!ENTITY % followed by the entity name, the
quoted string the entity expands to, and finally a closing >. Instances of parameter entities in a DTD begin
with "%", then the parameter entity name, and terminated by an optional ";".

The following example defines the string that the "%fontstyle;" entity will expand to.
<!ENTITY % fontstyle "TT | I | B | BIG | SMALL">

The string the parameter entity expands to may contain other parameter entity names. These names are
expanded recursively. In the following example, the "%inline;" parameter entity is defined to include the
"%fontstyle;", "%phrase;", "%special;" and "%formctrl;" parameter entities.
<!ENTITY % inline "#PCDATA | %fontstyle; | %phrase; | %special; | %formctrl;">

You will encounter two DTD entities frequently in the HTML DTD [p.251] : "%block;" "%inline;". They
are used when the content model includes block-level and inline elements [p.66] , respectively (defined in
the section on the global structure of an HTML document [p.53] ).

27
3.3.3 Element declarations

3.3.3 Element declarations


The bulk of the HTML DTD consists of the declarations of element types and their attributes. The
<!ELEMENT keyword begins a declaration and the > character ends it. Between these are specified:

1. The element’s name.


2. Whether the element’s end tag is optional. Two hyphens that appear after the element name mean
that the start and end tags are mandatory. One hyphen followed by the letter "O" indicates that the
end tag can be omitted. A pair of letter "O"s indicate that both the start and end tags can be omitted.
3. The element’s content, if any. The allowed content for an element is called its content model.
Element types that are designed to have no content are called empty elements. The content model for
such element types is declared using the keyword "EMPTY".

In this example:
<!ELEMENT UL - - (LI)+>

The element type being declared is UL.


The two hyphens indicate that both the start tag <UL> and the end tag </UL> for this element type
are required.
The content model for this element type is declared to be "at least one LI element". Below, we
explain how to specify content models.

This example illustrates the declaration of an empty element type:


<!ELEMENT IMG - O EMPTY>

The element type being declared is IMG.


The hyphen and the following "O" indicate that the end tag can be omitted, but together with the
content model "EMPTY", this is strengthened to the rule that the end tag must be omitted.
The "EMPTY" keyword means that instances of this type must not have content.

Content model definitions


The content model describes what may be contained by an instance of an element type. Content model
definitions may include:

The names of allowed or forbidden element types (e.g., the UL element contains instances of the LI
element type, and the P element type may not contain other P elements).
DTD entities (e.g., the LABEL element contains instances of the "%inline;" parameter entity).
Document text (indicated by the SGML construct "#PCDATA"). Text may contain character
references [p.40] . Recall that these begin with & and end with a semicolon (e.g., "Herg&eacute;’s
adventures of Tintin" contains the character entity reference for the "e acute" character).

The content model of an element is specified with the following syntax:

28
3.3.3 Element declarations

( ... )
Delimits a group.
A|B
Either A or B occurs, but not both.
A,B
Both A and B occur, in that order.
A&B
Both A and B occur, in any order.
A?
A occurs zero or one time.
A*
A occurs zero or more times.
A+
A occurs one or more times.

Here are some examples from the HTML DTD:


<!ELEMENT UL - - (LI)+>

The UL element must contain one or more LI elements.


<!ELEMENT DL - - (DT|DD)+>

The DL element must contain one or more DT or DD elements in any order.


<!ELEMENT OPTION - O (#PCDATA)>

The OPTION element may only contain text and entities, such as &amp; -- this is indicated by the SGML
data type #PCDATA.

A few HTML element types use an additional SGML feature to exclude elements from their content
model. Excluded elements are preceded by a hyphen. Explicit exclusions override permitted elements.

In this example, the -(A) signifies that the element A cannot appear in another A element (i.e., anchors
may not be nested).
<!ELEMENT A - - (%inline;)* -(A)>

Note that the A element type is part of the DTD parameter entity "%inline;", but is excluded explicitly
because of -(A).

Similarly, the following element type declaration for FORM prohibits nested forms:
<!ELEMENT FORM - - (%block;|SCRIPT)+ -(FORM)>

29
3.3.4 Attribute declarations

3.3.4 Attribute declarations


The <!ATTLIST keyword begins the declaration of attributes that an element may take. It is followed by
the name of the element in question, a list of attribute definitions, and a closing >. Each attribute definition
is a triplet that defines:

The name of an attribute.


The type of the attribute’s value or an explicit set of possible values. Values defined explicitly by the
DTD are case-insensitive. Please consult the section on basic HTML data types [p.43] for more
information about attribute value types.
Whether the default value of the attribute is implicit (keyword "#IMPLIED"), in which case the
default value must be supplied by the user agent (in some cases via inheritance from parent
elements); always required (keyword "#REQUIRED"); or fixed to the given value (keyword
"#FIXED"). Some attribute definitions explicitly specify a default value for the attribute.

In this example, the name attribute is defined for the MAP element. The attribute is optional for this
element.
<!ATTLIST MAP
name CDATA #IMPLIED
>

The type of values permitted for the attribute is given as CDATA, an SGML data type. CDATA is text
that may contain character references [p.40] .

For more information about "CDATA", "NAME", "ID", and other data types, please consult the section
on HTML data types [p.43] .

The following examples illustrate several attribute definitions:


rowspan NUMBER 1 -- number of rows spanned by cell --
http-equiv NAME #IMPLIED -- HTTP response header name --
id ID #IMPLIED -- document-wide unique id --
valign (top|middle|bottom|baseline) #IMPLIED

The rowspan attribute requires values of type NUMBER. The default value is given explicitly as "1".
The optional http-equiv attribute requires values of type NAME. The optional id attribute requires
values of type ID. The optional valign attribute is constrained to take values from the set {top, middle,
bottom, baseline}.

DTD entities in attribute definitions


Attribute definitions may also contain parameter entity references.

In this example, we see that the attribute definition list for the LINK element begins with the "%attrs;"
parameter entity.

30
3.3.4 Attribute declarations

<!ELEMENT LINK - O EMPTY -- a media-independent link -->


<!ATTLIST LINK
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
type %ContentType; #IMPLIED -- advisory content type --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
media %MediaDesc; #IMPLIED -- for rendering on these media --
>

Start tag: required, End tag: forbidden

The "%attrs;" parameter entity is defined as follows:


<!ENTITY % attrs "%coreattrs; %i18n; %events;">

The "%coreattrs;" parameter entity in the "%attrs;" definition expands as follows:


<!ENTITY % coreattrs
"id ID #IMPLIED -- document-wide unique id --
class CDATA #IMPLIED -- space separated list of classes --
style %StyleSheet; #IMPLIED -- associated style info --
title %Text; #IMPLIED -- advisory title/amplification --"
>

The "%attrs;" parameter entity has been defined for convenience since these attributes are defined for
most HTML element types.

Similarly, the DTD defines the "%URI;" parameter entity as expanding into the string "CDATA".
<!ENTITY % URI "CDATA"
-- a Uniform Resource Identifier,
see [URI]
-->

As this example illustrates, the parameter entity "%URI;" provides readers of the DTD with more
information as to the type of data expected for an attribute. Similar entities have been defined for
"%Color;", "%Charset;", "%Length;", "%Pixels;", etc.

Boolean attributes
Some attributes play the role of boolean variables (e.g., the selected attribute for the OPTION
element). Their appearance in the start tag of an element implies that the value of the attribute is "true".
Their absence implies a value of "false".

Boolean attributes may legally take a single value: the name of the attribute itself (e.g.,
selected="selected").

31
3.3.4 Attribute declarations

This example defines the selected attribute to be a boolean attribute.


selected (selected) #IMPLIED -- reduced inter-item spacing --

The attribute is set to "true" by appearing in the element’s start tag:


<OPTION selected="selected">
...contents...
<OPTION>

In HTML, boolean attributes may appear in minimized form -- the attribute’s value appears alone in the
element’s start tag. Thus, selected may be set by writing:
<OPTION selected>

instead of:
<OPTION selected="selected">

Authors should be aware than many user agents only recognize the minimized form of boolean attributes
and not the full form.

32
4 Conformance: requirements and recommendations

4 Conformance: requirements and recommendations


Contents

1. Definitions . . . . . . . . . . . . . . . . . . . 33
.
2. SGML . . . . . . . . . . . . . . . . . . . . 34
.
3. The text/html content type . . . . . . . . . . . . . . . . 35
.

In this section, we begin the specification of HTML 4.0, starting with the contract between authors,
documents, users, and user agents.

The key words "MUST", "MUST NOT", "REQUIRED", "SHALL", "SHALL NOT", "SHOULD",
"SHOULD NOT", "RECOMMENDED", "MAY", and "OPTIONAL" in this document are to be
interpreted as described in [RFC2119] [p.328] . However, for readability, these words do not appear in all
uppercase letters in this specification.

At times, the authors of this specification recommend good practice for authors and user agents. These
recommendations are not normative and conformance with this specification does not depend on their
realization. These recommendations contain the expression "We recommend ...", "This specification
recommends ...", or some similar wording.

4.1 Definitions
HTML document
An HTML document is an SGML document that meets the constraints of this specification.
Author
An author is a person or program that writes or generates HTML documents. An authoring tool is a
special case of an author, namely, it’s a program that generates HTML.

We recommend that authors write documents that conform to the strict DTD [p.251] rather than the
other DTDs defined by this specification. Please see the section on version information [p.54] for
details about the DTDs defined in HTML 4.0.
User
A user is a person who interacts with a user agent to view, hear, or otherwise use a rendered HTML
document.
HTML user agent
An HTML user agent is any device that interprets HTML documents. User agents include visual
browsers (text-only and graphical), non-visual browsers (audio, Braille), search robots, proxies, etc.

A conforming user agent for HTML 4.0 is one that observes the mandatory conditions ("must") set
forth in this specification, including the following points:
A user agent should avoid imposing arbitrary length limits on attribute value literals (see the
section on capacities in the SGML Declaration [p.249] ). For introductory information on
SGML attributes, please consult the section on attribute definitions [p.30] .
A user agent must ensure that rendering is unchanged by the presence or absence of start tags
and end tags when the HTML DTD indicates that these are optional. See the section on element

33
4.2 SGML

definitions [p.28] for introductory information on SGML elements.


For reasons of backwards compatibility, we recommend that tools interpreting HTML 4.0
continue to support HTML 3.2 (see [HTML32] [p.329] ) and HTML 2.0 (see [RFC1866]
[p.330] ).
Error conditions
This specification does not define how conforming user agents handle general error conditions,
including how user agents behave when they encounter elements, attributes, attribute values, or
entities not specified in this document.

However, for recommended error handling behavior, please consult the notes on invalid documents
[p.310] .
Deprecated
A deprecated element or attribute is one that has been outdated by newer constructs. Deprecated
elements are defined in the reference manual in appropriate locations, but are clearly marked as
deprecated. Deprecated elements may become obsolete in future versions of HTML.

User agents should continue to support deprecated elements for reasons of backward compatibility.

Definitions of elements and attributes clearly indicate which are deprecated.

This specification includes examples that illustrate how to avoid using deprecated elements. In most
cases these depend on user agent support for style sheets. In general, authors should use style sheets
to achieve stylistic and formatting effects rather than HTML presentational attributes. HTML
presentational attributes have been deprecated when style sheet alternatives exist (see, for example,
[CSS1] [p.327] ).
Obsolete
An obsolete element or attribute is one for which there is no guarantee of support by a user agent.
Obsolete elements are no longer defined in the specification, but are listed for historical purposes in
the changes section [p.301] of the reference manual.

4.2 SGML
HTML 4.0 is an SGML application conforming to International Standard ISO 8879 -- Standard
Generalized Markup Language SGML (defined in [ISO8879] [p.327] ).

Examples in the text conform to the strict document type definition [p.251] unless the example in question
refers to elements or attributes only defined by the transitional document type definition [p.267] or
frameset document type definition [p.287] . For the sake of brevity, most of the examples in this
specification do not begin with the document type declaration [p.54] that is mandatory at the beginning of
each HTML document.

DTD fragments in element definitions come from the strict document type definition [p.251] except for
the elements related to frames.

Please consult the section on HTML version information [p.54] for details about when to use the strict,
transitional, or frameset DTD.

34
4.3 The text/html content type

Comments appearing in the HTML 4.0 DTD [p.251] have no normative value; they are informative only.

User agents must not render SGML processing instructions (e.g., <?full volume>) or comments. For more
information about this and other SGML features that may be legal in HTML but aren’t widely supported
by HTML user agents, please consult the section on SGML features with limited support. [p.313]

4.3 The text/html content type


HTML documents are sent over the Internet as a sequence of bytes accompanied by encoding information
(described in the section on character encodings [p.38] ). The structure of the transmission, termed a
message entity, is defined by [RFC2045] [p.328] and [RFC2068] [p.328] . A message entity with a content
type [p.46] of "text/html" represents an HTML document.

The content type for HTML documents is defined as follows:

Content type name:


text
Content subtype name:
html
Required parameters:
none
Optional parameters:
charset
Encoding considerations:
any encoding is allowed
Security considerations:
See the notes on security [p.325]

The optional parameter "charset" refers to the character encoding [p.38] used to represent the HTML
document as a sequence of bytes. Legal values for this parameter are defined in the section on character
encodings [p.38] . Although this parameter is optional, we recommend that it always be present.

35
4.3 The text/html content type

36
5 HTML Document Representation

5 HTML Document Representation


Contents

1. The Document Character Set . . . . . . . . . . . . . . . 37


.
2. Character encodings . . . . . . . . . . . . . . . . . 38
.
1. Choosing an encoding . . . . . . . . . . . . . . . 38
.
Notes on specific encodings . . . . . . . . . . . . . 39
.
2. Specifying the character encoding . . . . . . . . . . . . . 39
.
3. Character references . . . . . . . . . . . . . . . . . 40
.
1. Numeric character references . . . . . . . . . . . . . . 41
.
2. Character entity references . . . . . . . . . . . . . . 41
.
4. Undisplayable characters . . . . . . . . . . . . . . . . 42
.

In this chapter, we discuss how HTML documents are represented on a computer and over the Internet.

The section on the document character set [p.37] addresses the issue of what abstract characters may be
part of an HTML document. Characters include the Latin letter "A", the Cyrillic letter "I", the Chinese
character meaning "water", etc.

The section on character encodings [p.38] addresses the issue of how those characters may be represented
in a file or when transferred over the Internet. As some character encodings cannot directly represent all
characters an author may want to include in a document, HTML offers other mechanisms, called character
references [p.40] , for referring to any character.

Since there are a great number of characters throughout human languages, and a great variety of ways to
represent those characters, proper care must be taken so that documents may be understood by user agents
around the world.

5.1 The Document Character Set


To promote interoperability, SGML requires that each application (including HTML) specify its document
character set. A document character set consists of:

A Repertoire: A set of abstract characters,, such as the Latin letter "A", the Cyrillic letter "I", the
Chinese character meaning "water", etc.
Code positions: A set of integer references to characters in the repertoire.

Each SGML document (including each HTML document) is a sequence of characters from the repertoire.
Computer systems identify each character by its code position; for example, in the ASCII character set,
code positions 65, 66, and 67 refer to the characters ’A’, ’B’, and ’C’, respectively.

The ASCII character set is not sufficient for a global information system such as the Web, so HTML uses
the much more complete character set called the Universal Character Set (UCS), defined in [ISO10646].
[p.327] This standard defines a repertoire of thousands of characters used by communities all over the
world.

37
5.2 Character encodings

The character set defined in [ISO10646] [p.327] is character-by-character equivalent to Unicode 2.0
([UNICODE] [p.328] ). Both of these standards are updated from time to time with new characters, and
the amendments should be consulted at the respective Web sites. In the current specification, references to
ISO/IEC-10646 or Unicode imply the same document character set. However, the HTML specification
also refers to the Unicode specification for other issues such as the bidirectional text algorithm. [p.73]

The document character set, however, does not suffice to allow user agents to correctly interpret HTML
documents as they are typically exchanged -- encoded as a sequence of bytes in a file or during a network
transmission. User agents must also know the specific character encoding [p.38] that was used to
transform the document character stream into a byte stream.

5.2 Character encodings


What this specification calls a character encoding is known by different names in other specifications
(which may cause some confusion). However, the concept is largely the same across the Internet. Also,
protocol headers, attributes, and parameters referring to character encodings share the same name --
"charset" -- and use the same values from the [IANA] [p.327] registry (see [CHARSETS] [p.329] for a
complete list).

The "charset" parameter identifies a character encoding, which is a method of converting a sequence of
bytes into a sequence of characters. This conversion fits naturally with the scheme of Web activity:
servers send HTML documents to user agents as a stream of bytes; user agents interpret them as a
sequence of characters. The conversion method can range from simple one-to-one correspondence to
complex switching schemes or algorithms.

A simple one-byte-per-character encoding technique is not sufficient for text strings over a character
repertoire as large as [ISO10646] [p.327] . There are several different encodings of parts of [ISO10646]
[p.327] in addition to encodings of the entire character set (such as UCS-4).

5.2.1 Choosing an encoding


Authoring tools (e.g., text editors) may encode HTML documents in the character encoding of their
choice, and the choice largely depends on the conventions used by the system software. These tools may
employ any convenient encoding that covers most of the characters contained in the document, provided
the encoding is correctly labeled. [p.39] Occasional characters that fall outside this encoding may still be
represented by character references [p.40] . These always refer to the document character set, not the
character encoding.

Servers and proxies may change a character encoding (called transcoding) on the fly to meet the requests
of user agents (see section 14.2 of [RFC2068] [p.328] , the "Accept-Charset" HTTP request header).
Servers and proxies do not have to serve a document in a character encoding that covers the entire
document character set.

Commonly used character encodings on the Web include ISO-8859-1 (also referred to as "Latin-1"; usable
for most Western European languages), ISO-8859-5 (which supports Cyrillic), SHIFT_JIS (a Japanese
encoding), EUC-JP (another Japanese encoding), and UTF-8 (an encoding of ISO 10646 using a different
number of bytes for different characters). Names for character encodings are case-insensitive, so that for

38
5.2.2 Specifying the character encoding

example "SHIFT_JIS", "Shift_JIS", and "shift_jis" are equivalent.

This specification does not mandate which character encodings a user agent must support.

Conforming user agents [p.33] must correctly map to Unicode all characters in any character encodings
that they recognize (or they must behave as if they did).

Notes on specific encodings


When HTML text is transmitted in UTF-16 (charset=UTF-16), text data should be transmitted in network
byte order ("big-endian", high-order byte first) in accordance with [ISO10646] [p.327] , Section 6.3 and
[UNICODE] [p.328] , clause C3, page 3-1.

Furthermore, to maximize chances of proper interpretation, it is recommended that documents transmitted


as UTF-16 always begin with a ZERO-WIDTH NON-BREAKING SPACE character (hexadecimal FEFF,
also called Byte Order Mark (BOM)) which, when byte-reversed, becomes hexadecimal FFFE, a character
guaranteed never to be assigned. Thus, a user-agent receiving a hexadecimal FFFE as the first bytes of a
text would know that bytes have to be reversed for the remainder of the text.

The UTF-1 transformation format of [ISO10646] [p.327] (registered by IANA as ISO-10646-UTF-1),


should not be used. For information about ISO 8859-8 and the bidirectional algorithm, please consult the
section on bidirectionality and character encoding [p.78] .

5.2.2 Specifying the character encoding


How does a server determine which character encoding applies for a document it serves? Some servers
examine the first few bytes of the document, or check against a database of known files and encodings.
Many modern servers give Web masters more control over charset configuration than old servers do. Web
masters should use these mechanisms to send out a "charset" parameter whenever possible, but should
take care not to identify a document with the wrong "charset" parameter value.

How does a user agent know which character encoding has been used? The server should provide this
information. The most straightforward way for a server to inform the user agent about the character
encoding of the document is to use the "charset" parameter of the "Content-Type" header field of the
HTTP protocol ([RFC2068] [p.328] , sections 3.4 and 14.18) For example, the following HTTP header
announces that the character encoding is EUC-JP:
Content-Type: text/html; charset=EUC-JP

Please consult the section on conformance [p.33] for the definition of text/html [p.35] .

The HTTP protocol ([RFC2068] [p.328] , section 3.7.1) mentions ISO-8859-1 as a default character
encoding when the "charset" parameter is absent from the "Content-Type" header field. In practice, this
recommendation has proved useless because some servers don’t allow a "charset" parameter to be sent,
and others may not be configured to send the parameter. Therefore, user agents must not assume any
default value for the "charset" parameter.

39
5.3 Character references

To address server or configuration limitations, HTML documents may include explicit information about
the document’s character encoding; the META element can be used to provide user agents with this
information.

For example, to specify that the character encoding of the current document is "EUC-JP", a document
should include the following META declaration:
<META http-equiv="Content-Type" content="text/html; charset=EUC-JP">

The META declaration must only be used when the character encoding is organized such that ASCII
characters stand for themselves (at least until the META element is parsed). META declarations should
appear as early as possible in the HEAD element.

For cases where neither the HTTP protocol nor the META element provides information about the
character encoding of a document, HTML also provides the charset attribute on several elements. By
combining these mechanisms, an author can greatly improve the chances that, when the user retrieves a
resource, the user agent will recognize the character encoding.

To sum up, conforming user agents must observe the following priorities when determining a document’s
character encoding (from highest priority to lowest):

1. An HTTP "charset" parameter in a "Content-Type" field.


2. A META declaration with "http-equiv" set to "Content-Type" and a value set for "charset".
3. The charset attribute set on an element that designates an external resource.

In addition to this list of priorities, the user agent may use heuristics and user settings. For example, many
user agents use a heuristic to distinguish the various encodings used for Japanese text. Also, user agents
typically have a user-definable, local default character encoding which they apply in the absence of other
indicators.

User agents may provide a mechanism that allows users to override incorrect "charset" information.
However, if a user agent offers such a mechanism, it should only offer it for browsing and not for editing,
to avoid the creation of Web pages marked with an incorrect "charset" parameter.

Note. If, for a specific application, it becomes necessary to refer to characters outside [ISO10646]
[p.327] , characters should be assigned to a private zone to avoid conflicts with present or future versions
of the standard. This is highly discouraged, however, for reasons of portability.

5.3 Character references


A given character encoding may not be able to express all characters of the document character set. For
such encodings, or when hardware or software configurations do not allow users to input some document
characters directly, authors may use SGML character references. Character references are a character
encoding-independent mechanism for entering any character from the document character set.

40
5.3.1 Numeric character references

Character references in HTML may appear in two forms:

Numeric character references (either decimal or hexadecimal).


Character entity references.

Character references within comments have no special meaning; they are comment data only.

Note. HTML provides other ways to present character data, in particular inline images [p.149] .

Note. In SGML, it is possible to eliminate the final ";" after a character reference in some cases (e.g., at a
line break or immediately before a tag). In other circumstances it may not be eliminated (e.g., in the
middle of a word). We strongly suggest using the ";" in all cases to avoid problems with user agents that
require this character to be present.

5.3.1 Numeric character references


Numeric character references specify the code position [p.37] of a character in the document character
set. Numeric character references may take two forms:

The syntax "&#D;", where D is a decimal number, refers to the Unicode decimal character number
D.
The syntax "&#xH;" or "&#XH;", where H is an hexadecimal number, refers to the Unicode
hexadecimal character number H. Hexadecimal numbers in numeric character references are
case-insensitive.

Here are some examples of numeric character references:

&#229; (in decimal) represents the letter "a" with a small circle above it (used, for example, in
Norwegian).
&#xE5; (in hexadecimal) represents the same character.
&#Xe5; (in hexadecimal) represents the same character as well.
&#1048; (in decimal) represents the Cyrillic capital letter "I".
&#x6C34; (in hexadecimal) represents the Chinese character for water.

Note. Although the hexadecimal representation is not defined in [ISO8879] [p.327] , it is expected to be in
the revision, as described in [WEBSGML] [p.329] . This convention is particularly useful since character
standards generally use hexadecimal representations.

5.3.2 Character entity references


In order to give authors a more intuitive way of referring to characters in the document character set,
HTML offers a set of character entity references. Character entity references use symbolic names so that
authors need not remember code positions. [p.37] For example, the character entity reference &aring;
refers to the lowercase "a" character topped with a ring; "&aring;" is easier to remember than &#229;.

41
5.4 Undisplayable characters

HTML 4.0 does not define a character entity reference for every character in the document character set.
For instance, there is no character entity reference for the Cyrillic capital letter "I". Please consult the full
list of character references [p.289] defined in HTML 4.0.

Character entity references are case-sensitive. Thus, &Aring; refers to a different character (uppercase A,
ring) than &aring; (lowercase a, ring).

Four character entity references deserve special mention since they are frequently used to escape special
characters:

"&lt;" represents the < sign.


"&gt;" represents the > sign.
"&amp;" represents the & sign.
"&quot; represents the " mark.

Authors wishing to put the "<" character in text should use "&lt;" (ASCII decimal 60) to avoid possible
confusion with the beginning of a tag (start tag open delimiter). Similarly, authors should use "&gt;"
(ASCII decimal 62) in text instead of ">" to avoid problems with older user agents that incorrectly
perceive this as the end of a tag (tag close delimiter) when it appears in quoted attribute values.

Authors should use "&amp;" (ASCII decimal 38) instead of "&" to avoid confusion with the beginning of
a character reference (entity reference open delimiter). Authors should also use "&amp;" in attribute
values since character references are allowed within CDATA [p.44] attribute values.

Some authors use the character entity reference "&quot;" to encode instances of the double quote mark (")
since that character may be used to delimit attribute values.

5.4 Undisplayable characters


A user agent may not be able to render all characters in a document meaningfully, for instance, because
the user agent lacks a suitable font, a character has a value that may not be expressed in the user agent’s
internal character encoding, etc.

Because there are many different things that may be done in such cases, this document does not prescribe
any specific behavior. Depending on the implementation, undisplayable characters may also be handled
by the underlying display system and not the application itself. In the absence of more sophisticated
behavior, for example tailored to the needs of a particular script or language, we recommend the following
behavior for user agents:

1. Adopt a clearly visible, but unobtrusive mechanism to alert the user of missing resources.
2. If missing characters are presented using their numeric representation, use the hexadecimal (not
decimal) form since this is the form used in character set standards.

42
6 Basic HTML data types

6 Basic HTML data types


Contents

1. Case information . . . . . . . . . . . . . . . . . . 43
.
2. SGML basic types . . . . . . . . . . . . . . . . . 44
.
3. Text strings . . . . . . . . . . . . . . . . . . . 44
.
4. URIs . . . . . . . . . . . . . . . . . . . . 44
.
5. Colors . . . . . . . . . . . . . . . . . . . . 45
.
1. Notes on using colors . . . . . . . . . . . . . . . . 45
.
6. Lengths . . . . . . . . . . . . . . . . . . . . 46
.
7. Content types (MIME types) . . . . . . . . . . . . . . . 46
.
8. Language codes . . . . . . . . . . . . . . . . . . 47
.
9. Character encodings . . . . . . . . . . . . . . . . . 47
.
10. Single characters . . . . . . . . . . . . . . . . . . 47
.
11. Dates and times . . . . . . . . . . . . . . . . . . 47
.
12. Link types . . . . . . . . . . . . . . . . . . . 48
.
13. Media descriptors . . . . . . . . . . . . . . . . . 49
.
14. Script data . . . . . . . . . . . . . . . . . . . 50
.
15. Style sheet data . . . . . . . . . . . . . . . . . . 51
.
16. Frame target names . . . . . . . . . . . . . . . . . 51
.

This section of the specification describes the basic data types that may appear as an element’s content or
an attribute’s value.

For introductory information about reading the HTML DTD, please consult the SGML tutorial [p.23] .

6.1 Case information


Each attribute definition includes information about the case-sensitivity of its values. The case information
is presented with the following keys:

CS
The value is case-sensitive (i.e., user agents interpret "a" and "A" differently).
CI
The value is case-insensitive (i.e., user agents interpret "a" and "A" as the same).
CN
The value is not subject to case changes, e.g., because it is a number or a character from the
document character set.
CA
The element or attribute definition itself gives case information.
CT
Consult the type definition for details about case-sensitivity.

43
6.2 SGML basic types

If an attribute value is a list, the keys apply to every value in the list, unless otherwise indicated.

6.2 SGML basic types


The document type definition [p.251] specifies the syntax of HTML element content and attribute values
using SGML tokens (e.g., PCDATA, CDATA, NAME, ID, etc.). See [ISO8879] [p.327] for their full
definitions. The following is a summary of key information:

CDATA is a sequence of characters from the document character set and may include character
entities. User agents should interpret attribute values as follows:
Replace character entities with characters,
Ignore line feeds,
Replace each carriage return or tab with a single space.

User agents may ignore leading and trailing white space in CDATA attribute values (e.g.,
" myval " may be interpreted as "myval"). Authors should not declare attribute values with leading
or trailing white space.

For some HTML 4.0 attributes with CDATA attribute values, the specification imposes further
constraints on the set of legal values for the attribute that may not be expressed by the DTD.

Although the STYLE and SCRIPT elements use CDATA for their data model, for these elements,
CDATA must be handled differently by user agents. Markup and entities must be treated as raw text
and passed to the application as is. The first occurrence of the character sequence "</" (end-tag open
delimiter) is treated as terminating the end of the element’s content. In valid documents, this would
be the end tag for the element.
ID and NAME tokens must begin with a letter ([A-Za-z]) and may be followed by any number of
letters, digits ([0-9]), hyphens ("-"), underscores ("_"), colons (":"), and periods (".").
IDREF and IDREFS are references to ID tokens defined by other attributes. IDREF is a single token
and IDREFS is a space-separated list of tokens.
NUMBER tokens must contain at least one digit ([0-9]).

6.3 Text strings


A number of attributes ( %Text; [p.253] in the DTD) take text that is meant to be "human readable". For
introductory information about attributes, please consult the tutorial discussion of attributes [p.25] .

6.4 URIs
This specification uses the term URI as defined in [URI] [p.328] (see also [RFC1630] [p.330] ).

Note that URIs include URLs (as defined in [RFC1738] [p.328] and [RFC1808] [p.328] ).

44
6.5 Colors

Relative URIs are resolved to full URIs using a base URI. [RFC1808] [p.328] , section 3, defines the
normative algorithm for this process. For more information about base URIs, please consult the section on
base URIs [p.146] in the chapter on links [p.135] .

URIs are represented in the DTD by the parameter entity %URI; [p.253] .

URIs in general are case-sensitive. [p.43] There may be URIs, or parts of URIs, where case doesn’t matter
(e.g., machine names), but identifying these may not be easy. Users should always consider that URIs are
case-sensitive (to be on the safe side).

Please consult the appendix for information about non-ASCII characters in URI attribute values [p.310] .

6.5 Colors
The attribute value type "color" (%Color; [p.269] ) refers to color definitions as specified in [SRGB]
[p.328] . A color value may either be a hexadecimal number (prefixed by a hash mark) or one of the
following sixteen color names. The color names are case-insensitive. [p.43]

Color names and sRGB values

Black = "#000000" Green = "#008000"

Silver = "#C0C0C0" Lime = "#00FF00"

Gray = "#808080" Olive = "#808000"

White = "#FFFFFF" Yellow = "#FFFF00"

Maroon = "#800000" Navy = "#000080"

Red = "#FF0000" Blue = "#0000FF"

Purple = "#800080" Teal = "#008080"

Fuchsia = "#FF00FF" Aqua = "#00FFFF"

Thus, the color values "#800080" and "Purple" both refer to the color purple.

6.5.1 Notes on using colors


Although colors can add significant amounts of information to document and make them more readable,
please consider the following guidelines when including color in your documents:

45
6.6 Lengths

The use of HTML elements and attributes for specifying color is deprecated [p.34] . You are
encouraged to use style sheets [p.171] instead.
Don’t use color combinations that cause problems for people with color blindness in its various
forms.
If you use a background image or set the background color, then be sure to set the various text colors
as well.
Colors specified with the BODY and FONT elements and bgcolor on tables look different on
different platforms (e.g., workstations, Macs, Windows, and LCD panels vs. CRTs), so you shouldn’t
rely entirely on a specific effect. In the future, support for the [SRGB] [p.328] color model together
with ICC color profiles should mitigate this problem.
When practical, adopt common conventions to minimize user confusion.

6.6 Lengths
HTML specifies three types of length values for attributes:

1. Pixels: The value (%Pixels; [p.257] in the DTD) is an integer that represents the number of pixels of
the canvas (screen, paper). Thus, the value "50" means fifty pixels. For normative information about
the definition of a pixel, please consult [CSS1] [p.327] .
2. Length: The value (%Length; [p.257] in the DTD) may be either a %Pixel; or a percentage of the
available horizontal or vertical space. Thus, the value "50%" means half of the available space.
3. MultiLength: The value ( %MultiLength; [p.257] in the DTD) may be a %Length; or a relative
length. A relative length has the form "i*", where "i" is an integer. When allotting space among
elements competing for that space, user agents allot pixel and percentage lengths first, then divide up
remaining available space among relative lengths. Each relative length receives a portion of the
available space that is proportional to the integer preceding the "*". The value "*" is equivalent to
"1*". Thus, if 60 pixels of space are available after the user agent allots pixel and percentage space,
and the competing relative lengths are 1*, 2*, and 3*, the 1* will be alloted 10 pixels, the 2* will be
alloted 20 pixels, and the 3* will be alloted 30 pixels.

Length values are case-neutral. [p.43]

6.7 Content types (MIME types)


Note. A "media type" (defined in [RFC2045] [p.328] and [RFC2046] [p.328] ) specifies the nature of a
linked resource. This specification employs the term "content type" rather than "media type" in
accordance with current usage. Furthermore, in this specification, "media type" may refer to the media
[p.49] where a user agent renders a document.

This type is represented in the DTD by %ContentType;. [p.252]

Content types are case-insensitive. [p.43]

Examples of content types include "text/html", "image/png", "image/gif", "video/mpeg", "audio/basic",


"text/tcl", "text/javascript", and "text/vbscript". For the current list of registered MIME types, please
consult [MIMETYPES]. [p.327]

46
6.8 Language codes

Note. The content type "text/css", while not currently registered with IANA, should be used when the
linked resource is a [CSS1] [p.327] style sheet.

6.8 Language codes


The value of attributes whose type is a language code ( %LanguageCode [p.252] in the DTD) refers to a
language code as specified by [RFC1766] [p.328] , section 2. For information on specifying language
codes in HTML, please consult the section on language codes [p.72] . Whitespace is not allowed within
the language-code.

Language codes are case-insensitive. [p.43]

6.9 Character encodings


The "charset" attributes (%Charset [p.252] in the DTD) refer to a character encoding as described in the
section on character encodings [p.38] . Values must be strings (e.g., "euc-jp") from the IANA registry (see
[CHARSETS] [p.329] for a complete list).

Names of character encodings are case-insensitive. [p.43]

User agents must follow the steps set out in the section on specifying character encodings [p.39] in order
to determine the character encoding of an external resource.

6.10 Single characters


Certain attributes call for single character from the document character set [p.37] . These attributes take
the %Character [p.252] type in the DTD.

Single characters may be specified with character references [p.40] (e.g., "&amp;").

6.11 Dates and times


[ISO8601] [p.327] allows many options and variations in the representation of dates and times. The
current specification uses one of the formats described in the profile [DATETIME] [p.327] for its
definition of legal date/time strings ( %Datetime [p.253] in the DTD).

The format is:


YYYY-MM-DDThh:mm:ssTZD

where:

47
6.12 Link types

YYYY = four-digit year


MM = two-digit month (01=January, etc.)
DD = two-digit day of month (01 through 31)
hh = two digits of hour (00 through 23) (am/pm NOT allowed)
mm = two digits of minute (00 through 59)
ss = two digits of second (00 through 59)
TZD = time zone designator

The time zone designator is one of:

Z
indicates UTC (Coordinated Universal Time). The "Z" must be uppercase.
+hh:mm
indicates that the time is a local time which is hh hours and mm minutes ahead of UTC.
-hh:mm
indicates that the time is a local time which is hh hours and mm minutes behind UTC.

Exactly the components shown here must be present, with exactly this punctuation. Note that the "T"
appears literally in the string (it must be uppercase), to indicate the beginning of the time element, as
specified in [ISO8601] [p.327]

If a generating application does not know the time to the second, it may use the value "00" for the seconds
(and minutes and hours if necessary).

Note. [DATETIME] [p.327] does not address the issue of leap seconds.

6.12 Link types


Authors may use the following recognized link types, listed here with their conventional interpretations. In
the DTD, %LinkTypes [p.252] refers to a space-separated list of link types. White space characters are not
permitted within link types.

These link types are case-insensitive, [p.43] i.e., "Alternate" has the same meaning as "alternate".

User agents, search engines, etc. may interpret these link types in a variety of ways. For example, user
agents may provide access to linked documents through a navigation bar.

Alternate
Designates substitute versions for the document in which the link occurs. When used together with
the lang attribute, it implies a translated version of the document. When used together with the
media attribute, it implies a version designed for a different medium (or media).
Stylesheet
Refers to an external style sheet. See the section on external style sheets [p.177] for details. This is
used together with the link type "Alternate" for user-selectable alternate style sheets.
Start
Refers to the first document in a collection of documents. This link type tells search engines which
document is considered by the author to be the starting point of the collection.

48
6.13 Media descriptors

Next
Refers to the next document in an linear sequence of documents. User agents may choose to preload
the "next" document, to reduce the perceived load time.
Prev
Refers to the previous document in an ordered series of documents. Some user agents also support
the synonym "Previous".
Contents
Refers to a document serving as a table of contents. Some user agents also support the synonym ToC
(from "Table of Contents").
Index
Refers to a document providing an index for the current document.
Glossary
Refers to a document providing a glossary of terms that pertain to the current document.
Copyright
Refers to a copyright statement for the current document.
Chapter
Refers to a document serving as a chapter in a collection of documents.
Section
Refers to a document serving as a section in a collection of documents.
Subsection
Refers to a document serving as a subsection in a collection of documents.
Appendix
Refers to a document serving as an appendix in a collection of documents.
Help
Refers to a document offering help (more information, links to other sources information, etc.)
Bookmark
Refers to a bookmark. A bookmark is a link to a key entry point within an extended document. The
title attribute may be used, for example, to label the bookmark. Note that several bookmarks may
be defined in each document.

Authors may wish to define additional link types not described in this specification. If they do so, they
should use a profile [p.61] to cite the conventions used to define the link types. Please see the profile
attribute of the HEAD element for more details.

For further discussions about link types, please consult the section on links in HTML documents [p.135] .

6.13 Media descriptors


The following is a list of recognized media descriptors ( %MediaDesc [p.252] in the DTD).

screen
Intended for non-paged computer screens.
tty
Intended for media using a fixed-pitch character grid, such as teletypes, terminals, or portable devices
with limited display capabilities.

49
6.14 Script data

tv
Intended for television-type devices (low resolution, color, limited scrollability).
projection
Intended for projectors.
handheld
Intended for handheld devices (small screen, monochrome, bitmapped graphics, limited bandwidth).
print
Intended for paged, opaque material and for documents viewed on screen in print preview mode.
braille
Intended for braille tactile feedback devices.
aural
Intended for speech synthesizers.
all
Suitable for all devices.

Future versions of HTML may introduce new values and may allow parameterized values. To facilitate
the introduction of these extensions, conforming user agents must be able to parse the media attribute
value as follows:

1. The value is a comma-separated list of entries. For example,


media="screen, 3d-glasses, print and resolution > 90dpi"

is mapped to:
"screen"
"3d-glasses"
"print and resolution > 90dpi"

2. Each entry is truncated just before the first character that isn’t a US ASCII letter [a-zA-Z] (Unicode
decimal 65-90, 97-122), digit [0-9] (Unicode hex 30-39), or hyphen (45). In the example, this gives:
"screen"
"3d-glasses"
"print"

3. A case-sensitive [p.43] match is then made with the set of media types defined above. User agents
may ignore entries that don’t match. In the example we are left with screen and print.

Note. Style sheets may include media-dependent variations within them (e.g., the CSS @media construct).
In such cases it may be appropriate to use "media=all".

6.14 Script data


Script data ( %Script; [p.253] in the DTD [p.251] ) can be the content of the SCRIPT element and the
value of intrinsic event attributes [p.237] . User agents must not evaluate script data as HTML markup but
instead must pass it on as data to a script engine.

50
6.15 Style sheet data

The case-sensitivity of script data depends on the scripting language.

Please note that script data that is element content may not contain character references [p.40] , but script
data that is the value of an attribute may contain them. The appendix provides further information about
specifying non-HTML data [p.312] .

6.15 Style sheet data


Style sheet data (%StyleSheet; [p.253] in the DTD [p.251] ) can be the content of the STYLE element and
the value of the style attribute. User agents must not evaluate style data as HTML markup.

The case-sensitivity of style data depends on the style sheet language.

Please note that style sheet data that is element content may not contain character references [p.40] , but
style sheet data that is the value of an attribute may contain them. The appendix provides further
information about specifying non-HTML data [p.312] .

6.16 Frame target names


Except for the reserved names listed below, frame target names (%FrameTarget; [p.269] in the DTD)
must begin with an alphabetic character (a-zA-Z). User agents should ignore all other target names.

The following target names are reserved and have special meanings.

_blank
The user agent should load the designated document in a new, unnamed window.
_self
The user agent should load the document in the same frame as the element that refers to this target.
_parent
The user agent should load the document into the immediate FRAMESET parent of the current frame.
This value is equivalent to _self if the current frame has no parent.
_top
The user agent should load the document into the full, original window (thus cancelling all other
frames). This value is equivalent to _self if the current frame has no parent.

51
6.16 Frame target names

52
7 The global structure of an HTML document

7 The global structure of an HTML document


Contents

1. Introduction to the structure of an HTML document . . . . . . . . . . 53


.
2. HTML version information . . . . . . . . . . . . . . . 54
.
3. The HTML element . . . . . . . . . . . . . . . . . 55
.
4. The document head . . . . . . . . . . . . . . . . . 55
.
1. The HEAD element . . . . . . . . . . . . . . . . 55
.
2. The TITLE element . . . . . . . . . . . . . . . . 56
.
3. The title attribute . . . . . . . . . . . . . . . . 57
.
4. Meta data . . . . . . . . . . . . . . . . . . 57
.
Specifying meta data . . . . . . . . . . . . . . . 58
.
The META element . . . . . . . . . . . . . . . 58
.
Meta data profiles . . . . . . . . . . . . . . . 61
.
5. The document body . . . . . . . . . . . . . . . . . 62
.
1. The BODY element . . . . . . . . . . . . . . . . 62
.
2. Element identifiers: the id and class attributes . . . . . . . . . 65
.
3. Block-level and inline elements . . . . . . . . . . . . . 66
.
4. Grouping elements: the DIV and SPAN elements . . . . . . . . . 67
.
5. Headings: The H1, H2, H3, H4, H5, H6 elements . . . . . . . . . 68
.
6. The ADDRESS element . . . . . . . . . . . . . . . 70
.

7.1 Introduction to the structure of an HTML document


An HTML 4.0 document is composed of three parts:

1. a line containing HTML version information [p.54] ,


2. a declarative header section (delimited by the HEAD element),
3. a body, which contains the document’s actual content. The body may be implemented by the BODY
element or the FRAMESET element.

White space (spaces, newlines, tabs, and comments) may appear before or after each section. Sections 2
and 3 should be delimited by the HTML element.

Here’s an example of a simple HTML document:


<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>My first HTML document</TITLE>
</HEAD>
<BODY>
<P>Hello world!
</BODY>
</HTML>

53
7.2 HTML version information

7.2 HTML version information


A valid HTML document declares what version of HTML is used in the document. The document type
declaration names the document type definition (DTD) in use for the document (see [ISO8879] [p.327] ).

HTML 4.0 specifies three DTDs, so authors must include one of the following document type declarations
in their documents. The DTDs vary in the elements they support.

The HTML 4.0 Strict DTD [p.251] includes all elements and attributes that have not been deprecated
[p.34] or do not appear in frameset documents. For documents that use this DTD, use this document
type declaration:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]

The HTML 4.0 Transitional DTD [p.267] includes everything in the strict DTD plus deprecated
elements and attributes (most of which concern visual presentation). For documents that use this
DTD, use this document type declaration:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"
"[Link]

The HTML 4.0 Frameset DTD [p.287] includes everything in the transitional DTD plus frames as
well. For documents that use this DTD, use this document type declaration:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]

The URI in each document type declaration allows user agents to download the DTD and any entity sets
[p.289] that are needed. The following URIs refer to DTDs and entity sets for HTML 4.0 that W3C
supports:

"[Link] -- default strict DTD


"[Link] -- loose DTD
"[Link] -- DTD for frameset documents
"[Link] -- Latin-1 entities
"[Link] -- Symbol entities
"[Link] -- Special entities

The binding between public identifiers and files can be specified using a catalog file following the format
recommended by the SGML Open Consortium (see [SGMLOPEN] [p.330] ). A sample catalog file for
HTML 4.0 [p.248] is included at the beginning of the section on SGML reference information for HTML.
The last two letters of the declaration indicate the language of the DTD. For HTML, this is always English
("EN").

54
7.3 The HTML element

7.3 The HTML element


<!ENTITY % [Link] "HEAD, BODY">

<!ELEMENT HTML O O (%[Link];) -- document root element -->


<!ATTLIST HTML
%i18n; -- lang, dir --
>

Start tag: optional, End tag: optional

Attribute definitions

version = cdata [p.44] [CN] [p.43]


Deprecated. [p.34] The value of this attribute specifies which HTML DTD version governs the
current document. This attribute has been deprecated because it is redundant with version
information [p.54] provided by the document type declaration.

Attributes defined elsewhere

lang (language information [p.71] ), dir (text direction [p.73] )

After document type declaration, the remainder of an HTML document is contained by the HTML element.
Thus, a typical HTML document has this structure:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
...The head, body, etc. goes here...
</HTML>

7.4 The document head


7.4.1 The HEAD element
<!-- %[Link]; defined earlier on as "SCRIPT|STYLE|META|LINK|OBJECT" -->
<!ENTITY % [Link] "TITLE & BASE?">

<!ELEMENT HEAD O O (%[Link];) +(%[Link];) -- document head -->


<!ATTLIST HEAD
%i18n; -- lang, dir --
profile %URI; #IMPLIED -- named dictionary of meta info --
>

Start tag: optional, End tag: optional

Attribute definitions

profile = uri [p.44] [CT] [p.43]


This attribute specifies the location of one or more meta data profiles, separated by white space. For
future extensions, user agents should consider the value to be a list even though this specification

55
7.4.2 The TITLE element

only considers the first URI to be significant. Profiles [p.61] are discussed below in the section on
meta data [p.57] .

Attributes defined elsewhere

lang (language information [p.71] ), dir (text direction [p.73] )

The HEAD element contains information about the current document, such as its title, keywords that may
be useful to search engines, and other data that is not considered document content. User agents do not
generally render elements that appear in the HEAD as content. They may, however, make information in
the HEAD available to users through other mechanisms.

7.4.2 The TITLE element


<!-- The TITLE element is not considered part of the flow of text.
It should be displayed, for example as the page header or
window title. Exactly one title is required per document.
-->
<!ELEMENT TITLE - - (#PCDATA) -(%[Link];) -- document title -->
<!ATTLIST TITLE %i18n>

Start tag: required, End tag: required

Attributes defined elsewhere

lang (language information [p.71] ), dir (text direction [p.73] )

Every HTML document must have a TITLE element in the HEAD section.

Authors should use the TITLE element to identify the contents of a document. Since users often consult
documents out of context, authors should provide context-rich titles. Thus, instead of a title such as
"Introduction", which doesn’t provide much contextual background, authors should supply a title such as
"Introduction to Medieval Bee-Keeping" instead.

For reasons of accessibility, user agents must always make the content of the TITLE element available to
users (including TITLE elements that occur in frames). The mechanism for doing so depends on the user
agent (e.g., as a caption, spoken).

Titles may contain character entities [p.289] (for accented characters, special characters, etc.), but may not
contain other markup. Here is a sample document title:

56
7.4.3 The title attribute

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A study of population dynamics</TITLE>
... other head elements...
</HEAD>
<BODY>
... document body...
</BODY>
</HTML>

7.4.3 The title attribute


Attribute definitions

title = text [p.44] [CS] [p.43]


This attribute offers advisory information about the element for which it is set.

Unlike the TITLE element, which provides information about an entire document and may only appear
once, the title attribute may annotate any number of elements. Please consult an element’s definition to
verify that it supports this attribute.

Values of the title attribute may be rendered by user agents in a variety of ways. For instance, visual
browsers frequently display the title as a "tool tip" (a short message that appears when the pointing device
pauses over an object). Audio user agents may speak the title information in a similar context. For
example, setting the attribute on a link allows user agents (visual and non-visual) to tell users about the
nature of the linked resource:
...some text...
Here’s a photo of
<A href="[Link] title="Me scuba diving">
me scuba diving last summer
</A>
...some more text...

The title attribute has an additional role when used with the LINK element to designate an external
style sheet. [p.177] Please consult the section on links and style sheets [p.144] for details.

Note. To improve the quality of speech synthesis for cases handled poorly by standard techniques, future
versions of HTML may include an attribute for encoding phonemic and prosodic information.

7.4.4 Meta data


As this specification is being written, work is underway that will allow authors to assign richer
machine-readable information about HTML documents and other network-accessible resources. The W3C
Resource Description Language (see [RDF] [p.330] ) is being developed as a common framework for
meta data.

57
7.4.4 Meta data

HTML lets authors specify meta data -- information about a document rather than document content -- in
a variety of ways.

For example, to specify the author of a document, one may use the META element as follows:
<META name="Author" content="Dave Raggett">

The META element specifies a property (here "Author") and assigns a value to it (here "Dave Raggett").

This specification does not define a set of legal meta data properties. The meaning of a property and the
set of legal values for that property should be defined in a reference lexicon called a profile [p.61] . For
example, a profile designed to help search engines index documents might define properties such as
"author", "copyright", "keywords", etc.

Specifying meta data


In general, specifying meta data involves two steps:

1. Declaring a property and a value for that property. This may be done in two ways:
1. From within a document, via the META element.
2. From outside a document, by linking to meta data via the LINK element (see the section on link
types [p.48] ).
2. Referring to a profile [p.61] where the property and its legal values are defined. To designate a
profile, use the profile attribute of the HEAD element.

Note that since a profile is defined for the HEAD element, the same profile applies to all META and LINK
elements in the document head.

User agents are not required to support meta data mechanisms. For those that choose to support meta data,
this specification does not define how meta data should be interpreted.

The META element


<!ELEMENT META - O EMPTY -- generic metainformation -->
<!ATTLIST META
%i18n; -- lang, dir, for use with content --
http-equiv NAME #IMPLIED -- HTTP response header name --
name NAME #IMPLIED -- metainformation name --
content CDATA #REQUIRED -- associated information --
scheme CDATA #IMPLIED -- select form of content --
>

Start tag: required, End tag: forbidden

Attribute definitions

For the following attributes, the permitted values and their interpretation are profile dependent:

58
7.4.4 Meta data

name = name [p.44] [CS] [p.43]


This attribute identifies a property name. This specification does not list legal values for this
attribute.
content = cdata [p.44] [CS] [p.43]
This attribute specifies a property’s value. This specification does not list legal values for this
attribute.
scheme = cdata [p.44] [CS] [p.43]
This attribute names a scheme to be used to interpret the property’s value (see the section on profiles
[p.61] for details).
http-equiv = name [p.44] [CI] [p.43]
This attribute may be used in place of the name attribute. HTTP servers use this attribute to gather
information for HTTP response message headers.

Attributes defined elsewhere

lang (language information [p.71] ), dir (text direction [p.73] )

The META element can be used to identify properties of a document (e.g., author, expiration date, a list of
key words, etc.) and assign values to those properties. This specification does not define a normative set of
properties.

Each META element specifies a property/value pair. The name attribute identifies the property and the
content attribute specifies the property’s value.

For example, the following declaration sets a value for the Author property:
<META name="Author" content="Dave Raggett">

The lang attribute can be used with META to specify the language for the value of the content
attribute. This enables speech synthesizers to apply language dependent pronunciation rules.

In this example, the author’s name is declared to be French:


<META name="Author" lang="fr" content="Arnaud Le Hors">

Note. The META element is a generic mechanism for specifying meta data. However, some HTML
elements and attributes already handle certain pieces of meta data and may be used by authors instead of
META to specify those pieces: the TITLE element, the ADDRESS element, the INS and DEL elements, the
title attribute, and the cite attribute.

Note. When a property specified by a META element takes a value that is a URI [p.44] , some authors
prefer to specify the meta data via the LINK element. Thus, the following meta data declaration:
<META name="[Link]"
content="[Link]

might also be written:

59
7.4.4 Meta data

<LINK rel="[Link]"
type="text/plain"
href="[Link]

META and HTTP headers

The http-equiv attribute can be used in place of the name attribute and has a special significance
when documents are retrieved via the Hypertext Transfer Protocol (HTTP). HTTP servers may use the
property name specified by the http-equiv attribute to create an [RFC822] [p.330] -style header in the
HTTP response. Please see the HTTP specification ([RFC2068] [p.328] ) for details on valid HTTP
headers.

The following sample META declaration:


<META http-equiv="Expires" content="Tue, 20 Aug 1996 14:25:27 GMT">

will result in the HTTP header:


Expires: Tue, 20 Aug 1996 14:25:27 GMT

This can be used by caches to determine when to fetch a fresh copy of the associated document.

Some user agents support the use of META to refresh the current page after a specified number of seconds,
with the option of replacing it by a different URI.
<META http-equiv="refresh" content="3,[Link]

The content is a number specifying the delay in seconds, followed by the URI to load when the time is up.
This mechanism is generally used to show users a fleeting introductory page. However, since some user
agents do not support this mechanism, authors should include content on the introductory page to allow
users to navigate away from it (so they don’t remain "stranded" on the introductory page).

META and search engines

A common use for META is to specify keywords that a search engine may use to improve the quality of
search results. When several META elements provide language-dependent information about a document,
search engines may filter on the lang attribute to display search results using the language preferences of
the user. For example,
<-- For speakers of US English -->
<META name="keywords" lang="en-us"
content="vacation, Greece, sunshine">
<-- For speakers of British English -->
<META name="keywords" lang="en"
content="holiday, Greece, sunshine">
<-- For speakers of French -->
<META name="keywords" lang="fr"
content="vacances, Gr&egrave;ce, soleil">

60
7.4.4 Meta data

The effectiveness of search engines can also be increased by using the LINK element to specify links to
translations of the document in other languages, links to versions of the document in other media (e.g.,
PDF), and, when the document is part of a collection, links to an appropriate starting point for browsing
the collection.

Further help is provided in the section on helping search engines index your Web site [p.315] .

META and PICS


The Platform for Internet Content Selection (PICS, specified in [PICS] [p.329] ) is an infrastructure for
associating labels (meta data) with Internet content. Originally designed to help parents and teachers
control what children can access on the Internet, it also facilitates other uses for labels, including code
signing, privacy, and intellectual property rights management.

This example illustrates how one can use a META declaration to include a PICS 1.1 label:
<HEAD>
<META http-equiv="PICS-Label" content=’
(PICS-1.1 "[Link]
labels on "1994.11.05T08:15-0500"
until "1995.12.31T23:59-0000"
for "[Link]
ratings (suds 0.5 density 0 color/hue 1))
’>
<TITLE>... document title ...</TITLE>
</HEAD>

META and default information

The META element may be used to specify the default information for a document in the following
instances:

The default scripting language [p.239] .


The default style sheet language [p.173] .
The document character encoding [p.37] .

The following example specifies the character encoding [p.37] for a document as being ISO-8859-5
<META http-equiv="Content-Type" content="text/html; charset=ISO-8859-5">

Meta data profiles


The profile attribute of the HEAD specifies the location of a meta data profile. The value of the
profile attribute is a URI. User agents may use this URI in two ways:

As a globally unique name. User agents may be able to recognize the name (without actually
retrieving the profile) and perform some activity based on known conventions for that profile. For
instance, search engines could provide an interface for searching through catalogs of HTML
documents, where these documents all use the same profile for representing catalog entries.
As a link. User agents may dereference the URI and, perform some activity based on the actual
definitions within the profile (e.g., authorize the usage of the profile within the current HTML

61
7.5 The document body

document). This specification does not define formats for profiles.

This example refers to a hypothetical profile that defines useful properties for document indexing. The
properties defined by this profile -- including "author", "copyright", "keywords", and "date" -- have their
values set by subsequent META declarations.
<HEAD profile="[Link]
<TITLE>How to complete Memorandum cover sheets</TITLE>
<META name="author" content="John Doe">
<META name="copyright" content="&copy; 1997 Acme Corp.">
<META name="keywords" content="corporate,guidelines,cataloging">
<META name="date" content="1994-11-06T08:49:37+00:00">
</HEAD>

As this specification is being written, it is common practice to use the date formats described in
[RFC2068] [p.328] , section 3.3. As these formats are relatively hard to process, we recommend that
authors use the [ISO8601] [p.327] date format. For more information, see the sections on the INS and
DEL elements.

The scheme attribute allows authors to provide user agents more context for the correct interpretation of
meta data. At times, such additional information may be critical, as when meta data may be specified in
different formats. For example, an author might specify a date in the (ambiguous) format "10-9-97"; does
this mean 9 October 1997 or 10 September 1997? The scheme attribute value "Month-Date-Year" would
disambiguate this date value.

At other times, the scheme attribute may provide helpful but non-critical information to user agents.

For example, the following scheme declaration may help a user agent determine that the value of the
"identifier" property is an ISBN code number:
<META scheme="ISBN" name="identifier" content="0-8230-2355-9">

Values for the scheme attribute depend on the property name and the associated profile.

Note. One sample profile is the Dublin Core (see [DCORE] [p.329] ). This profile defines a set of
recommended properties for electronic bibliographic descriptions, and is intended to promote
interoperability among disparate description models.

7.5 The document body


7.5.1 The BODY element
<!ELEMENT BODY O O (%block;|SCRIPT)+ +(INS|DEL) -- document body -->
<!ATTLIST BODY
%attrs; -- %coreattrs, %i18n, %events --
onload %Script; #IMPLIED -- the document has been loaded --
onunload %Script; #IMPLIED -- the document has been removed --
>

62
7.5.1 The BODY element

Start tag: optional, End tag: optional

Attribute definitions

background = uri [p.44] [CT] [p.43]


Deprecated. [p.34] The value of this attribute is a URI that designates an image resource. The image
generally tiles the background (for visual browsers).
text = color [p.45] [CI] [p.43]
Deprecated. [p.34] This attribute sets the foreground color for text (for visual browsers).
link = color [p.45] [CI] [p.43]
Deprecated. [p.34] This attribute sets the color of text marking unvisited hypertext links (for visual
browsers).
vlink = color [p.45] [CI] [p.43]
Deprecated. [p.34] This attribute sets the color of text marking visited hypertext links (for visual
browsers).
alink = color [p.45] [CI] [p.43]
Deprecated. [p.34] This attribute sets the color of text marking hypertext links when selected by the
user (for visual browsers).

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
bgcolor (background color [p.183] )
onload, onunload (intrinsic events [p.240] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The body of a document contains the document’s content. The content may be presented by a user agent
in a variety of ways. For example, for visual browsers, you can think of the body as a canvas where the
content appears: text, images, colors, graphics, etc. For audio user agents, the same content may be
spoken. Since style sheets [p.171] are now the preferred way to specify a document’s presentation, the
presentational attributes of BODY have been deprecated [p.34] .

DEPRECATED EXAMPLE:
The following HTML fragment illustrates the use of the deprecated [p.34] attributes. It sets the
background color of the canvas to white, the text foreground color to black, and the color of hyperlinks to
red initially, fuchsia when activated, and maroon once visited.

63
7.5.1 The BODY element

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A study of population dynamics</TITLE>
</HEAD>
<BODY bgcolor="white" text="black"
link="red" alink="fuchsia" vlink="maroon">
... document body...
</BODY>
</HTML>

Using style sheets [p.171] , the same effect could be accomplished as follows:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A study of population dynamics</TITLE>
<STYLE type="text/css">
BODY { background: white; color: black}
A:link { color: red }
A:visited { color: maroon }
A:active { color: fuchsia }
</STYLE>
</HEAD>
<BODY>
... document body...
</BODY>
</HTML>

Using external (linked) style sheets gives you the flexibility to change the presentation without revising
the source HTML document:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A study of population dynamics</TITLE>
<LINK rel="stylesheet" type="text/css" href="[Link]">
</HEAD>
<BODY>
... document body...
</BODY>
</HTML>

Framesets and HTML bodies. Documents that contain framesets replace the BODY element by the
FRAMESET element. Please consult the section on frames [p.193] for more information.

64
7.5.2 Element identifiers: the id and class attributes

7.5.2 Element identifiers: the id and class attributes


Attribute definitions

id = name [p.44] [CS] [p.43]


This attribute assigns a name to an element. This name must be unique in a document.
class = cdata-list [p.44] [CS] [p.43]
This attribute assigns a class name or set of class names to an element. Any number of elements may
be assigned the same class name or names. Multiple class names must be separated by white space
characters.

The id attribute assigns a unique identifier to an element (which may be verified by an SGML parser).
For example, the following paragraphs are distinguished by their id values:
<P id="myparagraph"> This is a uniquely named paragraph.</P>
<P id="yourparagraph"> This is also a uniquely named paragraph.</P>

The id attribute has several roles in HTML:

As a style sheet [p.171] selector.


As a target anchor [p.135] for hypertext links.
As a means to reference a particular element from a script [p.240] .
As the name of a declared OBJECT element.
For general purpose processing by user agents (e.g. for identifying fields when extracting data from
HTML pages into a database, translating HTML documents into other formats, etc.).

The class attribute, on the other hand, assigns one or more class names to an element; the element may
be said to belong to these classes. A class name may be shared by several element instances. The class
attribute has several roles in HTML:

As a style sheet [p.171] selector (when an author wishes to assign style information to a set of
elements).
For general purpose processing by user agents.

In the following example, the SPAN element is used in conjunction with the id and class attributes to
markup document messages. Messages appear in both English and French versions.
<!-- English messages -->
<P><SPAN id="msg1" class="info" lang="en">Variable declared twice</SPAN>
<P><SPAN id="msg2" class="warning" lang="en">Undeclared variable</SPAN>
<P><SPAN id="msg3" class="error" lang="en">Bad syntax for variable name</SPAN>

<!-- French messages -->


<P><SPAN id="msg1" class="info" lang="fr">Variable d&eacute;clar&eacute;e deux fois</SPAN>
<P><SPAN id="msg2" class="warning" lang="fr">Variable ind&eacute;finie</SPAN>
<P><SPAN id="msg3" class="error" lang="fr">Erreur de syntaxe pour variable</SPAN>

65
7.5.3 Block-level and inline elements

The following CSS style rules would tell visual user agents to display informational messages in green,
warning messages in yellow, and error messages in red:
[Link] { color: green }
[Link] { color: yellow }
[Link] { color: red }

Note that the French "msg1" and the English "msg1" may not appear in the same document since they
share the same id value. Authors may make further use of the id attribute to refine the presentation of
individual messages, make them target anchors, etc.

Almost every HTML element may be assigned identifier and class information.

Suppose, for example, that we are writing a document about a programming language. The document is to
include a number of preformatted examples. We use the PRE element to format the examples. We also
assign a background color (green) to all instances of the PRE element belonging to the class "example".
<HEAD>
<TITLE>... document title ...</TITLE>
<STYLE type="text/css">
[Link] { background : green }
</STYLE>
</HEAD>
<BODY>
<PRE class="example" id="example-1">
...example code here...
</PRE>
</BODY>

By setting the id attribute for this example, we can (1) create a hyperlink to it and (2) override class style
information with instance style information.

Note. The id attribute shares the same name space as the name attribute when used for anchor names.
Please consult the section on anchors with id [p.142] for more information.

7.5.3 Block-level and inline elements


Certain HTML elements that may appear in BODY are said to be "block-level" while others are "inline"
(also known as "text level"). The distinction is founded on several notions:

Content model
Generally, block-level elements may contain inline elements and other block-level elements.
Generally, inline elements may contain only data and other inline elements. Inherent in this structural
distinction is the idea that block elements create "larger" structures than inline elements.
Formatting
By default, block-level elements are formatted differently than inline elements. Generally,
block-level elements begin on new lines, inline elements do not. For information about white space,
line breaks, and block formatting, please consult the section on text [p.81] .

66
7.5.4 Grouping elements: the DIV and SPAN elements

Directionality
For technical reasons involving the [UNICODE] [p.328] bidirectional text algorithm, block-level and
inline elements differ in how they inherit directionality information. For details, see the section on
inheritance of text direction [p.75] .

Style sheets [p.171] provide the means to specify the rendering of arbitrary elements, including whether
an element is rendered as block or inline. In some cases, such as an inline style for list elements, this may
be appropriate, but generally speaking, authors are discouraged from overriding the conventional
interpretation of HTML elements in this way.

The alteration of the traditional presentation idioms for block level and inline elements also has an impact
on the bidirectional text algorithm. See the section on the effect of style sheets on bidirectionality [p.79]
for more information.

7.5.4 Grouping elements: the DIV and SPAN elements


<!ELEMENT DIV - - (%flow;)* -- generic language/style container -->
<!ATTLIST DIV
%attrs; -- %coreattrs, %i18n, %events --
>
<!ELEMENT SPAN - - (%inline;)* -- generic language/style container -->
<!ATTLIST SPAN
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
align (alignment [p.183] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The DIV and SPAN elements, in conjunction with the id and class attributes, offer a generic
mechanism for adding structure to documents. These elements define content to be inline (SPAN) or
block-level (DIV) but impose no other presentational idioms on the content. Thus, authors may use these
elements in conjunction with style sheets [p.171] , the lang attribute, etc., to tailor HTML to their own
needs and tastes.

Suppose, for example, that we wanted to generate an HTML document based on a database of client
information. Since HTML does not include elements that identify objects such as "client", "telephone
number", "email address", etc., we use DIV and SPAN to achieve the desired structural and presentational
effects. We might use the TABLE element as follows to structure the information:

67
7.5.5 Headings: The H1, H2, H3, H4, H5, H6 elements

<!-- Example of data from the client database: -->


<!-- Name: Stephane Boyera, Tel: (212) 555-1212, Email: sb@[Link] -->

<DIV id="client-boyera" class="client">


<P><SPAN class="client-title">Client information:</SPAN>
<TABLE class="client-data">
<TR><TH>Last name:<TD>Boyera</TR>
<TR><TH>First name:<TD>Stephane</TR>
<TR><TH>Tel:<TD>(212) 555-1212</TR>
<TR><TH>Email:<TD>sb@[Link]</TR>
</TABLE>
</DIV>

<DIV id="client-lafon" class="client">


<P><SPAN class="client-title">Client information:</SPAN>
<TABLE class="client-data">
<TR><TH>Last name:<TD>Lafon</TR>
<TR><TH>First name:<TD>Yves</TR>
<TR><TH>Tel:<TD>(617) 555-1212</TR>
<TR><TH>Email:<TD>yves@[Link]</TR>
</TABLE>
</DIV>

Later, we may easily add style sheet declaration to fine tune the presentation of these database entries.

For another example of usage, please consult the example in the section on the class and id attributes
[p.65] .

Visual user agents generally place a line break before and after DIV elements, for instance:
<P>aaaaaaaaa<DIV>bbbbbbbbb</DIV><DIV>ccccc<P>ccccc</DIV>

which is typically rendered as:


aaaaaaaaa
bbbbbbbbb
ccccc

ccccc

7.5.5 Headings: The H1, H2, H3, H4, H5, H6 elements


<!ENTITY % heading "H1|H2|H3|H4|H5|H6">
<!--
There are six levels of headings from H1 (the most important)
to H6 (the least important).
-->

<!ELEMENT (%heading;) - - (%inline;)* -- heading -->


<!ATTLIST (%heading;)
%attrs; -- %coreattrs, %i18n, %events --
>

68
7.5.5 Headings: The H1, H2, H3, H4, H5, H6 elements

Start tag: required, End tag: required

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
align (alignment [p.183] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

A heading element briefly describes the topic of the section it introduces. Heading information may be
used by user agents, for example, to construct a table of contents for a document automatically.

There are six levels of headings in HTML with H1 as the most important and H6 as the least. Visual
browsers usually render more important headings in larger fonts than less important ones.

The following example shows how to use the DIV element to associate a heading with the document
section that follows it. Doing so allows you to define a style for the section (color the background, set the
font, etc.) with style sheets.
<DIV class="section" id="forest-elephants" >
<H1>Forest elephants</H1>
<P>In this section, we discuss the lesser known forest elephants.
...this section continues...
<DIV class="subsection" id="forest-habitat" >
<H2>Habitat</H2>
<P>Forest elephants do not live in trees but among them.
...this subsection continues...
</DIV>
</DIV>

This structure may be decorated with style information such as:


<HEAD>
<TITLE>... document title ...</TITLE>
<STYLE type="text/css">
[Link] { text-align: justify; font-size: 12pt}
[Link] { text-indent: 2em }
H1 { font-style: italic; color: green }
H2 { color: green }
</STYLE>
</HEAD>

Numbered sections and references


HTML does not itself cause section numbers to be generated from headings. This facility may be offered
by user agents, however. Soon, style sheet languages such as CSS will allow authors to control the
generation of section numbers (handy for forward references in printed documents, as in "See section
7.2").

69
7.5.6 The ADDRESS element

Some people consider skipping heading levels to be bad practice. They accept H1 H2 H1 while they do
not accept H1 H3 H1 since the heading level H2 is skipped.

7.5.6 The ADDRESS element


<!ELEMENT ADDRESS - - (%inline;)* -- information on author -->
<!ATTLIST ADDRESS
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The ADDRESS element may be used by authors to supply contact information for document or a major
part of a document such as a form. This element often appears at the beginning or end of a document.

For example, a page at the W3C Web site related to HTML might include the following contact
information:
<ADDRESS>
<A href="../People/Raggett/">Dave Raggett</A>,
<A href="../People/Arnaud/">Arnaud Le Hors</A>,
contact persons for the <A href="Activity">W3C HTML Activity</A><BR>
$Date: 1998/04/02 00:20:03 $
</ADDRESS>

70
8 Language information and text direction

8 Language information and text direction


Contents

1. Specifying the language of content: the lang attribute . . . . . . . . . 71


.
1. Language codes . . . . . . . . . . . . . . . . . 72
.
2. Inheritance of language codes . . . . . . . . . . . . . . 72
.
3. Interpretation of language codes . . . . . . . . . . . . . 73
.
2. Specifying the direction of text and tables: the dir attribute . . . . . . . . 73
.
1. Introduction to the bidirectional algorithm . . . . . . . . . . . 74
.
2. Inheritance of text direction information . . . . . . . . . . . 75
.
3. Setting the direction of embedded text . . . . . . . . . . . . 75
.
4. Overriding the bidirectional algorithm: the BDO element . . . . . . . . 76
.
5. Character references for directionality and joining control . . . . . . . 78
.
6. The effect of style sheets on bidirectionality . . . . . . . . . . . 79
.

This section of the document discusses two important issues that affect the internationalization of HTML:
specifying the language (the lang attribute) and direction (the dir attribute) of text in a document.

8.1 Specifying the language of content: the lang attribute


Attribute definitions

lang = language-code [p.47] [CI] [p.43]


This attribute specifies the base language of an element’s attribute values and text content. The
default value of this attribute is unknown.

Language information specified via the lang attribute may be used by a user agent to control rendering in
a variety of ways. Some situations where author-supplied language information may be helpful include:

Assisting search engines


Assisting speech synthesizers
Helping a user agent select glyph variants for high quality typography
Helping a user agent choose a set of quotation marks
Helping a user agent make decisions about hyphenation [p.88] , ligatures, and spacing
Assisting spell checkers and grammar checkers

The lang attribute specifies the language of element content and attribute values; whether it is relevant
for a given attribute depends on the syntax and semantics of the attribute and the operation involved.

The intent of the lang attribute is to allow user agents to render content more meaningfully based on
accepted cultural practice for a given language. This does not imply that user agents should render
characters that are atypical for a particular language in less meaningful ways; user agents must make a
best attempt to render all characters, regardless of the value specified by lang.

71
8.1.1 Language codes

For instance, if characters from the Greek alphabet appear in the midst of English text:
<P><Q lang="en">Her super-powers were the result of
&gamma;-radiation,</Q> he explained.</P>

a user agent (1) should try to render the English content in an appropriate manner (e.g., in its handling the
quotation marks) and (2) must make a best attempt to render γ even though it is not an English character.

Please consult the section on undisplayable characters [p.42] for related information.

8.1.1 Language codes


The lang attribute’s value is a language code that identifies a natural language spoken, written, or
otherwise used for the communication of information among people. Computer languages are explicitly
excluded from language codes.

[RFC1766] [p.328] defines and explains the language codes that must be used in HTML documents.

Briefly, language codes consist of a primary code and a possibly empty series of subcodes:
language-code = primary-code ( "-" subcode )*

Here are some sample language codes:

"en": English
"en-US": the U.S. version of English.
"en-cockney": the Cockney version of English.
"i-navajo": the Navajo language spoken by some Native Americans.
"x-klingon": The primary tag "x" indicates an experimental language tag

Two-letter primary codes are reserved for [ISO639] [p.327] language abbreviations. Two-letter codes
include fr (French), de (German), it (Italian), nl (Dutch), el (Greek), es (Spanish), pt (Portuguese), ar
(Arabic), he (Hebrew), ru (Russian), zh (Chinese), ja (Japanese), hi (Hindi), ur (Urdu), and sa (Sanskrit).

Any two-letter subcode is understood to be a [ISO3166] [p.327] country code.

8.1.2 Inheritance of language codes


An element inherits language code information according to the following order of precedence (highest to
lowest):

The lang attribute set for the element itself.


The closest parent element that has the lang attribute set (i.e., the lang attribute is inherited).
The HTTP "Content-Language" header (which may be configured in a server). For example:
Content-Language: en-cockney

User agent default values and user preferences.

72
8.2 Specifying the direction of text and tables: the dir attribute

In this example, the primary language of the document is French ("fr"). One paragraph is declared to be in
Spanish ("es"), after which the primary language returns to French. The following paragraph includes an
embedded Japanese ("ja") phrase, after which the primary language returns to French.
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML lang="fr">
<HEAD>
<TITLE>Un document multilingue</TITLE>
</HEAD>
<BODY>
...Interpreted as French...
<P lang="es">...Interpreted as Spanish...
<P>...Interpreted as French again...
<P>...French text interrupted by<EM lang="ja">some
Japanese</EM>French begins here again...
</BODY>
</HTML>

Note. Table cells may inherit lang values not from its parent but from the first cell in a span. Please
consult the section on alignment inheritance [p.123] for details.

8.1.3 Interpretation of language codes


In the context of HTML, a language code should be interpreted by user agents as a hierarchy of tokens
rather than a single token. When a user agent adjusts rendering according to language information (say, by
comparing style sheet language codes and lang values), it should always favor an exact match, but
should also consider matching primary codes to be sufficient. Thus, if the lang attribute value of
"en-US" is set for the HTML element, a user agent should prefer style information that matches "en-US"
first, then the more general value "en".

Note. Language code hierarchies do not guarantee that all languages with a common prefix will be
understood by those fluent in one or more of those languages. They do allow a user to request this
commonality when it is true for that user.

8.2 Specifying the direction of text and tables: the dir attribute
Attribute definitions

dir = LTR | RTL [CI] [p.43]


This attribute specifies the base direction of directionally neutral text (i.e., text that doesn’t have
inherent directionality as defined in [UNICODE] [p.328] ) and the directionality of tables [p.105] .
Possible values:
LTR: Left-to-right text or table.
RTL: Right-to-left text or table.

In addition to specifying the language of a document with the lang attribute, authors may need to specify
the base directionality (left-to-right or right-to-left) of portions of a document’s text, of table structure, etc.
This is done with the dir attribute.

73
8.2.1 Introduction to the bidirectional algorithm

The [UNICODE] [p.328] specification assigns directionality to characters and defines a (complex)
algorithm for determining the proper directionality of text. If a document does not contain a displayable
right-to-left character, a conforming user agent is not required to apply the [UNICODE] [p.328]
bidirectional algorithm. If a document contains right-to-left characters, and if the user agent displays these
characters, the user agent must use the bidirectional algorithm.

Although Unicode specifies special characters that deal with text direction, HTML offers higher-level
markup constructs that do the same thing: the dir attribute (do not confuse with the DIR element) and
the BDO element. Thus, to express a Hebrew quotation, it is more intuitive to write
<Q lang="he" dir="rtl">...a Hebrew quotation...</Q>

than the equivalent with Unicode references:


&#x202B;&#x05F4;...a Hebrew quotation...&#x05F4;&#x202C;

User agents must not use the lang attribute to determine text directionality.

The dir attribute is inherited and may be overridden. Please consult the section on the inheritance of text
direction information [p.75] for details.

8.2.1 Introduction to the bidirectional algorithm


The following example illustrates the expected behavior of the bidirectional algorithm. It involves
English, a left-to-right script, and Hebrew, a right-to-left script.

Consider the following example text:


english1 HEBREW2 english3 HEBREW4 english5 HEBREW6

The characters in this example (and in all related examples) are stored in the computer the way they are
displayed here: the first character in the file is "e", the second is "n", and the last is "6".

Suppose the predominant language of the document containing this paragraph is English. This means that
the base direction is left-to-right. The correct presentation of this line would be:
english1 2WERBEH english3 4WERBEH english5 6WERBEH
<------ <------ <------
H H H
------------------------------------------------->
E

The dotted lines indicate the structure of the sentence: English predominates and some Hebrew text is
embedded. Achieving the correct presentation requires no additional markup since the Hebrew fragments
are reversed correctly by user agents applying the bidirectional algorithm.

If, on the other hand, the predominant language of the document is Hebrew, the base direction is
right-to-left. The correct presentation is therefore:

74
8.2.2 Inheritance of text direction information

6WERBEH english5 4WERBEH english3 2WERBEH english1


-------> -------> ------->
E E E
<-------------------------------------------------
H

In this case, the whole sentence has been presented as right-to-left and the embedded English sequences
have been properly reversed by the bidirectional algorithm.

8.2.2 Inheritance of text direction information


The Unicode bidirectional algorithm requires a base text direction for text blocks. To specify the base
direction of a block-level element, set the element’s dir attribute. The default value of the dir attribute
is "ltr" (left-to-right text).

When the dir attribute is set for a block-level element, it remains in effect for the duration of the element
and any nested block-level elements. Setting the dir attribute on a nested element overrides the inherited
value.

To set the base text direction for an entire document, set the dir attribute on the HTML element.

For example:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML dir="RTL">
<HEAD>
<TITLE>...a right-to-left title...</TITLE>
</HEAD>
...right-to-left text...
<P dir="ltr">...left-to-right text...</P>
<P>...right-to-left text again...</P>
</HTML>

Inline elements, on the other hand, do not inherit the dir attribute. This means that an inline element
without a dir attribute does not open an additional level of embedding with respect to the bidirectional
algorithm. (Here, an element is considered to be block-level or inline based on its default presentation.
Note that the INS and DEL elements can be block-level or inline depending on their context.)

8.2.3 Setting the direction of embedded text


The [UNICODE] [p.328] bidirectional algorithm automatically reverses embedded character sequences
according to their inherent directionality (as illustrated by the previous examples). However, in general
only one level of embedding can be accounted for. To achieve additional levels of embedded direction
changes, you must make use of the dir attribute on an inline element.

Consider the same example text as before:

75
8.2.4 Overriding the bidirectional algorithm: the BDO element

english1 HEBREW2 english3 HEBREW4 english5 HEBREW6

Suppose the predominant language of the document containing this paragraph is English. Furthermore, the
above English sentence contains a Hebrew section extending from HEBREW2 through HEBREW4 and
the Hebrew section contains an English quotation (english3). The desired presentation of the text is thus:
english1 4WERBEH english3 2WERBEH english5 6WERBEH
------->
E
<-----------------------
H
------------------------------------------------->
E

To achieve two embedded direction changes, we must supply additional information, which we do by
delimiting the second embedding explicitly. In this example, we use the SPAN element and the dir
attribute to mark up the text:
english1 <SPAN dir="RTL">HEBREW2 english3 HEBREW4</SPAN> english5 HEBREW6

Authors may also use special Unicode characters to achieve multiply embedded direction changes. To
achieve left-to-right embedding, surround embedded text with the characters LEFT-TO-RIGHT
EMBEDDING ("LRE", hexadecimal 202A) and POP DIRECTIONAL FORMATTING ("PDF",
hexadecimal 202C). To achieve right-to-left embedding, surround embedded text with the characters
RIGHT-TO-LEFT EMBEDDING ("RTE", hexadecimal 202B) and PDF.

Using HTML directionality markup with Unicode characters. Authors and designers of authoring
software should be aware that conflicts can arise if the dir attribute is used on inline elements (including
BDO) concurrently with the corresponding [UNICODE] [p.328] formatting characters. Preferably one or
the other should be used exclusively. The markup method offers a better guarantee of document structural
integrity and alleviates some problems when editing bidirectional HTML text with a simple text editor, but
some software may be more apt at using the [UNICODE] [p.328] characters. If both methods are used,
great care should be exercised to insure proper nesting of markup and directional embedding or override,
otherwise, rendering results are undefined.

8.2.4 Overriding the bidirectional algorithm: the BDO element


<!ELEMENT BDO - - (%inline;)* -- I18N BiDi over-ride -->
<!ATTLIST BDO
%coreattrs; -- id, class, style, title --
lang %LanguageCode; #IMPLIED -- language code --
dir (ltr|rtl) #REQUIRED -- directionality --
>

Start tag: required, End tag: required

Attribute definitions

76
8.2.4 Overriding the bidirectional algorithm: the BDO element

dir = LTR | RTL [CI] [p.43]


This mandatory attribute specifies the base direction of the element’s text content. This direction
overrides the inherent directionality of characters as defined in [UNICODE] [p.328] . Possible
values:
LTR: Left-to-right text.
RTL: Right-to-left text.

Attributes defined elsewhere

lang (language information [p.71] )

The bidirectional algorithm and the dir attribute generally suffice to manage embedded direction
changes. However, some situations may arise when the bidirectional algorithm results in incorrect
presentation. The BDO element allows authors to turn off the bidirectional algorithm for selected
fragments of text.

Consider a document containing the same text as before:


english1 HEBREW2 english3 HEBREW4 english5 HEBREW6

but assume that this text has already been put in visual order. One reason for this may be that the MIME
standard ([RFC2045] [p.328] , [RFC1556] [p.328] ) favors visual order, i.e., that right-to-left character
sequences are inserted right-to-left in the byte stream. In an email, the above might be formatted,
including line breaks, as:
english1 2WERBEH english3
4WERBEH english5 6WERBEH

This conflicts with the [UNICODE] [p.328] bidirectional algorithm, because that algorithm would invert
2WERBEH, 4WERBEH, and 6WERBEH a second time, displaying the Hebrew words left-to-right instead of
right-to-left.

The solution in this case is to override the bidirectional algorithm by putting the Email excerpt in a PRE
element (to conserve line breaks) and each line in a BDO element, whose dir attribute is set to LTR:
<PRE>
<BDO dir="LTR">english1 2WERBEH english3</BDO>
<BDO dir="LTR">4WERBEH english5 6WERBEH</BDO>
</PRE>

This tells the bidirectional algorithm "Leave me left-to-right!" and would produce the desired
presentation:
english1 2WERBEH english3
4WERBEH english5 6WERBEH

The BDO element should be used in scenarios where absolute control over sequence order is required (e.g.,
multi-language part numbers). The dir attribute is mandatory for this element.

77
8.2.5 Character references for directionality and joining control

Authors may also use special Unicode characters to override the bidirectional algorithm --
LEFT-TO-RIGHT OVERRIDE (202D) or RIGHT-TO-LEFT OVERRIDE (hexadecimal 202E). The POP
DIRECTIONAL FORMATTING (hexadecimal 202C) character ends either bidirectional override.

Note. Recall that conflicts can arise if the dir attribute is used on inline elements (including BDO)
concurrently with the corresponding [UNICODE] [p.328] formatting characters.

Bidirectionality and character encoding According to [RFC1555] [p.327] and [RFC1556] [p.328] ,
there are special conventions for the use of "charset" parameter values to indicate bidirectional treatment
in MIME mail, in particular to distinguish between visual, implicit, and explicit directionality. The
parameter value "ISO-8859-8" (for Hebrew) denotes visual encoding, "ISO-8859-8-i" denotes implicit
bidirectionality, and "ISO-8859-8-e" denotes explicit directionality.

Because HTML uses the Unicode bidirectionality algorithm, conforming documents encoded using ISO
8859-8 must be labeled as "ISO-8859-8-i". Explicit directional control is also possible with HTML, but
cannot be expressed with ISO 8859-8, so "ISO-8859-8-e" should not be used.

The value "ISO-8859-8" implies that the document is formatted visually, misusing some markup (such as
TABLE with right alignment and no line wrapping) to ensure reasonable display on older user agents that
do not handle bidirectionality. Such documents do not conform to the present specification. If necessary,
they can be made to conform to the current specification (and at the same time will be displayed correctly
on older user agents) by adding BDO markup where necessary. Contrary to what is said in [RFC1555]
[p.327] and [RFC1556] [p.328] , ISO-8859-6 (Arabic) is not visual ordering.

8.2.5 Character references for directionality and joining control


Since ambiguities sometimes arise as to the directionality of certain characters (e.g., punctuation), the
[UNICODE] [p.328] specification includes characters to enable their proper resolution. Also, Unicode
includes some characters to control joining behavior where this is necessary (e.g., some situations with
Arabic letters). HTML 4.0 includes character references [p.289] for these characters.

The following DTD excerpt presents some of the directional entities:


<!ENTITY zwnj CDATA "&#8204;"--=zero width non-joiner-->
<!ENTITY zwj CDATA "&#8205;"--=zero width joiner-->
<!ENTITY lrm CDATA "&#8206;"--=left-to-right mark-->
<!ENTITY rlm CDATA "&#8207;"--=right-to-left mark-->

The zwnj entity is used to block joining behavior in contexts where joining will occur but shouldn’t. The
zwj entity does the opposite; it forces joining when it wouldn’t occur but should. For example, the Arabic
letter "HEH" is used to abbreviate "Hijri", the name of the Islamic calendar system. Since the isolated
form of "HEH" looks like the digit five as employed in Arabic script (based on Indic digits), in order to
prevent confusing "HEH" as a final digit five in a year, the initial form of "HEH" is used. However, there
is no following context (i.e., a joining letter) to which the "HEH" can join. The zwj character provides
that context.

78
8.2.6 The effect of style sheets on bidirectionality

Similarly, in Persian texts, there are cases where a letter that normally would join a subsequent letter in a
cursive connection should not. The character zwnj is used to block joining in such cases.

The other characters, lrm and rlm, are used to force directionality of directionally neutral characters. For
example, if a double quotation mark comes between an Arabic (right-to-left) and a Latin (left-to-right)
letter, the direction of the quotation mark is not clear (is it quoting the Arabic text or the Latin text?). The
lrm and rlm characters have a directional property but no width and no word/line break property. Please
consult [UNICODE] [p.328] for more details.

Mirrored character glyphs. In general, the bidirectional algorithm does not mirror character glyphs but
leaves them unaffected. An exception are characters such as parentheses (see [UNICODE] [p.328] , table
4-7). In cases where mirroring is desired, for example for Egyptian Hieroglyphs, Greek Bustrophedon, or
special design effects, this should be controlled with styles.

8.2.6 The effect of style sheets on bidirectionality


In general, using style sheets to change an element’s visual rendering from block-level to inline or
vice-versa is straightforward. However, because the bidirectional algorithm relies on the inline/block-level
distinction [p.75] , special care must be taken during the transformation.

When an inline element that does not have a dir attribute is transformed to the style of a block-level
element by a style sheet, it inherits the dir attribute from its closest parent block element to define the
base direction of the block.

When a block element that does not have a dir attribute is transformed to the style of an inline element
by a style sheet, the resulting presentation should be equivalent, in terms of bidirectional formatting, to the
formatting obtained by explicitly adding a dir attribute (assigned the inherited value) to the transformed
element.

79
8.2.6 The effect of style sheets on bidirectionality

80
9 Text

9 Text
Contents

1. White space . . . . . . . . . . . . . . . . . . . 81
.
2. Structured text . . . . . . . . . . . . . . . . . . 82
.
1. Phrase elements: EM, STRONG, DFN, CODE, SAMP, KBD, VAR, CITE, ABBR, and ACRONYM 82
.
2. Quotations: The BLOCKQUOTE and Q elements . . . . . . . . . . 84
.
Rendering quotations . . . . . . . . . . . . . . . 85
.
3. Subscripts and superscripts: the SUB and SUP elements . . . . . . . . 86
.
3. Lines and Paragraphs . . . . . . . . . . . . . . . . . 86
.
1. Paragraphs: the P element . . . . . . . . . . . . . . . 87
.
2. Controlling line breaks . . . . . . . . . . . . . . . 87
.
Forcing a line break: the BR element . . . . . . . . . . . 87
.
Prohibiting a line break . . . . . . . . . . . . . . 88
.
3. Hyphenation . . . . . . . . . . . . . . . . . 88
.
4. Preformatted text: The PRE element . . . . . . . . . . . . 88
.
5. Visual rendering of paragraphs . . . . . . . . . . . . . . 90
.
4. Marking document changes: The INS and DEL elements . . . . . . . . . 91
.

The following sections discuss issues surrounding the structuring of text. Elements that present text
[p.183] (alignment elements, font elements, style sheets, etc.) are discussed elsewhere in the specification.
For information about characters, please consult the section on the document character set. [p.37]

9.1 White space


The document character set [p.37] includes a wide variety of white space characters. Many of these are
typographic elements used in some applications to produce particular visual spacing effects. In HTML,
only the following characters are defined as white space characters:

ASCII space (&#x0020;)


ASCII tab (&#x0009;)
ASCII form feed (&#x000C;)
Zero-width space (&#x200B;)

Line breaks [p.87] are also white space characters. Note that although &#x2028; and &#x2029; are
defined in [ISO10646] [p.327] to unambiguously separate lines and paragraphs, respectively, these do not
constitute line breaks in HTML, nor does this specification include them in the more general category of
white space characters.

This specification does not indicate the behavior, rendering or otherwise, of space characters other than
those explicitly identified here as white space characters. For this reason, authors should use appropriate
elements and styles to achieve visual formatting effects that involve white space, rather than space
characters.

81
9.2 Structured text

For all HTML elements except PRE, sequences of white space separate "words" (we use the term "word"
here to mean "sequences of non-white space characters"). When formatting text, user agents should
identify these words and lay them out according to the conventions of the particular written language
(script) and target medium.

This layout may involve putting space between words (called inter-word space), but conventions for
inter-word space vary from script to script. For example, in Latin scripts, inter-word space is typically
rendered as an ASCII space (&#x0020;), while in Thai it is a zero-width word separator (&#x200B;). In
Japanese and Chinese, inter-word space is not typically rendered at all.

Note that a sequence of white spaces between words in the source document may result in an entirely
different rendered inter-word spacing (except in the case of the PRE element). In particular, user agents
should collapse input white space sequences when producing output inter-word space. This can and
should be done even in the absence of language information (from the lang attribute, the HTTP
"Content-Language" header field (see [RFC2068] [p.328] , section 14.13), user agent settings, etc.).

The PRE element is used for preformatted text [p.88] , where white space is significant.

In order to avoid problems with SGML line break rules [p.311] and inconsistencies among extant
implementations, authors should not rely on user agents to render white space immediately after a start tag
or immediately before an end tag. Thus, authors, and in particular authoring tools, should write:
<P>We offer free <A>technical support</A> for subscribers.</P>

and not:
<P>We offer free<A> technical support </A>for subscribers.</P>

9.2 Structured text


9.2.1 Phrase elements: EM, STRONG, DFN, CODE, SAMP, KBD, VAR, CITE,
ABBR, and ACRONYM
<!ENTITY % phrase "EM | STRONG | DFN | CODE |
SAMP | KBD | VAR | CITE | ABBR | ACRONYM" >
<!ELEMENT (%fontstyle;|%phrase;) - - (%inline;)*>
<!ATTLIST (%fontstyle;|%phrase;)
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )

82
9.2.1 Phrase elements: EM, STRONG, DFN, CODE, SAMP, KBD, VAR, CITE, ABBR, and ACRONYM

onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,


onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

Phrase elements add structural information to text fragments. The usual meanings of phrase elements are
following:

EM:
Indicates emphasis.
STRONG:
Indicates stronger emphasis.
CITE:
Contains a citation or a reference to other sources.
DFN:
Indicates that this is the defining instance of the enclosed term.
CODE:
Designates a fragment of computer code.
SAMP:
Designates sample output from programs, scripts, etc.
KBD:
Indicates text to be entered by the user.
VAR:
Indicates an instance of a variable or program argument.
ABBR:
Indicates an abbreviated form (e.g., WWW, HTTP, URI, Mass., etc.).
ACRONYM:
Indicates an acronym (e.g., WAC, radar, etc.).

EM and STRONG are used to indicate emphasis. The other phrase elements have particular significance in
technical documents. These examples illustrate some of the phrase elements:
As <CITE>Harry S. Truman</CITE> said,
<Q lang="en-us">The buck stops here.</Q>

More information can be found in <CITE>[ISO-0000]</CITE>.

Please refer to the following reference number in future


correspondence: <STRONG>1-234-55</STRONG>

The presentation of phrase elements depends on the user agent. Generally, visual user agents present EM
text in italics and STRONG text in bold font. Speech synthesizer user agents may change the synthesis
parameters, such as volume, pitch and rate accordingly.

The ABBR and ACRONYM elements allow authors to clearly indicate occurrences of abbreviations and
acronyms. Western languages make extensive use of acronyms such as "GmbH", "NATO", and "F.B.I.",
as well as abbreviations like "M.", "Inc.", "et al.", "etc.". Both Chinese and Japanese use analogous
abbreviation mechanisms, wherein a long name is referred to subsequently with a subset of the Han
characters from the original occurrence. Marking up these constructs provides useful information to user
agents and tools such as spell checkers, speech synthesizers, translation systems and search-engine
indexers.

83
9.2.2 Quotations: The BLOCKQUOTE and Q elements

The content of the ABBR and ACRONYM elements specifies the abbreviated expression itself, as it would
normally appear in running text. The title attribute of these elements may be used to provide the full or
expanded form of the expression.

Here are some sample uses of ABBR:


<P>
<ABBR title="World Wide Web">WWW</ABBR>
<ABBR lang="fr"
title="Soci&eacute;t&eacute; Nationale des Chemins de Fer">
SNCF
</ABBR>
<ABBR lang="es" title="Do&ntilde;a">Do&ntilde;a</ABBR>
<ABBR title="Abbreviation">abbr.</ABBR>

Note that abbreviations and acronyms often have idiosyncratic pronunciations. For example, while "IRS"
and "BBC" are typically pronounced letter by letter, "NATO" and "UNESCO" are pronounced
phonetically. Still other abbreviated forms (e.g., "URI" and "SQL") are spelled out by some people and
pronounced as words by other people. When necessary, authors should use style sheets to specify the
pronunciation of an abbreviated form.

9.2.2 Quotations: The BLOCKQUOTE and Q elements


<!ELEMENT BLOCKQUOTE - - (%block;|SCRIPT)+ -- long quotation -->
<!ATTLIST BLOCKQUOTE
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>
<!ELEMENT Q - - (%inline;)* -- short inline quotation -->
<!ATTLIST Q
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>

Start tag: required, End tag: required

Attribute definitions

cite = uri [p.44] [CT] [p.43]


The value of this attribute is a URI that designates a source document or message. This attribute is
intended to give information about the source from which the quotation was borrowed.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

84
9.2.2 Quotations: The BLOCKQUOTE and Q elements

These two elements designate quoted text. BLOCKQUOTE is for long quotations (block-level content) and
Q is intended for short quotations (inline content) that don’t require paragraph breaks.

This example formats an excerpt from "The Two Towers", by J.R.R. Tolkien, as a blockquote.
<BLOCKQUOTE cite="[Link]
<P>They went in single file, running like hounds on a strong scent,
and an eager light was in their eyes. Nearly due west the broad
swath of the marching Orcs tramped its ugly slot; the sweet grass
of Rohan had been bruised and blackened as they passed.</P>
</BLOCKQUOTE>

Rendering quotations
Visual user agents generally render BLOCKQUOTE as an indented block.

Visual user agents must ensure that the content of the Q element is rendered with delimiting quotation
marks. Authors should not put quotation marks at the beginning and end of the content of a Q element.

User agents should render quotation marks in a language-sensitive manner (see the lang attribute). Many
languages adopt different quotation styles for outer and inner (nested) quotations, which should be
respected by user-agents.

The following example illustrates nested quotations with the Q element.


John said, <Q lang="en-us">I saw Lucy at lunch, she says
<Q lang="en-us">Mary wants you
to get some ice cream on your way home.</Q> I think I will get
some at Ben and Jerry’s, on Gloucester Road.</Q>

Since the language of both quotations is American English, user agents should render them appropriately,
for example with single quote marks around the inner quotation and double quote marks around the outer
quotation:
John said, "I saw Lucy at lunch, she told me ’Mary wants you
to get some ice cream on your way home.’ I think I will get some
at Ben and Jerry’s, on Gloucester Road."

Note. We recommend that style sheet implementations provide a mechanism for inserting quotation marks
before and after a quotation delimited by BLOCKQUOTE in a manner appropriate to the current language
context and the degree of nesting of quotations.

However, as some authors have used BLOCKQUOTE merely as a mechanism to indent text, in order to
preserve the intention of the authors, user agents should not insert quotation marks in the default style.

The usage of BLOCKQUOTE to indent text is deprecated [p.34] in favor of style sheets.

85
9.3 Lines and Paragraphs

9.2.3 Subscripts and superscripts: the SUB and SUP elements


<!ELEMENT (SUB|SUP) - - (%inline;)* -- subscript, superscript -->
<!ATTLIST (SUB|SUP)
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

Many scripts (e.g., French) require superscripts or subscripts for proper rendering. The SUB and SUP
elements should be used to markup text in these cases.
H<sub>2</sub>O
E = mc<sup>2</sup>
<SPAN lang="fr">M<sup>lle</sup> Dupont</SPAN>

9.3 Lines and Paragraphs


Authors traditionally divide their thoughts and arguments into sequences of paragraphs. The organization
of information into paragraphs is not affected by how the paragraphs are presented: paragraphs that are
double-justified contain the same thoughts as those that are left-justified.

The HTML markup for defining a paragraph is straightforward: the P element defines a paragraph.

The visual presentation of paragraphs is not so simple. A number of issues, both stylistic and technical,
must be addressed:

Treatment of white space


Line breaking and word wrapping
Justification
Hyphenation
Written language conventions and text directionality
Formatting of paragraphs with respect to surrounding content

We address these questions below. Paragraph alignment and floating objects [p.183] are discussed later in
this document.

86
9.3.1 Paragraphs: the P element

9.3.1 Paragraphs: the P element


<!ELEMENT P - O (%inline;)* -- paragraph -->
<!ATTLIST P
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: optional

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
align (alignment [p.183] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The P element represents a paragraph. It cannot contain block-level elements [p.66] (including P itself).

We discourage authors from using empty P elements. User agents should ignore empty P elements.

9.3.2 Controlling line breaks


A line break is defined to be a carriage return (&#x000D;), a line feed (&#x000A;), or a carriage
return/line feed pair. All line breaks constitute white space. [p.81]

For more information about SGML’s specification of line breaks, please consult the notes on line breaks
[p.311] in the appendix.

Forcing a line break: the BR element


<!ELEMENT BR - O EMPTY -- forced line break -->
<!ATTLIST BR
%coreattrs; -- id, class, style, title --
>

Start tag: required, End tag: forbidden

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


title (element title [p.57] )
style (inline style information [p.174] )
clear (alignment and floating objects [p.183] )

87
9.3.3 Hyphenation

The BR element forcibly breaks (ends) the current line of text.

For visual user agents, the clear attribute can be used to determine whether markup following the BR
element flows around images and other objects floated to the left or right margin, or whether it starts after
the bottom of such objects. Further details are given in the section on alignment and floating objects
[p.183] . Authors are advised to use style sheets to control text flow around floating images and other
objects.

With respect to bidirectional formatting, the BR element should behave the same way the [ISO10646]
[p.327] LINE SEPARATOR character behaves in the bidirectional algorithm.

Prohibiting a line break


Sometimes authors may want to prevent a line break from occurring between two words. The &nbsp;
entity (&#160; or &#xA0;) acts as a space where user agents should not cause a line break.

9.3.3 Hyphenation
In HTML, there are two types of hyphens: the plain hyphen and the soft hyphen. The plain hyphen should
be interpreted by a user agent as just another character. The soft hyphen tells the user agent where a line
break can occur.

Those browsers that interpret soft hyphens must observe the following semantics: If a line is broken at a
soft hyphen, a hyphen character must be displayed at the end of the first line. If a line is not broken at a
soft hyphen, the user agent must not display a hyphen character. For operations such as searching and
sorting, the soft hyphen should always be ignored.

In HTML, the plain hyphen is represented by the "-" character (&#45; or &#x2D;). The soft hyphen is
represented by the character entity reference &shy; (&#173; or &#xAD;)

9.3.4 Preformatted text: The PRE element


<!ENTITY % [Link] "IMG|OBJECT|BIG|SMALL|SUB|SUP">

<!ELEMENT PRE - - (%inline;)* -(%[Link];) -- preformatted text -->


<!ATTLIST PRE
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attribute definitions

width = number [p.44] [CN] [p.43]


Deprecated. [p.34] This attribute provides a hint to visual user agents about the desired width of the
formatted block. The user agent can use this information to select an appropriate font size or to indent
the content appropriately. The desired width is expressed in number of characters. This attribute is
not widely supported currently.

88
9.3.4 Preformatted text: The PRE element

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The PRE element tells visual user agents that the enclosed text is "preformatted". When handling
preformatted text, visual user agents:

May leave white space [p.81] intact.


May render text with a fixed-pitch font.
May disable automatic word wrap.
Must not disable bidirectional processing.

Non-visual user agents are not required to respect extra white space [p.81] in the content of a PRE
element.

For more information about SGML’s specification of line breaks, please consult the notes on line breaks
[p.311] in the appendix.

The DTD fragment above indicates which elements may not appear within a PRE declaration. This is the
same as in HTML 3.2, and is intended to preserve constant line spacing and column alignment for text
rendered in a fixed pitch font. Authors are discouraged from altering this behavior through style sheets.

The following example shows a preformatted verse from Shelly’s poem To a Skylark:
<PRE>
Higher still and higher
From the earth thou springest
Like a cloud of fire;
The blue deep thou wingest,
And singing still dost soar, and soaring ever singest.
</PRE>

Here is how this is typically rendered:


Higher still and higher
From the earth thou springest
Like a cloud of fire;
The blue deep thou wingest,
And singing still dost soar, and soaring ever singest.

The horizontal tab character


The horizontal tab character (decimal 9 in [ISO10646] [p.327] and [ISO88591] [p.327] ) is usually
interpreted by visual user agents as the smallest non-zero number of spaces necessary to line characters
up along tab stops that are every 8 characters. We strongly discourage using horizontal tabs in
preformatted text since it is common practice, when editing, to set the tab-spacing to other values, leading

89
9.3.5 Visual rendering of paragraphs

to misaligned documents.

9.3.5 Visual rendering of paragraphs


Note. The following section is an informative description of the behavior of some current visual user
agents when formatting paragraphs. Style sheets allow better control of paragraph formatting.

How paragraphs are rendered visually depends on the user agent. Paragraphs are usually rendered flush
left with a ragged right margin. Other defaults are appropriate for right-to-left scripts.

HTML user agents have traditionally rendered paragraphs with white space before and after, e.g.,
At the same time, there began to take form a system of numbering,
the calendar, hieroglyphic writing, and a technically advanced
art, all of which later influenced other peoples.

Within the framework of this gradual evolution or cultural


progress the Preclassic horizon has been divided into Lower,
Middle and Upper periods, to which can be added a transitional
or Protoclassic period with several features that would later
distinguish the emerging civilizations of Mesoamerica.

This contrasts with the style used in novels which indents the first line of the paragraph and uses the
regular line spacing between the final line of the current paragraph and the first line of the next, e.g.,
At the same time, there began to take form a system of
numbering, the calendar, hieroglyphic writing, and a technically
advanced art, all of which later influenced other peoples.
Within the framework of this gradual evolution or cultural
progress the Preclassic horizon has been divided into Lower,
Middle and Upper periods, to which can be added a transitional
or Protoclassic period with several features that would later
distinguish the emerging civilizations of Mesoamerica.

Following the precedent set by the NCSA Mosaic browser in 1993, user agents generally don’t justify
both margins, in part because it’s hard to do this effectively without sophisticated hyphenation routines.
The advent of style sheets, and anti-aliased fonts with subpixel positioning promises to offer richer
choices to HTML authors than previously possible.

Style sheets provide rich control over the size and style of a font, the margins, space before and after a
paragraph, the first line indent, justification and many other details. The user agent’s default style sheet
renders P elements in a familiar form, as illustrated above. One could, in principle, override this to render
paragraphs without the breaks that conventionally distinguish successive paragraphs. In general, since this
may confuse readers, we discourage this practice.

By convention, visual HTML user agents wrap text lines to fit within the available margins. Wrapping
algorithms depend on the script being formatted.

In Western scripts, for example, text should only be wrapped at white space. Early user agents incorrectly
wrapped lines just after the start tag or just before the end tag of an element, which resulted in dangling
punctuation. For example, consider this sentence:

90
9.4 Marking document changes: The INS and DEL elements

A statue of the <A href="cih78">Cihuateteus</A>, who are patron ...

Wrapping the line just before the end tag of the A element causes the comma to be stranded at the
beginning of the next line:
A statue of the Cihuateteus
, who are patron ...

This is an error since there was no white space at that point in the markup.

9.4 Marking document changes: The INS and DEL elements


<!-- INS/DEL are handled by inclusion on BODY -->
<!ELEMENT (INS|DEL) - - (%flow;)* -- inserted text, deleted text -->
<!ATTLIST (INS|DEL)
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- info on reason for change --
datetime %Datetime; #IMPLIED -- date and time of change --
>

Start tag: required, End tag: required

Attribute definitions

cite = uri [p.44] [CT] [p.43]


The value of this attribute is a URI that designates a source document or message. This attribute is
intended to point to information explaining why a document was changed.
datetime = datetime [p.47] [CS] [p.43]
The value of this attribute specifies the date and time when the change was made.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

INS and DEL are used to markup sections of the document that have been inserted or deleted with respect
to a different version of a document (e.g., in draft legislation where lawmakers need to view the changes).

These two elements are unusual for HTML in that they may serve as either block-level or inline elements
(but not both). They may contain one or more words within a paragraph or contain one or more
block-level elements such as paragraphs, lists and tables.

This example could be from a bill to change the legislation for how many deputies a County Sheriff can
employ from 3 to 5.

91
9.4 Marking document changes: The INS and DEL elements

<P>
A Sheriff can employ <DEL>3</DEL><INS>5</INS> deputies.
</P>

The INS and DEL elements must not contain block-level content when these elements behave as inline
elements.

ILLEGAL EXAMPLE:
The following is not legal HTML.
<P>
<INS><DIV>...block-level content...</DIV></INS>
</P>

User agents should render inserted and deleted text in ways that make the change obvious. For instance,
inserted text may appear in a special font, deleted text may not be shown at all or be shown as
struck-through or with special markings, etc.

Both of the following examples correspond to November 5, 1994, 8:15:30 am, US Eastern Standard Time.
1994-11-05T13:15:30Z
1994-11-05T08:15:30-05:00

Used with INS, this gives:


<INS datetime="1994-11-05T08:15:30-05:00"
cite="[Link]
Furthermore, the latest figures from the marketing department
suggest that such practice is on the rise.
</INS>

The document "[Link] would contain comments about why


information was inserted into the document.

Authors may also make comments about inserted or deleted text by means of the title attribute for the
INS and DEL elements. User agents may present this information to the user (e.g., as a popup note). For
example:
<INS datetime="1994-11-05T08:15:30-05:00"
title="Changed as a result of Steve B’s comments in meeting.">
Furthermore, the latest figures from the marketing department
suggest that such practice is on the rise.
</INS>

92
10 Lists

10 Lists
Contents

1. Introduction to lists . . . . . . . . . . . . . . . . . 93
.
2. Unordered lists (UL), ordered lists (OL), and list items (LI) . . . . . . . . 94
.
3. Definition lists: the DL, DT, and DD elements . . . . . . . . . . . 96
.
1. Visual rendering of lists . . . . . . . . . . . . . . . 97
.
4. The DIR and MENU elements . . . . . . . . . . . . . . . 99
.

10.1 Introduction to lists


HTML offers authors several mechanisms for specifying lists of information. All lists must contain one or
more list elements. Lists may contain:

Unordered information.
Ordered information.
Definitions.

The previous list, for example, is an unordered list, created with the UL element:
<UL>
<LI>Unordered information.
<LI>Ordered information.
<LI>Definitions.
</UL>

An ordered list, created using the OL element, should contain information where order should be
emphasized, as in a recipe:

1. Mix dry ingredients thoroughly.


2. Pour in wet ingredients.
3. Mix for 10 minutes.
4. Bake for one hour at 300 degrees.

Definition lists, created using the DL element, generally consist of a series of term/definition pairs
(although definition lists may have other applications). Thus, when advertising a product, one might use a
definition list:

Lower cost
The new version of this product costs significantly less than the previous one!
Easier to use
We’ve changed the product so that it’s much easier to use!
Safe for kids
You can leave your kids alone in a room with this product and they won’t get hurt (not a guarantee).

93
10.2 Unordered lists (UL), ordered lists (OL), and list items (LI)

defined in HTML as:


<DL>
<DT><STRONG>Lower cost</STRONG>
<DD>The new version of this product costs significantly less than the
previous one!
<DT><STRONG>Easier to use</STRONG>
<DD>We’ve changed the product so that it’s much easier to use!
<DT><STRONG>Safe for kids</STRONG>
<DD>You can leave your kids alone in a room with this product and
they won’t get hurt (not a guarantee).
</DL>

Lists may also be nested and different list types may be used together, as in the following example, which
is a definition list that contains an unordered list (the ingredients) and an ordered list (the procedure):

The ingredients:
100 g. flour
10 g. sugar
1 cup water
2 eggs
salt, pepper
The procedure:
1. Mix dry ingredients thoroughly.
2. Pour in wet ingredients.
3. Mix for 10 minutes.
4. Bake for one hour at 300 degrees.
Notes:
The recipe may be improved by adding raisins.

The exact presentation of the three list types depends on the user agent. We discourage authors from using
lists purely as a means of indenting text. This is a stylistic issue and is properly handled by style sheets.

10.2 Unordered lists (UL), ordered lists (OL), and list items (LI)
<!ELEMENT UL - - (LI)+ -- unordered list -->
<!ATTLIST UL
%attrs; -- %coreattrs, %i18n, %events --
>
<!ELEMENT OL - - (LI)+ -- ordered list -->
<!ATTLIST OL
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required


<!ELEMENT LI - O (%flow;)* -- list item -->
<!ATTLIST LI
%attrs; -- %coreattrs, %i18n, %events --
>

94
10.2 Unordered lists (UL), ordered lists (OL), and list items (LI)

Start tag: required, End tag: optional

Attribute definitions

type = style-information [CI] [p.43]


Deprecated. [p.34] This attribute sets the style of a list item. Currently available values are intended
for visual user agents. Possible values [p.97] are described below (along with case information).
start = number [p.44] [CN] [p.43]
Deprecated. [p.34] For OL only. This attribute specifies the starting number of the first item in an
ordered list. The default starting number is "1". Note that while the value of this attribute is an
integer, the corresponding label may be non-numeric. Thus, when the list item style is uppercase latin
letters (A, B, C, ...), start=3 means "C". When the style is lowercase roman numerals, start=3
means "iii", etc.
value = number [p.44] [CN] [p.43]
Deprecated. [p.34] For LI only. This attribute sets the number of the current list item. Note that
while the value of this attribute is an integer, the corresponding label may be non-numeric (see the
start attribute).
compact [CI] [p.43]
Deprecated. [p.34] When set, this boolean attribute gives a hint to visual user agents to render the
list in a more compact way. The interpretation of this attribute depends on the user agent.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

Ordered and unordered lists are rendered in an identical manner except that visual user agents number
ordered list items. User agents may present those numbers in a variety of ways. Unordered list items are
not numbered.

Both types of lists are made up of sequences of list items defined by the LI element (whose end tag may
be omitted).

This example illustrates the basic structure of a list.


<UL>
<LI> ... first list item...
<LI> ... second list item...
...
</UL>

Lists may also be nested:

95
10.3 Definition lists: the DL, DT, and DD elements

DEPRECATED EXAMPLE:
<UL>
<LI> ... Level one, number one...
<OL>
<LI> ... Level two, number one...
<LI> ... Level two, number two...
<OL start="10">
<LI> ... Level three, number one...
</OL>
<LI> ... Level two, number three...
</OL>
<LI> ... Level one, number two...
</UL>

Details about number order. In ordered lists, it is not possible to continue list numbering automatically
from a previous list or to hide numbering of some list items. However, authors can reset the number of a
list item by setting its value attribute. Numbering continues from the new value for subsequent list items.
For example:
<ol>
<li value="30"> makes this list item number 30.
<li value="40"> makes this list item number 40.
<li> makes this list item number 41.
</ol>

10.3 Definition lists: the DL, DT, and DD elements


<!-- definition lists - DT for term, DD for its definition -->

<!ELEMENT DL - - (DT|DD)+ -- definition list -->


<!ATTLIST DL
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required


<!ELEMENT DT - O (%inline;)* -- definition term -->
<!ELEMENT DD - O (%flow;)* -- definition description -->
<!ATTLIST (DT|DD)
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: optional

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,

96
10.3.1 Visual rendering of lists

onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

Definition lists vary only slightly from other types of lists in that list items consist of two parts: a term and
a description. The term is given by the DT element and is restricted to inline content. The description is
given with a DD element that contains block-level content.

Here is an example:

<DL>
<DT>Dweeb
<DD>young excitable person who may mature
into a <EM>Nerd</EM> or <EM>Geek</EM>

<DT>Cracker
<DD>hacker on the Internet

<DT>Nerd
<DD>male so into the Net that he forgets
his wife’s birthday
</DL>

Here is an example with multiple terms and descriptions:


<DL>
<DT>Center
<DT>Centre
<DD> A point equidistant from all points
on the surface of a sphere.
<DD> In some field sports, the player who
holds the middle position on the field, court,
or forward line.
</DL>

Another application of DL, for example, is for marking up dialogues, with each DT naming a speaker, and
each DD containing his or her words.

10.3.1 Visual rendering of lists


Note. The following is an informative description of the behavior of some current visual user agents when
formatting lists. Style sheets allow better control of list formatting (e.g., for numbering,
language-dependent conventions, indenting, etc.).

Visual user agents generally indent nested lists with respect to the current level of nesting.

For both OL and UL, the type attribute specifies rendering options for visual user agents.

For the UL element, possible values for the type attribute are disc, square, and circle. The default
value depends on the level of nesting of the current list. These values are case-insensitive.

97
10.3.1 Visual rendering of lists

How each value is presented depends on the user agent. User agents should attempt to present a "disc" as a
small filled-in circle, a "circle" as a small circle outline, and a "square" as a small square outline.

A graphical user agent might render this as:

for the value "disc"


for the value "circle"
for the value "square"

For the OL element, possible values for the type attribute are summarized in the table below (they are
case-sensitive):

Type Numbering style


1 arabic numbers 1, 2, 3, ...
a lower alpha a, b, c, ...
A upper alpha A, B, C, ...
i lower roman i, ii, iii, ...
I upper roman I, II, III, ...

Note that the type attribute is deprecated [p.34] and list styles should be handled through style sheets.

For example, using CSS, one may specify that the style of numbers for list elements in a numbered list
should be lowercase roman numerals. In the excerpt below, every OL element belonging to the class
"withroman" will have roman numerals in front of its list items.
<STYLE type="text/css">
[Link] { list-style-type: lower-roman }
</STYLE>
<BODY>
<OL class="withroman">
<LI> Step one ...
<LI> Step two ...
</OL>
</BODY>

The rendering of a definition list also depends on the user agent. The example:
<DL>
<DT>Dweeb
<DD>young excitable person who may mature
into a <EM>Nerd</EM> or <EM>Geek</EM>

<DT>Cracker
<DD>hacker on the Internet

98
10.4 The DIR and MENU elements

<DT>Nerd
<DD>male so into the Net that he forgets
his wife’s birthday
</DL>

might be rendered as follows:


Dweeb
young excitable person who may mature into a Nerd or Geek
Cracker
hacker on the Internet
Nerd
male so into the Net that he forgets his wife’s birthday

10.4 The DIR and MENU elements


DIR and MENU are deprecated [p.34] .

See the Transitional DTD [p.278] for the formal definition.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The DIR element was designed to be used for creating multicolumn directory lists. The MENU element
was designed to be used for single column menu lists. Both elements have the same structure as UL, just
different rendering. In practice, a user agent will render a DIR or MENU list exactly as a UL list.

We strongly recommend using UL instead of these elements.

99
10.4 The DIR and MENU elements

100
11 Tables

11 Tables
Contents

1. Introduction to tables . . . . . . . . . . . . . . . . . 101


.
2. Elements for constructing tables . . . . . . . . . . . . . . 103
.
1. The TABLE element . . . . . . . . . . . . . . . . 103
.
Table directionality . . . . . . . . . . . . . . . 105
.
2. Table Captions: The CAPTION element . . . . . . . . . . . 105
.
3. Row groups: the THEAD, TFOOT, and TBODY elements . . . . . . . . 106
.
4. Column groups: the COLGROUP and COL elements . . . . . . . . . 108
.
The COLGROUP element . . . . . . . . . . . . . . 108
.
The COL element . . . . . . . . . . . . . . . 110
.
Calculating the number of columns in a table . . . . . . . . . 111
.
Calculating the width of columns . . . . . . . . . . . . 112
.
5. Table rows: The TR element . . . . . . . . . . . . . . 114
.
6. Table cells: The TH and TD elements . . . . . . . . . . . . 114
.
Cells that span several rows or columns . . . . . . . . . . . 117
.
3. Table formatting by visual user agents . . . . . . . . . . . . . 119
.
1. Borders and rules . . . . . . . . . . . . . . . . 119
.
2. Horizontal and vertical alignment . . . . . . . . . . . . . 121
.
Inheritance of alignment specifications . . . . . . . . . . . 123
.
3. Cell margins . . . . . . . . . . . . . . . . . . 124
.
4. Table rendering by non-visual user agents . . . . . . . . . . . . 125
.
1. Associating header information with data cells . . . . . . . . . . 125
.
2. Categorizing cells . . . . . . . . . . . . . . . . 128
.
3. Algorithm to find heading information . . . . . . . . . . . . 131
.
5. Sample table . . . . . . . . . . . . . . . . . . . 132
.

11.1 Introduction to tables


The HTML table model allows authors to arrange data -- text, preformatted text, images, links, forms,
form fields, other tables, etc. -- into rows and columns of cells.

Each table may have an associated caption (see the CAPTION element) that provides a short description
of the table’s purpose. A longer description may also be provided (via the summary attribute) for the
benefit of people using speech or Braille-based user agents.

Table rows [p.106] may be grouped into a head, foot, and body sections, (via the THEAD, TFOOT and
TBODY elements, respectively). Row groups convey additional structural information and may be
rendered by user agents in ways that emphasize this structure. User agents may exploit the head/body/foot
division to support scrolling of body sections independently of the head and foot sections. When long
tables are printed, the head and foot information may be repeated on each page that contains table data.

101
11.1 Introduction to tables

Authors may also group columns [p.108] to provide additional structural information that may be
exploited by user agents. Furthermore, authors may declare column properties at the start of a table
definition (via the COLGROUP and COL elements) in a way that enables user agents to render the table
incrementally rather than having to wait for all the table data to arrive before rendering.

Table cells [p.114] may either contain "header" information (see the TH element) or "data" (see the TD
element). Cells may span multiple rows and columns. The HTML 4.0 table model allows authors to label
each cell so that non-visual user agents [p.125] may more easily communicate heading information about
the cell to the user. Not only do these mechanisms greatly assist users with visual disabilities, they make it
possible for multi-modal wireless browsers with limited display capabilities (e.g., Web-enabled pagers
and phones) to handle tables.

Tables should not be used purely as a means to layout document content as this may present problems
when rendering to non-visual media. Additionally, when used with graphics, these tables may force users
to scroll horizontally to view a table designed on a system with a larger display. To minimize these
problems, authors should use style sheets [p.171] to control layout rather than tables.

Note. This specification includes more detailed information about tables in sections on table design
rationale and implementation issues [p.317] .

Here’s a simple table that illustrates some of the features of the HTML table model. The following table
definition:
<TABLE border="1"
summary="This table gives some statistics about fruit
flies: average height and weight, and percentage
with red eyes (for both males and females).">
<CAPTION><EM>A test table with merged cells</EM></CAPTION>
<TR><TH rowspan="2"><TH colspan="2">Average
<TH rowspan="2">Red<BR>eyes
<TR><TH>height<TH>weight
<TR><TH>Males<TD>1.9<TD>0.003<TD>40%
<TR><TH>Females<TD>1.7<TD>0.002<TD>43%
</TABLE>

might be rendered something like this on a tty device:


A test table with merged cells
/-----------------------------------------\
| | Average | Red |
| |-------------------| eyes |
| | height | weight | |
|-----------------------------------------|
| Males | 1.9 | 0.003 | 40% |
|-----------------------------------------|
| Females | 1.7 | 0.002 | 43% |
\-----------------------------------------/

or like this by a graphical user agent:

102
11.2 Elements for constructing tables

11.2 Elements for constructing tables


11.2.1 The TABLE element
<!ELEMENT TABLE - -
(CAPTION?, (COL*|COLGROUP*), THEAD?, TFOOT?, TBODY+)>
<!ATTLIST TABLE -- table element --
%attrs; -- %coreattrs, %i18n, %events --
summary %Text; #IMPLIED -- purpose/structure for speech output--
width %Length; #IMPLIED -- table width --
border %Pixels; #IMPLIED -- controls frame width around table --
frame %TFrame; #IMPLIED -- which parts of frame to render --
rules %TRules; #IMPLIED -- rulings between rows and cols --
cellspacing %Length; #IMPLIED -- spacing between cells --
cellpadding %Length; #IMPLIED -- spacing within cells --
>

Start tag: required, End tag: required

Attribute definitions

summary = text [p.44] [CS] [p.43]


This attribute provides a summary of the table’s purpose and structure for user agents rendering to
non-visual media such as speech and Braille.
align = left|center|right [CI] [p.43]
Deprecated. [p.34] This attribute specifies the position of the table with respect to the document.
Permitted values:
left: The table is to the left of the document.
center: The table is to the center of the document.
right: The table is to the right of the document.
width = length [p.46] [CN] [p.43]
This attribute specifies the desired width of the entire table and is intended for visual user agents.
When the value is a percentage value, the value is relative to the user agent’s available horizontal
space. In the absence of any width specification, table width is determined by the user agent.

Attributes defined elsewhere

103
11.2.1 The TABLE element

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
bgcolor (background color [p.183] )
frame, rules, border (borders and rules [p.119] )
cellspacing, cellpadding (cell margins [p.124] )

The TABLE element contains all other elements that specify caption, rows, content, and formatting.

The following informative list describes what operations user agents may carry out when rendering a
table:

Make the table summary available to the user. Authors should provide a summary of a table’s
content and structure so that people using non-visual user agents may better understand it.
Render the caption, if one is defined.
Render the table header, if one is specified. Render the table footer, if one is specified. User agents
must know where to render the header and footer. For instance, if the output medium is paged, user
agents may put the header at the top of each page and the footer at the bottom. Similarly, if the user
agent provides a mechanism to scroll the rows, the header may appear at the top of the scrolled area
and the footer at the bottom.
Calculate the number of columns [p.111] in the table. Note that the number of rows in a table is equal
to the number of TR elements contained by the TABLE element.
Group the columns according to any column group [p.108] specifications.
Render the cells, row by row and grouped in appropriate columns, between the header and footer.
Visual user agents should format the table [p.119] according to HTML attributes and style sheet
specification.

The HTML table model has been designed so that, with author assistance, user agents may render tables
incrementally (i.e., as table rows arrive) rather than having to wait for all the data before beginning to
render.

In order for a user agent to format a table in one pass, authors must tell the user agent:

The number of columns in the table. Please consult the section on calculating the number of columns
in a table [p.111] for details on how to supply this information.
The widths of these columns. Please consult the section on calculating the width of columns [p.112]
for details on how to supply this information.

More precisely, a user agent may render a table in a single pass when the column widths are specified
using a combination of COLGROUP and COL elements. If any of the columns are specified in relative or
percentage terms (see the section on calculating the width of columns [p.112] ), authors must also specify
the width of the table itself.

104
11.2.2 Table Captions: The CAPTION element

Table directionality
The directionality of a table is either the inherited directionality (the default is left-to-right) or that
specified by the dir attribute for the TABLE element.

For a left-to-right table, column zero is on the left side and row zero is at the top. For a right-to-left table,
column zero is on the right side and row zero is at the top.

When a user agent allots extra cells to a row (see the section on calculating the number of columns in a
table [p.111] ), extra row cells are added to the right of the table for left-to-right tables and to the left side
for right-to-left tables.

Note that TABLE is the only element on which dir reverses the visual order of the columns; a single
table row (TR) or a group of columns (COLGROUP) cannot be independently reversed.

When set for the TABLE element, the dir attribute also affects the direction of text within table cells
(since the dir attribute is inherited by block-level elements).

To specify a right-to-left table, set the dir attribute as follows:


<TABLE dir="RTL">
...the rest of the table...
</TABLE>

The direction of text in individual cells can be changed by setting the dir attribute in an element that
defines the cell. Please consult the section on bidirectional text [p.73] for more information on text
direction issues.

11.2.2 Table Captions: The CAPTION element


<!ELEMENT CAPTION - - (%inline;)* -- table caption -->
<!ENTITY % CAlign "(top|bottom|left|right)">

<!ATTLIST CAPTION
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

Attribute definitions

align = top|bottom|left|right [CI] [p.43]


Deprecated. [p.34] For visual user agents, this attribute specifies the position of the caption with
respect to the table. Possible values:
top: The caption is at the top of the table. This is the default value.
bottom: The caption is at the bottom of the table.
left: The caption is at the left of the table.
right: The caption is at the right of the table.

105
11.2.3 Row groups: the THEAD, TFOOT, and TBODY elements

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

When present, the CAPTION element’s text should describe the nature of the table. The CAPTION
element is only permitted immediately after the TABLE start tag. A TABLE element may only contain one
CAPTION element.

Visual user agents allow sighted people to quickly grasp the structure of the table from the headings as
well as the caption. A consequence of this is that captions will often be inadequate as a summary of the
purpose and structure of the table from the perspective of people relying on non-visual user agents.

Authors should therefore take care to provide additional information summarizing the purpose and
structure of the table using the summary attribute of the TABLE element. This is especially important for
tables without captions. Examples below illustrate the use of the summary attribute.

Visual user agents should avoid clipping any part of the table including the caption, unless a means is
provided to access all parts, e.g., by horizontal or vertical scrolling. We recommend that the caption text
be wrapped to the same width as the table. (See also the section on recommended layout algorithms
[p.319] .)

11.2.3 Row groups: the THEAD, TFOOT, and TBODY elements


<!ELEMENT THEAD - O (TR)+ -- table header -->
<!ELEMENT TFOOT - O (TR)+ -- table footer -->

Start tag: required, End tag: optional


<!ELEMENT TBODY O O (TR)+ -- table body -->

Start tag: optional, End tag: optional


<!ATTLIST (THEAD|TBODY|TFOOT) -- table section --
%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )

106
11.2.3 Row groups: the THEAD, TFOOT, and TBODY elements

onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,


onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
align, char, charoff, valign (cell alignment [p.121] )

Table rows may be grouped into a table head, table foot, and one or more table body sections, using the
THEAD, TFOOT and TBODY elements, respectively. This division enables user agents to support scrolling
of table bodies independently of the table head and foot. When long tables are printed, the table head and
foot information may be repeated on each page that contains table data.

The table head and table foot should contain information about the table’s columns. The table body should
contain rows of table data.

When present, each THEAD, TFOOT, and TBODY contains a row group. Each row group must contain at
least one row, defined by the TR element.

This example illustrates the order and structure of table heads, feet, and bodies.
<TABLE>
<THEAD>
<TR> ...header information...
</THEAD>
<TFOOT>
<TR> ...footer information...
</TFOOT>
<TBODY>
<TR> ...first row of block one data...
<TR> ...second row of block one data...
</TBODY>
<TBODY>
<TR> ...first row of block two data...
<TR> ...second row of block two data...
<TR> ...third row of block two data...
</TBODY>
</TABLE>

TFOOT must appear before TBODY within a TABLE definition so that user agents can render the foot
before receiving all of the (potentially numerous) rows of data. The following summarizes which tags are
required and which may be omitted:

The TBODY start tag is always required except when the table contains only one table body and no
table head or foot sections. The TBODY end tag may always be safely omitted.
The start tags for THEAD and TFOOT are required when the table head and foot sections are present
respectively, but the corresponding end tags may always be safely omitted.

Conforming user agent parsers must obey these rules for reasons of backward compatibility.

The table of the previous example could be shortened by removing certain end tags, as in:
<TABLE>
<THEAD>
<TR> ...header information...
<TFOOT>

107
11.2.4 Column groups: the COLGROUP and COL elements

<TR> ...footer information...


<TBODY>
<TR> ...first row of block one data...
<TR> ...second row of block one data...
<TBODY>
<TR> ...first row of block two data...
<TR> ...second row of block two data...
<TR> ...third row of block two data...
</TABLE>

The THEAD, TFOOT, and TBODY sections must contain the same number of columns.

11.2.4 Column groups: the COLGROUP and COL elements


Column groups allow authors to create structural divisions within a table. Authors may highlight this
structure through style sheets or HTML attributes (e.g., the rules attribute for the TABLE element). For
an example of the visual presentation of column groups, please consult the sample table [p.132] .

A table may either contain a single implicit column group (no COLGROUP element delimits the columns)
or any number of explicit column groups (each delimited by an instance of the COLGROUP element).

The COL element allows authors to share attributes among several columns without implying any
structural grouping. The "span" of the COL element is the number of columns that will share the element’s
attributes.

The COLGROUP element


<!ELEMENT COLGROUP - O (col)* -- table column group -->
<!ATTLIST COLGROUP
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- default number of columns in group --
width %MultiLength; #IMPLIED -- default width for enclosed COLs --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

Start tag: required, End tag: optional

Attribute definitions

span = number [p.44] [CN] [p.43]


This attribute, which must be an integer > 0, specifies the number of columns in a column group.
Values mean the following:
In the absence of a span attribute, each COLGROUP defines a column group containing one
column.
If the span attribute is set to N > 0, the current COLGROUP element defines a column group
containing N columns.

108
11.2.4 Column groups: the COLGROUP and COL elements

User agents must ignore this attribute if the COLGROUP element contains one or more COL elements.

width = multi-length [p.46] [CN] [p.43]

This attribute specifies a default width for each column in the current column group. In addition to
the standard pixel, percentage, and relative values, this attribute allows the special form "0*" (zero
asterisk) which means that the width of the each column in the group should be the minimum width
necessary to hold the column’s contents. This implies that a column’s entire contents must be known
before its width may be correctly computed. Authors should be aware that specifying "0*" will
prevent visual user agents from rendering a table incrementally.

This attribute is overridden for any column in the column group whose width is specified via a COL
element.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
align, char, charoff, valign (cell alignment [p.121] )

The COLGROUP element creates an explicit column group. The number of columns in the column group
may be specified in two, mutually exclusive ways:

1. The element’s span attribute (default value 1) specifies the number of columns in the group.
2. Each COL element in the COLGROUP represents one or more columns in the group.

The advantage of using the span attribute is that authors may group together information about column
widths. Thus, if a table contains forty columns, all of which have a width of 20 pixels, it is easier to write:
<COLGROUP span="40" width="20">
</COLGROUP>

than:
<COLGROUP>
<COL width="20">
<COL width="20">
...a total of forty COL elements...
</COLGROUP>

When it is necessary to single out a column (e.g., for style information, to specify width information, etc.)
within a group, authors must identify that column with a COL element. Thus, to apply special style
information to the last column of the previous table, we single it out as follows:

109
11.2.4 Column groups: the COLGROUP and COL elements

<COLGROUP width="20">
<COL span="39">
<COL id="format-me-specially">
</COLGROUP>

The width attribute of the COLGROUP element is inherited by all 40 columns. The first COL element
refers to the first 39 columns (doing nothing special to them) and the second one assigns an id value to
the fortieth columns so that style sheets may refer to it.

The table in the following example contains two column groups. The first column group contains 10
columns and the second contains 5 columns. The default width for each column in the first column group
is 50 pixels. The width of each column in the second column group will be the minimum required for that
column.
<TABLE>
<COLGROUP span="10" width="50">
<COLGROUP span="5" width="0*">
<THEAD>
<TR><TD> ...
</TABLE>

The COL element


<!ELEMENT COL - O EMPTY -- table column -->
<!ATTLIST COL -- column groups and properties --
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- COL attributes affect N columns --
width %MultiLength; #IMPLIED -- column width specification --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

Start tag: required, End tag: forbidden

Attribute definitions

span = number [p.44] [CN] [p.43]


This attribute, whose value must be an integer > 0, specifies the number of columns "spanned" by the
COL element; the COL element shares its attributes with all the columns it spans. The default value
for this attribute is 1 (i.e., the COL element refers to a single column). If the span attribute is set to N
> 1, the current COL element shares its attributes with the next N-1 columns.
width = multi-length [p.46] [CN] [p.43]
This attribute specifies a default width for each column spanned by the current COL element. It has
the same meaning as the width attribute for the COLGROUP element and overrides it.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )

110
11.2.4 Column groups: the COLGROUP and COL elements

onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,


onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
align, char, charoff, valign (cell alignment [p.121] )

The COL element allows authors to group together attribute specifications for table columns. The COL
does not group columns together structurally -- that is the role of the COLGROUP element. COL elements
are empty and serve only as a support for attributes. They may appear inside or outside an explicit column
group (i.e., COLGROUP element).

The width attribute for COL refers to the width of each column in the element’s span.

Calculating the number of columns in a table


There are two ways to determine the number of columns in a table (in order of precedence):

1. If the TABLE element contains any COLGROUP or COL elements, user agents should calculate the
number of columns by summing the following:
For each COL element, take the value of its span attribute (default value 1).
For each COLGROUP element containing at least one COL element, ignore the span attribute
for the COLGROUP element. For each COL element, perform the calculation of step 1.
For each empty COLGROUP element, take the value of its span attribute (default value 1).
2. Otherwise, if the TABLE element contains no COLGROUP or COL elements, user agents should base
the number of columns on what is required by the rows. The number of columns is equal to the
number of columns required by the row with the most columns, including cells that span multiple
columns. For any row that has fewer than this number of columns, the end of that row should be
padded with empty cells. The "end" of a row depends on the table directionality [p.105] .

It is an error if a table contains COLGROUP or COL elements and the two calculations do not result in the
same number of columns.

Once the user agent has calculated the number of columns in the table, it may group them into column
groups. [p.108]

For example, for each of the following tables, the two column calculation methods should result in three
columns. The first three tables may be rendered incrementally.
<TABLE>
<COLGROUP span="3"></COLGROUP>
<TR><TD> ...
...rows...
</TABLE>

<TABLE>
<COLGROUP>
<COL>
<COL span="2">
</COLGROUP>
<TR><TD> ...
...rows...
</TABLE>

111
11.2.4 Column groups: the COLGROUP and COL elements

<TABLE>
<COLGROUP>
<COL>
</COLGROUP>
<COLGROUP span="2">
<TR><TD> ...
...rows...
</TABLE>

<TABLE>
<TR>
<TD><TD><TD>
</TR>
</TABLE>

Calculating the width of columns


Authors may specify column widths in three ways:

Fixed
A fixed width specification is given in pixels (e.g., width="30"). A fixed-width specification
enables incremental rendering.
Percentage
A percentage specification (e.g., width="20%") is based on the percentage of the horizontal space
available to the table (between the current left and right margins, including floats). Note that this
space does not depend on the table itself, and thus percentage specifications enable incremental
rendering.
Proportional
Proportional specifications (e.g., width="3*") refer to portions of the horizontal space required by a
table. If the table width is given a fixed value via the width attribute of the TABLE element, user
agents may render the table incrementally even with proportional columns.

However, if the table does not have a fixed width, user agents must receive all table data before they
can determine the horizontal space required by the table. Only then may this space be allotted to
proportional columns.

If an author specifies no width information for a column, a user agent may not be able to incrementally
format the table since it must wait for the entire column of data to arrive in order to allot an appropriate
width.

If column widths prove to be too narrow for the contents of a particular table cell, user agents may choose
to reflow the table.

The table in this example contains six columns. The first one does not belong to an explicit column group.
The next three belong to the first explicit column group and the last two belong to the second explicit
column group. This table cannot be formatted incrementally since it contains proportional column width
specifications and no value for the width attribute for the TABLE element.

112
11.2.4 Column groups: the COLGROUP and COL elements

Once the (visual) user agent has received the table’s data: the available horizontal space will be alloted by
the user agent as follows: First the user agent will allot 30 pixels to columns one and two. Then, the
minimal space required for the third column will be reserved. The remaining horizontal space will be
divided into six equal portions (since 2* + 1* + 3* = 6 portions). Column four (2*) will receive two of
these portions, column five (1*) will receive one, and column six (3*) will receive three.

<TABLE>
<COLGROUP>
<COL width="30">
<COLGROUP>
<COL width="30">
<COL width="0*">
<COL width="2*">
<COLGROUP align="center">
<COL width="1*">
<COL width="3*" align="char" char=":">
<THEAD>
<TR><TD> ...
...rows...
</TABLE>

We have set the value of the align attribute in the third column group to "center". All cells in every
column in this group will inherit this value, but may override it. In fact, the final COL does just that, by
specifying that every cell in the column it governs will be aligned along the ":" character.

In the following table, the column width specifications allow the user agent to format the table
incrementally:

<TABLE width="200">
<COLGROUP span="10" width="15">
<COLGROUP width="*">
<COL id="penultimate-column">
<COL id="last-column">
<THEAD>
<TR><TD> ...
...rows...
</TABLE>

The first ten columns will be 15 pixels wide each. The last two columns will each receive half of the
remaining 50 pixels. Note that the COL elements appear only so that an id value may be specified for the
last two columns.

Note. Although the width attribute on the TABLE element is not deprecated, authors are encouraged to
use style sheets to specify table widths.

113
11.2.5 Table rows: The TR element

11.2.5 Table rows: The TR element


<!ELEMENT TR - O (TH|TD)+ -- table row -->
<!ATTLIST TR -- table row --
%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

Start tag: required, End tag: optional

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
align, char, charoff, valign (cell alignment [p.121] )

The TR elements acts as a container for a row of table cells. The end tag may be omitted.

This sample table contains three rows, each begun by the TR element:
<TABLE summary="This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR> ...A header row...
<TR> ...First row of data...
<TR> ...Second row of data...
...the rest of the table...
</TABLE>

11.2.6 Table cells: The TH and TD elements


<!ELEMENT (TH|TD) - O (%flow;)* -- table header cell, table data cell-->

<!-- Scope is simpler than axes attribute for common tables -->
<!ENTITY % Scope "(row|col|rowgroup|colgroup)">

<!-- TH is for headers, TD for data, but for cells acting as both use TD -->
<!ATTLIST (TH|TD) -- header or data cell --
%attrs; -- %coreattrs, %i18n, %events --
abbr %Text; #IMPLIED -- abbreviation for header cell --
axis CDATA #IMPLIED -- names groups of related headers--
headers IDREFS #IMPLIED -- list of id’s for header cells --
scope %Scope; #IMPLIED -- scope covered by header cells --
rowspan NUMBER 1 -- number of rows spanned by cell --

114
11.2.6 Table cells: The TH and TD elements

colspan NUMBER 1 -- number of cols spanned by cell --


%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

Start tag: required, End tag: optional

Attribute definitions

headers = idrefs [p.44] [CS] [p.43]


This attribute specifies the list of header cells that provide header information for the current data
cell. The value of this attribute is a space-separated list of cell names; those cells must be named by
setting their id attribute. Authors generally use the headers attribute to help non-visual user
agents render header information about data cells (e.g., header information is spoken prior to the cell
data), but the attribute may also be used in conjunction with style sheets. See also the scope
attribute.
scope = scope-name [CI] [p.43]
This attribute specifies the set of data cells for which the current header cell provides header
information. This attribute may be used in place of the headers attribute, particularly for simple
tables. When specified, this attribute must have one of the following values:
row: The current cell provides header information for the rest of the row that contains it (see
also the section on table directionality [p.105] ).
col: The current cell provides header information for the rest of the column that contains it.
rowgroup: The header cell provides header information for the rest of the row group [p.106]
that contains it.
colgroup: The header cell provides header information for the rest of the column group [p.108]
that contains it.
abbr = text [p.44] [CS] [p.43]
This attribute should be used to provide an abbreviated form of the cell’s content, and may be
rendered by user agents when appropriate in place of the cell’s content. Abbreviated names should be
short since user agents may render them repeatedly. For instance, speech synthesizers may render the
abbreviated headers relating to a particular cell before rendering that cell’s content.
axis = cdata [p.44] [CI] [p.43]
This attribute may be used to place a cell into conceptual categories that can be considered to form
axes in an n-dimensional space. User agents may give users access to these categories (e.g., the user
may query the user agent for all cells that belong to certain categories, the user agent may present a
table in the form of a table of contents, etc.). Please consult the section on categorizing cells [p.128]
for more information. The value of this attribute is a comma-separated list of category names.
rowspan = number [p.44] [CN] [p.43]
This attribute specifies the number of rows spanned by the current cell. The default value of this
attribute is one ("1"). The value zero ("0") means that the cell spans all rows from the current row to
the last row of the table.
colspan = number [p.44] [CN] [p.43]
This attribute specifies the number of columns spanned by the current cell. The default value of this
attribute is one ("1"). The value zero ("0") means that the cell spans all columns from the current
column to the last column of the table.

115
11.2.6 Table cells: The TH and TD elements

nowrap [CI] [p.43]


Deprecated. [p.34] When present, this boolean attribute tells visual user agents to disable automatic
text wrapping for this cell. Style sheets [p.171] should be used instead of this attribute to achieve
wrapping effects. Note. if used carelessly, this attribute may result in excessively wide cells.
width = pixels [p.46] [CN] [p.43]
Deprecated. [p.34] This attribute supplies user agents with a recommended cell width.
height = pixels [p.46] [CN] [p.43]
Deprecated. [p.34] This attribute supplies user agents with a recommended cell height.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
bgcolor (background color [p.183] )
align, char, charoff, valign (cell alignment [p.121] )

Table cells may contain two types of information: header information and data. This distinction enables
user agents to render header and data cells distinctly, even in the absence of style sheets. For example,
visual user agents may present header cell text with a bold font. Speech synthesizers may render header
information with a distinct voice inflection.

The TH element defines a cell that contains header information. User agents have two pieces of header
information available: the contents of the TH element and the value of the abbr attribute. User agents
must render either the contents of the cell or the value of the abbr attribute. For visual media, the latter
may be appropriate when there is insufficient space to render the full contents of the cell. For non-visual
media abbr may be used as an abbreviation for table headers when these are rendered along with the
contents of the cells to which they apply.

The headers and scope attributes also allow authors to help non-visual user agents process header
information. Please consult the section on labeling cells for non-visual user agents [p.125] for information
and examples.

The TD element defines a cell that contains data.

Cells may be empty (i.e., contain no data).

For example, the following table contains four columns of data, each headed by a column description.
<TABLE summary="This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR>
<TH>Name</TH>

116
11.2.6 Table cells: The TH and TD elements

<TH>Cups</TH>
<TH>Type of Coffee</TH>
<TH>Sugar?</TH>
<TR>
<TD>T. Sexton</TD>
<TD>10</TD>
<TD>Espresso</TD>
<TD>No</TD>
<TR>
<TD>J. Dinnen</TD>
<TD>5</TD>
<TD>Decaf</TD>
<TD>Yes</TD>
</TABLE>

A user agent rendering to a tty device might display this as follows:


Name Cups Type of Coffee Sugar?
T. Sexton 10 Espresso No
J. Dinnen 5 Decaf Yes

Cells that span several rows or columns


Cells may span several rows or columns. The number of rows or columns spanned by a cell is set by the
rowspan and colspan attributes for the TH and TD elements.

In this table definition, we specify that the cell in row four, column two should span a total of three
columns, including the current column.
<TABLE border="1">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR><TH>Name<TH>Cups<TH>Type of Coffee<TH>Sugar?
<TR><TD>T. Sexton<TD>10<TD>Espresso<TD>No
<TR><TD>J. Dinnen<TD>5<TD>Decaf<TD>Yes
<TR><TD>A. Soria<TD colspan="3"><em>Not available</em>
</TABLE>

This table might be rendered on a tty device by a visual user agent as follows:
Cups of coffee consumed by each senator
--------------------------------------
| Name |Cups|Type of Coffee|Sugar?|
--------------------------------------
|T. Sexton|10 |Espresso |No |
--------------------------------------
|J. Dinnen|5 |Decaf |Yes |
--------------------------------------
|A. Soria |Not available |
--------------------------------------

The next example illustrates (with the help of table borders) how cell definitions that span more than one
row or column affect the definition of later cells. Consider the following table definition:

117
11.2.6 Table cells: The TH and TD elements

<TABLE border="1">
<TR><TD>1 <TD rowspan="2">2 <TD>3
<TR><TD>4 <TD>6
<TR><TD>7 <TD>8 <TD>9
</TABLE>

As cell "2" spans the first and second rows, the definition of the second row will take it into account.
Thus, the second TD in row two actually defines the row’s third cell. Visually, the table might be rendered
to a tty device as:
-------------
| 1 | 2 | 3 |
----| |----
| 4 | | 6 |
----|---|----
| 7 | 8 | 9 |
-------------

while a graphical user agent might render this as:

Note that if the TD defining cell "6" had been omitted, an extra empty cell would have been added by the
user agent to complete the row.

Similarly, in the following table definition:


<TABLE border="1">
<TR><TD>1 <TD>2 <TD>3
<TR><TD colspan="2">4 <TD>6
<TR><TD>7 <TD>8 <TD>9
</TABLE>

cell "4" spans two columns, so the second TD in the row actually defines the third cell ("6"):
-------------
| 1 | 2 | 3 |
--------|----
| 4 | 6 |
--------|----
| 7 | 8 | 9 |
-------------

A graphical user agent might render this as:

118
11.3 Table formatting by visual user agents

Defining overlapping cells is an error. User agents may vary in how they handle this error (e.g., rendering
may vary).

The following illegal example illustrates how one might create overlapping cells. In this table, cell "5"
spans two rows and cell "7" spans two columns, so there is overlap in the cell between "7" and "9":
<TABLE border="1">
<TR><TD>1 <TD>2 <TD>3
<TR><TD>4 <TD rowspan="2">5 <TD>6
<TR><TD colspan="2">7 <TD>9
</TABLE>

11.3 Table formatting by visual user agents


Note. The following sections describe the HTML table attributes that concern visual formatting. Although
style sheets will offer better control of visual table formatting, at the writing of this specification, [CSS1]
[p.327] did not offer mechanisms to control all aspects of visual table formatting.

HTML 4.0 includes mechanisms to control:

border styles [p.119]


horizontal and vertical alignment [p.121] of cell contents
and cell margins [p.124]

11.3.1 Borders and rules


The following attributes affect a table’s external frame and internal rules.

Attribute definitions

frame = void|above|below|hsides|lhs|rhs|vsides|box|border [CI] [p.43]


This attribute specifies which sides of the frame that surrounds a table will be visible. Possible
values:
void: No sides. This is the default value.
above: The top side only.
below: The bottom side only.
hsides: The top and bottom sides only.
vsides: The right and left sides only.
lhs: The left-hand side only.
rhs: The right-hand side only.

119
11.3.1 Borders and rules

box: All four sides.


border: All four sides.
rules = none|groups|rows|cols|all [CI] [p.43]
This attribute specifies which rules will appear between cells within a table. The rendering of rules is
user agent dependent. Possible values:
none: No rules. This is the default value.
groups: Rules will appear between row groups (see THEAD, TFOOT, and TBODY) and
column groups (see COLGROUP and COL) only.
rows: Rules will appear between rows only.
cols: Rules will appear between columns only.
all: Rules will appear between all rows and columns.
border = pixels [p.46] [CN] [p.43]
This attributes specifies the width (in pixels only) of the frame around a table (see the Note below for
more information about this attribute).

To help distinguish the cells of a table, we can set the border attribute of the TABLE element. Consider
a previous example:
<TABLE border="1"
summary="This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR>
<TH>Name</TH>
<TH>Cups</TH>
<TH>Type of Coffee</TH>
<TH>Sugar?</TH>
<TR>
<TD>T. Sexton</TD>
<TD>10</TD>
<TD>Espresso</TD>
<TD>No</TD>
<TR>
<TD>J. Dinnen</TD>
<TD>5</TD>
<TD>Decaf</TD>
<TD>Yes</TD>
</TABLE>

In the following example, the user agent should show borders five pixels thick on the left-hand and
right-hand sides of the table, with rules drawn between each column.
<TABLE border="5" frame="vsides" rules="cols">
<TR> <TD>1 <TD>2 <TD>3
<TR> <TD>4 <TD>5 <TD>6
<TR> <TD>7 <TD>8 <TD>9
</TABLE>

120
11.3.2 Horizontal and vertical alignment

The following settings should be observed by user agents for backwards compatibility.

Setting border="0" implies frame="void" and, unless otherwise specified, rules="none".


Other values of border imply frame="border" and, unless otherwise specified, rules="all".
The value "border" in the start tag of the TABLE element should be interpreted as the value of the
frame attribute. It implies rules="all" and some default (non-zero) value for the border
attribute.

For example, the following definitions are equivalent:


<TABLE border="2">
<TABLE border="2" frame="border" rules="all">

as are the following:


<TABLE border>
<TABLE frame="border" rules="all">

Note. The border attribute also defines the border behavior for the OBJECT and IMG elements, but
takes different values for those elements.

11.3.2 Horizontal and vertical alignment


The following attributes may be set for different table elements (see their definitions).
<!-- horizontal alignment attributes for cell contents -->
<!ENTITY % cellhalign
"align (left|center|right|justify|char) #IMPLIED
char %Character; #IMPLIED -- alignment char, e.g. char=’:’ --
charoff %Length; #IMPLIED -- offset for alignment char --"
>
<!-- vertical alignment attributes for cell contents -->
<!ENTITY % cellvalign
"valign (top|middle|bottom|baseline) #IMPLIED"
>

Attribute definitions

align = left|center|right|justify|char [CI] [p.43]


This attribute specifies the alignment of data and the justification of text in a cell. Possible values:
left: Left-flush data/Left-justify text. This is the default value for table data.
center: Center data/Center-justify text. This is the default value for table headers.
right: Right-flush data/Right-justify text.
justify: Double-justify text.
char: Align text around a specific character.
valign = top|middle|bottom|baseline [CI] [p.43]
This attribute specifies the vertical position of data within a cell. Possible values:
top: Cell data is flush with the top of the cell.
middle: Cell data is centered vertically within the cell. This is the default value.
bottom: Cell data is flush with the bottom of the cell.

121
11.3.2 Horizontal and vertical alignment

baseline: All cells in the same row as a cell whose valign attribute has this value should
have their textual data positioned so that the first text line occurs on a baseline common to all
cells in the row. This constraint does not apply to subsequent text lines in these cells.
char = character [p.47] [CN] [p.43]
This attribute specifies a single character within a text fragment to act as an axis for alignment. The
default value for this attribute is the decimal point character for the current language as set by the
lang attribute (e.g., the period (".") in English and the comma (",") in French). User agents are not
required to support this attribute.
charoff = length [p.46] [CN] [p.43]
When present, this attribute specifies the offset to the first occurrence of the alignment character on
each line. If a line doesn’t include the alignment character, it should be horizontally shifted to end at
the alignment position.

When charoff is used to set the offset of an alignment character, the direction of offset is
determined by the current text direction (set by the dir attribute). In left-to-right texts (the default),
offset is from the left margin. In right-to-left texts, offset is from the right margin. User agents are not
required to support this attribute.

The table in this example aligns a row of currency values along a decimal point. We set the alignment
character to "." explicitly.
<TABLE border="1">
<COLGROUP>
<COL><COL align="char" char=".">
<THEAD>
<TR><TH>Vegetable <TH>Cost per kilo
<TBODY>
<TR><TD>Lettuce <TD>$1
<TR><TD>Silver carrots <TD>$10.50
<TR><TD>Golden turnips <TD>$100.30
</TABLE>

The formatted table may resemble the following:


------------------------------
| Vegetable |Cost per kilo|
|--------------|-------------|
|Lettuce | $1 |
|--------------|-------------|
|Silver carrots| $10.50|
|--------------|-------------|
|Golden turnips| $100.30|
------------------------------

When the contents of a cell contain more than one instance of the alignment character specified by char
and the contents wrap, user agent behavior is undefined. Authors should therefore be attentive in their use
of char.

Note. Visual user agents typically render TH elements vertically and horizontally centered within the cell
and with a bold font weight.

122
11.3.2 Horizontal and vertical alignment

Inheritance of alignment specifications


The alignment of cell contents can be specified on a cell by cell basis, or inherited from enclosing
elements, such as the row, column or the table itself.

The order of precedence (from highest to lowest) for the attributes align, char, and charoff is the
following:

1. An alignment attribute set on an element within a cell’s data (e.g., P).


2. An alignment attribute set on a cell (TH and TD).
3. An alignment attribute set on a column grouping element (COL and COLGROUP). When a cell is part
of a multi-column span, the alignment property is inherited from the cell definition at the beginning
of the span.
4. An alignment attribute set on a row or row grouping element (TR, THEAD, TFOOT, and TBODY).
When a cell is part of a multi-row span, the alignment property is inherited from the cell definition at
the beginning of the span.
5. An alignment attribute set on the table (TABLE).
6. The default alignment value.

The order of precedence (from highest to lowest) for the attribute valign (as well as the other inherited
attributes lang, dir, and style) is the following:

1. An attribute set on an element within a cell’s data (e.g., P).


2. An attribute set on a cell (TH and TD).
3. An attribute set on a row or row grouping element (TR, THEAD, TFOOT, and TBODY). When a cell is
part of a multi-row span, the attribute value is inherited from the cell definition at the beginning of
the span.
4. An attribute set on a column grouping element (COL and COLGROUP). When a cell is part of a
multi-column span, the attribute value is inherited from the cell definition at the beginning of the
span.
5. An attribute set on the table (TABLE).
6. The default attribute value.

Furthermore, when rendering cells, horizontal alignment is determined by columns in preference to rows,
while for vertical alignment, rows are given preference over columns.

The default alignment for cells depends on the user agent. However, user agents should substitute the
default attribute for the current directionality (i.e., not just "left" in all cases).

User agents that do not support the "justify" value of the align attribute should use the value of the
inherited directionality in its place.

Note. Note that a cell may inherit an attribute not from its parent but from the first cell in a span. This is
an exception to the general attribute inheritance rules.

123
11.3.3 Cell margins

11.3.3 Cell margins


Attribute definitions

cellspacing = length [p.46] [CN] [p.43]


This attribute specifies how much space the user agent should leave between the left side of the table
and the left-hand side of the leftmost column, the top of the table and the top side of the topmost row,
and so on for the right and bottom of the table. The attribute also specifies the amount of space to
leave between cells.
cellpadding = length [p.46] [CN] [p.43]
This attribute specifies the amount of space between the border of the cell and its contents. If the
value of this attribute is a pixel length, all four margins should be this distance from the contents. If
the value of the attribute is a percentage length, the top and bottom margins should be equally
separated from the content based on a percentage of the available vertical space, and the left and right
margins should be equally separated from the content based on a percentage of the available
horizontal space.

These two attributes control spacing between and within cells. The following illustration explains how
they relate:

In the following example, the cellspacing attribute specifies that cells should be separated from each
other and from the table frame by twenty pixels. The cellpadding attribute specifies that the top
margin of the cell and the bottom margin of the cell will each be separated from the cell’s contents by
10% of the available vertical space (the total being 20%). Similarly, the left margin of the cell and the
right margin of the cell will each be separated from the cell’s contents by 10% of the available horizontal
space (the total being 20%).
<TABLE cellspacing="20" cellpadding="20%">
<TR> <TD>Data1 <TD>Data2 <TD>Data3
</TABLE>

124
11.4 Table rendering by non-visual user agents

If a table or given column has a fixed width, cellspacing and cellpadding may demand more
space than assigned. User agents may give these attributes precedence over the width attribute when a
conflict occurs, but are not required to.

11.4 Table rendering by non-visual user agents


11.4.1 Associating header information with data cells
Non-visual user agents such as speech synthesizers and Braille-based devices may use the following TD
and TH element attributes to render table cells more intuitively:

For a given data cell, the headers attribute lists which cells provide pertinent header information.
For this purpose, each header cell must be named using the id attribute. Note that its not always
possible to make a clean division of cells into headers or data. You should use the TD element for
such cells together with the id or scope attributes as appropriate.
For a given header cell, the scope attribute tells the user agent the data cells for which this header
provides information. Authors may choose to use this attribute instead of headers according to
which is more convenient; the two attributes fulfill the same function. The headers attribute is
generally needed when headers are placed in irregular positions with respect to the data they apply to.
The abbr attribute specifies an abbreviated header for header cells so that user agents may render
header information more rapidly.

In the following example, we assign header information to cells by setting the headers attribute. Each
cell in the same column refers to the same header cell (via the id attribute).
<TABLE border="1"
summary="This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR>
<TH id="t1">Name</TH>
<TH id="t2">Cups</TH>
<TH id="t3" abbr="Type">Type of Coffee</TH>
<TH id="t4">Sugar?</TH>
<TR>
<TD headers="t1">T. Sexton</TD>
<TD headers="t2">10</TD>
<TD headers="t3">Espresso</TD>
<TD headers="t4">No</TD>
<TR>
<TD headers="t1">J. Dinnen</TD>
<TD headers="t2">5</TD>
<TD headers="t3">Decaf</TD>
<TD headers="t4">Yes</TD>
</TABLE>

125
11.4.1 Associating header information with data cells

A speech synthesizer might render this table as follows:


Caption: Cups of coffee consumed by each senator
Summary: This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.
Name: T. Sexton, Cups: 10, Type: Espresso, Sugar: No
Name: J. Dinnen, Cups: 5, Type: Decaf, Sugar: Yes

Note how the header "Type of Coffee" is abbreviated to "Type" using the abbr attribute.

Here is the same example substituting the scope attribute for the headers attribute. Note the value
"col" for the scope attribute, meaning "all cells in the current column":
<TABLE border="1"
summary="This table charts the number of cups
of coffee consumed by each senator, the type
of coffee (decaf or regular), and whether
taken with sugar.">
<CAPTION>Cups of coffee consumed by each senator</CAPTION>
<TR>
<TH scope="col">Name</TH>
<TH scope="col">Cups</TH>
<TH scope="col" abbr="Type">Type of Coffee</TH>
<TH scope="col">Sugar?</TH>
<TR>
<TD>T. Sexton</TD>
<TD>10</TD>
<TD>Espresso</TD>
<TD>No</TD>
<TR>
<TD>J. Dinnen</TD>
<TD>5</TD>
<TD>Decaf</TD>
<TD>Yes</TD>
</TABLE>

Here’s a somewhat more complex example illustrating other values for the scope attribute:
<TABLE border="1" cellpadding="5" cellspacing="2"
summary="History courses offered in the community of
Bath arranged by course name, tutor, summary,
code, and fee">
<TR>
<TH colspan="5" scope="colgroup">Community Courses -- Bath Autumn 1997</TH>
</TR>
<TR>
<TH scope="col" abbr="Name">Course Name</TH>
<TH scope="col" abbr="Tutor">Course Tutor</TH>
<TH scope="col">Summary</TH>
<TH scope="col">Code</TH>
<TH scope="col">Fee</TH>
</TR>
<TR>
<TD scope="row">After the Civil War</TD>

126
11.4.1 Associating header information with data cells

<TD>Dr. John Wroughton</TD>


<TD>
The course will examine the turbulent years in England
after 1646. <EM>6 weekly meetings starting Monday 13th
October.</EM>
</TD>
<TD>H27</TD>
<TD>&pound;32</TD>
</TR>
<TR>
<TD scope="row">An Introduction to Anglo-Saxon England</TD>
<TD>Mark Cottle</TD>
<TD>
One day course introducing the early medieval
period reconstruction the Anglo-Saxons and
their society. <EM>Saturday 18th October.</EM>
</TD>
<TD>H28</TD>
<TD>&pound;18</TD>
</TR>
<TR>
<TD scope="row">The Glory that was Greece</TD>
<TD>Valerie Lorenz</TD>
<TD>
Birthplace of democracy, philosophy, heartland of theater, home of
argument. The Romans may have done it but the Greeks did it
first. <EM>Saturday day school 25th October 1997</EM>
</TD>
<TD>H30</TD>
<TD>&pound;18</TD>
</TR>
</TABLE>

A graphical user agent might render this as:

127
11.4.2 Categorizing cells

Note the use of the scope attribute with the "row" value. Although the first cell in each row contains
data, not header information, the scope attribute makes the data cell behave like a row header cell. This
allows speech synthesizers to provide the relevant course name upon request or to state it immediately
before each cell’s content.

11.4.2 Categorizing cells


Users browsing a table with a speech-based user agent may wish to hear an explanation of a cell’s
contents in addition to the contents themselves. One way the user might provide an explanation is by
speaking associated header information before speaking the data cell’s contents (see the section on
associating header information with data cells [p.125] ).

Users may also want information about more than one cell, in which case header information provided at
the cell level (by headers, scope, and abbr) may not provide adequate context. Consider the
following table, which classifies expenses for meals, hotels, and transport in two locations (San Jose and
Seattle) over several days:

Users might want to extract information from the table in the form of queries:

"What did I spend for all my meals?"


"What did I spend for meals on 25 August?"
"What did I spend for all expenses in San Jose?"

Each query involves a computation by the user agent that may involve zero or more cells. In order to
determine, for example, the costs of meals on 25 August, the user agent must know which table cells refer
to "Meals" (all of them) and which refer to "Dates" (specifically, 25 August), and find the intersection of
the two sets.

To accommodate this type of query, the HTML 4.0 table model allows authors to place cell headers and
data into categories. For example, for the travel expense table, an author could group the header cells "San
Jose" and "Seattle" into the category "Location", the headers "Meals", "Hotels", and "Transport" in the
category "Expenses", and the four days into the category "Date". The previous three questions would then
have the following meanings:

128
11.4.2 Categorizing cells

"What did I spend for all my meals?" means "What are all the data cells in the "Expenses=Meals"
category?
"What did I spend for meals on 25 August?" means "What are all the data cells in the
"Expenses=Meals" and "Date=Aug-25-1997" categories?
"What did I spend for all expenses in San Jose?" means "What are all the data cells in the
"Expenses=Meals, Hotels, Transport" and "Location=San Jose" categories?

Authors categorize a header or data cell by setting the axis attribute for the cell. For instance, in the
travel expense table, the cell containing the information "San Jose" could be placed in the "Location"
category as follows:
<TH id="a6" axis="location">San Jose</TH>

Any cell containing information related to "San Jose" should refer to this header cell via either the
headers or the scope attribute. Thus, meal expenses for 25-Aug-1997 should be marked up to refer to
id attribute (whose value here is "a6") of the "San Jose" header cell:

<TD headers="a6">37.74</TD>

Each headers attribute provides a list of id references. Authors may thus categorize a given cell in any
number of ways (or, along any number of "headers", hence the name).

Below we mark up the travel expense table with category information:


<TABLE border="1"
summary="This table summarizes travel expenses
incurred during August trips to
San Jose and Seattle">
<CAPTION>
Travel Expense Report
</CAPTION>
<TR>
<TH></TH>
<TH id="a2" axis="expenses">Meals</TH>
<TH id="a3" axis="expenses">Hotels</TH>
<TH id="a4" axis="expenses">Transport</TH>
<TD>subtotals</TD>
</TR>
<TR>
<TH id="a6" axis="location">San Jose</TH>
<TH></TH>
<TH></TH>
<TH></TH>
<TD></TD>
</TR>
<TR>
<TD id="a7" axis="date">25-Aug-97</TD>
<TD headers="a6 a7 a2">37.74</TD>
<TD headers="a6 a7 a3">112.00</TD>
<TD headers="a6 a7 a4">45.00</TD>
<TD></TD>
</TR>

129
11.4.2 Categorizing cells

<TR>
<TD id="a8" axis="date">26-Aug-97</TD>
<TD headers="a6 a8 a2">27.28</TD>
<TD headers="a6 a8 a3">112.00</TD>
<TD headers="a6 a8 a4">45.00</TD>
<TD></TD>
</TR>
<TR>
<TD>subtotals</TD>
<TD>65.02</TD>
<TD>224.00</TD>
<TD>90.00</TD>
<TD>379.02</TD>
</TR>
<TR>
<TH id="a10" axis="location">Seattle</TH>
<TH></TH>
<TH></TH>
<TH></TH>
<TD></TD>
</TR>
<TR>
<TD id="a11" axis="date">27-Aug-97</TD>
<TD headers="a10 a11 a2">96.25</TD>
<TD headers="a10 a11 a3">109.00</TD>
<TD headers="a10 a11 a4">36.00</TD>
<TD></TD>
</TR>
<TR>
<TD id="a12" axis="date">28-Aug-97</TD>
<TD headers="a10 a12 a2">35.00</TD>
<TD headers="a10 a12 a3">109.00</TD>
<TD headers="a10 a12 a4">36.00</TD>
<TD></TD>
</TR>
<TR>
<TD>subtotals</TD>
<TD>131.25</TD>
<TD>218.00</TD>
<TD>72.00</TD>
<TD>421.25</TD>
</TR>
<TR>
<TH>Totals</TH>
<TD>196.27</TD>
<TD>442.00</TD>
<TD>162.00</TD>
<TD>800.27</TD>
</TR>
</TABLE>

Note that marking up the table this way also allows user agents to avoid confusing the user with unwanted
information. For instance, if a speech synthesizer were to speak all of the figures in the "Meals" column of
this table in response to the query "What were all my meal expenses?", a user would not be able to
distinguish a day’s expenses from subtotals or totals. By carefully categorizing cell data, authors allow
user agents to make important semantic distinctions when rendering.

130
11.4.3 Algorithm to find heading information

Of course, there is no limit to how authors may categorize information in a table. In the travel expense
table, for example, we could add the additional categories "subtotals" and "totals".

This specification does not require user agents to handle information provided by the axis attribute, nor
does it make any recommendations about how user agents may present axis information to users or how
users may query the user agent about this information.

However, user agents, particularly speech synthesizers, may want to factor out information common to
several cells that are the result of a query. For instance, if the user asks "What did I spend for meals in San
Jose?", the user agent would first determine the cells in question (25-Aug-1997: 37.74,
26-Aug-1997:27.28), then render this information. A user agent speaking this information might read it:
Location: San Jose. Date: 25-Aug-1997. Expenses, Meals: 37.74
Location: San Jose. Date: 26-Aug-1997. Expenses, Meals: 27.28

or, more compactly:


San Jose, 25-Aug-1997, Meals: 37.74
San Jose, 26-Aug-1997, Meals: 27.28

An even more economical rendering would factor the common information and reorder it:
San Jose, Meals, 25-Aug-1997: 37.74
26-Aug-1997: 27.28

User agents that support this type of rendering should allow user agents a means to customize rendering
(e.g., through style sheets).

11.4.3 Algorithm to find heading information


In the absence of header information from either the scope or headers attribute, user agents may
construct header information according to the following algorithm. The goal of the algorithm is to find an
ordered list of headers. (In the following description of the algorithm the table directionality [p.105] is
assumed to be left-to-right.)

First, search left from the cell’s position to find row header cells. Then search upwards to find
column header cells. The search in a given direction stops when the edge of the table is reached or
when a data cell is found after a header cell.
Row headers are inserted into the list in the order they appear in the table. For left-to-right tables,
headers are inserted from left to right.
Column headers are inserted after row headers, in the order they appear in the table, from top to
bottom.
If a header cell has the headers attribute set, then the headers referenced by this attribute are
inserted into the list and the search stops for the current direction.
TD cells that set the axis attribute are also treated as header cells.

131
11.5 Sample table

11.5 Sample table


This sample illustrates grouped rows and columns. The example is adapted from "Developing
International Software", by Nadine Kano.

In "ascii art", the following table:


<TABLE border="2" frame="hsides" rules="groups"
summary="Code page support in different versions
of MS Windows.">
<CAPTION>CODE-PAGE SUPPORT IN MICROSOFT WINDOWS</CAPTION>
<COLGROUP align="center">
<COLGROUP align="left">
<COLGROUP align="center" span="2">
<COLGROUP align="center" span="3">
<THEAD valign="top">
<TR>
<TH>Code-Page<BR>ID
<TH>Name
<TH>ACP
<TH>OEMCP
<TH>Windows<BR>NT 3.1
<TH>Windows<BR>NT 3.51
<TH>Windows<BR>95
<TBODY>
<TR><TD>1200<TD>Unicode (BMP of ISO/IEC-10646)<TD><TD><TD>X<TD>X<TD>*
<TR><TD>1250<TD>Windows 3.1 Eastern European<TD>X<TD><TD>X<TD>X<TD>X
<TR><TD>1251<TD>Windows 3.1 Cyrillic<TD>X<TD><TD>X<TD>X<TD>X
<TR><TD>1252<TD>Windows 3.1 US (ANSI)<TD>X<TD><TD>X<TD>X<TD>X
<TR><TD>1253<TD>Windows 3.1 Greek<TD>X<TD><TD>X<TD>X<TD>X
<TR><TD>1254<TD>Windows 3.1 Turkish<TD>X<TD><TD>X<TD>X<TD>X
<TR><TD>1255<TD>Hebrew<TD>X<TD><TD><TD><TD>X
<TR><TD>1256<TD>Arabic<TD>X<TD><TD><TD><TD>X
<TR><TD>1257<TD>Baltic<TD>X<TD><TD><TD><TD>X
<TR><TD>1361<TD>Korean (Johab)<TD>X<TD><TD><TD>**<TD>X
<TBODY>
<TR><TD>437<TD>MS-DOS United States<TD><TD>X<TD>X<TD>X<TD>X
<TR><TD>708<TD>Arabic (ASMO 708)<TD><TD>X<TD><TD><TD>X
<TR><TD>709<TD>Arabic (ASMO 449+, BCON V4)<TD><TD>X<TD><TD><TD>X
<TR><TD>710<TD>Arabic (Transparent Arabic)<TD><TD>X<TD><TD><TD>X
<TR><TD>720<TD>Arabic (Transparent ASMO)<TD><TD>X<TD><TD><TD>X
</TABLE>

would be rendered something like this:


CODE-PAGE SUPPORT IN MICROSOFT WINDOWS
===============================================================================
Code-Page | Name | ACP OEMCP | Windows Windows Windows
ID | | | NT 3.1 NT 3.51 95
-------------------------------------------------------------------------------
1200 | Unicode (BMP of ISO 10646) | | X X *
1250 | Windows 3.1 Eastern European | X | X X X
1251 | Windows 3.1 Cyrillic | X | X X X
1252 | Windows 3.1 US (ANSI) | X | X X X
1253 | Windows 3.1 Greek | X | X X X

132
11.5 Sample table

1254 | Windows 3.1 Turkish | X | X X X


1255 | Hebrew | X | X
1256 | Arabic | X | X
1257 | Baltic | X | X
1361 | Korean (Johab) | X | ** X
-------------------------------------------------------------------------------
437 | MS-DOS United States | X | X X X
708 | Arabic (ASMO 708) | X | X
709 | Arabic (ASMO 449+, BCON V4) | X | X
710 | Arabic (Transparent Arabic) | X | X
720 | Arabic (Transparent ASMO) | X | X
===============================================================================

A graphical user agent might render this as:

This example illustrates how COLGROUP can be used to group columns and set the default column
alignment. Similarly, TBODY is used to group rows. The frame and rules attributes tell the user agent
which borders and rules to render.

133
11.5 Sample table

134
12 Links

12 Links
Contents

1. Introduction to links and anchors . . . . . . . . . . . . . . 135


.
1. Visiting a linked resource . . . . . . . . . . . . . . . 135
.
2. Other link relationships . . . . . . . . . . . . . . . 137
.
3. Specifying anchors and links . . . . . . . . . . . . . . 137
.
4. Link titles . . . . . . . . . . . . . . . . . . 138
.
5. Internationalization and links . . . . . . . . . . . . . . 138
.
2. The A element . . . . . . . . . . . . . . . . . . 138
.
1. Syntax of anchor names . . . . . . . . . . . . . . . 141
.
2. Nested links are illegal . . . . . . . . . . . . . . . 142
.
3. Anchors with the id attribute . . . . . . . . . . . . . . 142
.
4. Unavailable and unidentifiable resources . . . . . . . . . . . 143
.
3. Document relationships: the LINK element . . . . . . . . . . . . 143
.
1. Forward and reverse links . . . . . . . . . . . . . . . 144
.
2. Links and external style sheets . . . . . . . . . . . . . . 144
.
3. Links and search engines . . . . . . . . . . . . . . . 145
.
4. Path information: the BASE element . . . . . . . . . . . . . 146
.
1. Resolving relative URIs . . . . . . . . . . . . . . . 147
.

12.1 Introduction to links and anchors


HTML offers many of the conventional publishing idioms for rich text and structured documents, but
what separates it from most other markup languages is its features for hypertext and interactive
documents. This section introduces the link (or hyperlink, or Web link), the basic hypertext construct. A
link is a connection from one Web resource to another. Although a simple concept, the link has been one
of the primary forces driving the success of the Web.

A link has two ends -- called anchors -- and a direction. The link starts at the "source" anchor and points
to the "destination" anchor, which may be any Web resource (e.g., an image, a video clip, a sound bite, a
program, an HTML document, an element within an HTML document, etc.).

12.1.1 Visiting a linked resource


The default behavior associated with a link is the retrieval of another Web resource. This behavior is
commonly and implicitly obtained by selecting the link (e.g., by clicking, through keyboard input, etc.).

The following HTML excerpt contains two links, one whose destination anchor is an HTML document
named "[Link]" and the other whose destination anchor is a GIF image in the file "[Link]":

135
12.1.1 Visiting a linked resource

<BODY>
...some text...
<P>You’ll find a lot more in <A href="[Link]">chapter two</A>.
See also this <A href="../images/[Link]">map of the enchanted forest.</A>
</BODY>

By activating these links (by clicking with the mouse, through keyboard input, voice commands, etc.),
users may visit these resources. Note that the href attribute in each source anchor specifies the address of
the destination anchor with a URI.

The destination anchor of a link may be an element within an HTML document. The destination anchor
must be given an anchor name and any URI addressing this anchor must include the name as its fragment
identifier [p.18] .

Destination anchors in HTML documents may be specified either by the A element (naming it with the
name attribute), or by any other element (naming with the id attribute).

Thus, for example, an author might create a table of contents whose entries link to header elements H2,
H3, etc., in the same document. Using the A element to create destination anchors, we would write:
<H1>Table of Contents</H1>
<P><A href="#section1">Introduction</A><BR>
<A href="#section2">Some background</A><BR>
<A href="#section2.1">On a more personal note</A><BR>
...the rest of the table of contents...
...the document body...
<H2><A name="section1">Introduction</A></H2>
...section 1...
<H2><A name="section2">Some background</A></H2>
...section 2...
<H3><A name="section2.1">On a more personal note</A></H3>
...section 2.1...

We may achieve the same effect by making the header elements themselves the anchors:
<H1>Table of Contents</H1>
<P><A href="#section1">Introduction</A><BR>
<A href="#section2">Some background</A><BR>
<A href="#section2.1">On a more personal note</A><BR>
...the rest of the table of contents...
...the document body...
<H2 id="section1">Introduction</H2>
...section 1...
<H2 id="section2">Some background</H2>
...section 2...
<H3 id="section2.1">On a more personal note</H3>
...section 2.1...

136
12.1.2 Other link relationships

12.1.2 Other link relationships


By far the most common use of a link is to retrieve another Web resource, as illustrated in the previous
examples. However, authors may insert links in their documents that express other relationships between
resources than simply "activate this link to visit that related resource". Links that express other types of
relationships have one or more link types [p.48] specified in their source anchor.

The roles of a link defined by A or LINK are specified via the rel and rev attributes.

For instance, links defined by the LINK element may describe the position of a document within a series
of documents. In the following excerpt, links within the document entitled "Chapter 5" point to the
previous and next chapters:
<HEAD>
...other head information...
<TITLE>Chapter 5</TITLE>
<LINK rel="prev" href="[Link]">
<LINK rel="next" href="[Link]">
</HEAD>

The link type of the first link is "prev" and that of the second is "next" (two of several recognized link
types [p.48] ). Links specified by LINK are not rendered with the document’s contents, although user
agents may render them in other ways (e.g., as navigation tools).

Even if they are not used for navigation, these links may be interpreted in interesting ways. For example, a
user agent that prints a series of HTML documents as a single document may use this link information as
the basis of forming a coherent linear document. Further information is given below of using links for the
benefit of search engines [p.145]

12.1.3 Specifying anchors and links


Although several HTML elements and attributes create links to other resources (e.g., the IMG element, the
FORM element, etc.), this chapter discusses links and anchors created by the LINK and A elements. The
LINK element may only appear in the head of a document. The A element may only appear in the body.

When the A element’s href attribute is set, the element defines a source anchor for a link that may be
activated by the user to retrieve a Web resource. The source anchor is the location of the A instance and
the destination anchor is the Web resource.

The retrieved resource may be handled by the user agent in several ways: by opening a new HTML
document in the same user agent window, opening a new HTML document in a different window, starting
a new program to handle the resource, etc. Since the A element has content (text, images, etc.), user agents
may render this content in such a way as to indicate the presence of a link (e.g., by underlining the
content).

When the name or id attributes of the A element are set, the element defines an anchor that may be the
destination of other links.

137
12.2 The A element

Authors may set the name and href attributes simultaneously in the same A instance.

The LINK element defines a relationship between the current document and another resource. Although
LINK has no content, the relationships it defines may be rendered by some user agents.

12.1.4 Link titles


The title attribute may be set for both A and LINK to add information about the nature of a link. This
information may be spoken by a user agent, rendered as a tool tip, cause a change in cursor image, etc.

Thus, we may augment a previous example [p.135] by supplying a title for each link:
<BODY>
...some text...
<P>You’ll find a lot more in <A href="[Link]"
title="Go to chapter two">chapter two</A>.
<A href="./[Link]"
title="Get chapter two.">chapter two</A>.
See also this <A href="../images/[Link]"
title="GIF image of enchanted forest">map of
the enchanted forest.</A>
</BODY>

12.1.5 Internationalization and links


Since links may point to documents encoded with different character encodings [p.37] , the A and LINK
elements support the charset attribute. This attribute allows authors to advise user agents about the
encoding of data at the other end of the link.

The hreflang attribute provides user agents with information about the language of a resource at the
end of a link, just as the lang attribute provides information about the language of an element’s content
or attribute values.

Armed with this additional knowledge, user agents should be able to avoid presenting "garbage" to the
user. Instead, they may either locate resources necessary for the correct presentation of the document or, if
they cannot locate the resources, they should at least warn the user that the document will be unreadable
and explain the cause.

12.2 The A element


<!ELEMENT A - - (%inline;)* -(A) -- anchor -->
<!ATTLIST A
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #IMPLIED -- advisory content type --
name CDATA #IMPLIED -- named link end --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
accesskey %Character; #IMPLIED -- accessibility key character --

138
12.2 The A element

shape %Shape; rect -- for use with client-side image maps --


coords %Coords; #IMPLIED -- for use with client-side image maps --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

Start tag: required, End tag: required

Attribute definitions

name = cdata [p.44] [CS] [p.43]


This attribute names the current anchor so that it may be the destination of another link. The value of
this attribute must be a unique anchor name. The scope of this name is the current document. Note
that this attribute shares the same name space as the id attribute.
href = uri [p.44] [CT] [p.43]
This attribute specifies the location of a Web resource, thus defining a link between the current
element (the source anchor) and the destination anchor defined by this attribute.
hreflang = langcode [p.47] [CI] [p.43]
This attribute specifies the base language of the resource designated by href and may only be used
when href is specified.
type = content-type [p.46] [CI] [p.43]
When present, this attribute specifies the content type of a piece of content, for example, the result of
dereferencing a URI. Content types are defined in [MIMETYPES] [p.327] .
rel = link-types [p.48] [CI] [p.43]
This attribute describes the relationship from the current document to the anchor specified by the
href attribute. The value of this attribute is a space-separated list of link types.
rev = link-types [p.48] [CI] [p.43]
This attribute is used to describe a reverse link [p.144] from the anchor specified by the href
attribute to the current document. The value of this attribute is a space-separated list of link types.
charset = charset [p.47] [CI] [p.43]
This attribute specifies the character encoding of the resource designated by the link. Please consult
the section on character encodings [p.37] for more details.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
shape and coords (image maps [p.162] )
onfocus, onblur, onclick, ondblclick, onmousedown, onmouseup, onmouseover,
onmousemove, onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
target (target frame information [p.200] )
tabindex (tabbing navigation [p.228] )
accesskey (access keys [p.229] )

139
12.2 The A element

Each A element defines an anchor

1. The A element’s content defines the position of the anchor.


2. The name attribute names the anchor so that it may be the destination of zero or more links (see also
anchors with id [p.142] ).
3. The href attribute makes this anchor the source anchor of exactly one link.

Authors may also create an A element that specifies no anchors, i.e., that doesn’t specify href, name, or
id. Values for these attributes may be set at a later time through scripts. [p.237]

In the example that follows, the A element defines a link. The source anchor is the text "W3C Web site"
and the destination anchor is "[Link]
For more information about W3C, please consult the
<A href="[Link] Web site</A>.

This link designates the home page of the World Wide Web Consortium. When a user activates this link
in a user agent, the user agent will retrieve the resource, in this case, an HTML document.

User agents generally render links in such a way as to make them obvious to users (underlining, reverse
video, etc.). The exact rendering depends on the user agent. Rendering may vary according to whether the
user has already visited the link or not. A possible visual rendering of the previous link might be:
For more information about W3C, please consult the W3C Web site.
~~~~~~~~~~~~

To tell user agents explicitly what the character encoding of the destination page is, set the charset
attribute:
For more information about W3C, please consult the
<A href="[Link] charset="ISO-8859-1">W3C Web site</A>

Suppose we define an anchor named "anchor-one" in the file "[Link]".


...text before the anchor...
<A name="anchor-one">This is the location of anchor one.</A>
...text after the anchor...

This creates an anchor around the text "This is the location of anchor one.". Usually, the contents of A are
not rendered in any special way when A defines an anchor only.

Having defined the anchor, we may link to it from the same or another document. URIs that designate
anchors contain a "#" character followed by the anchor name (the fragment identifier [p.18] ). Here are
some examples of such URIs:

An absolute URI: [Link]


A relative URI: ./[Link]#anchor-one or [Link]#anchor-one
When the link is defined in the same document: #anchor-one

140
12.2.1 Syntax of anchor names

Thus, a link defined in the file "[Link]" in the same directory as "[Link]" would refer to the anchor as
follows:
...text before the link...
For more information, please consult <A href="./[Link]#anchor-one"> anchor one</A>.
...text after the link...

The A element in the following example specifies a link (with href) and creates a named anchor (with
name) simultaneously:
I just returned from vacation! Here’s a
<A name="anchor-two"
href="[Link]
photo of my family at the lake.</A>.

This example contains a link to a different type of Web resource (a PNG image). Activating the link
should cause the image resource to be retrieved from the Web (and possibly displayed if the system has
been configured to do so).

Note. User agents should be able to find anchors created by empty A elements, but some fail to do so. For
example, some user agents may not find the "empty-anchor" in the following HTML fragment:
<A name="empty-anchor"></A>
<EM>...some HTML...</EM>
<A href="#empty-anchor">Link to empty anchor</A>

12.2.1 Syntax of anchor names


An anchor name is the value of either the name or id attribute when used in the context of anchors.
Anchor names must observe the following rules:

Uniqueness: Anchor names must be unique within a document. Anchor names that differ only in
case may not appear in the same document.
String matching: Comparisons between fragment identifiers [p.18] and anchor names must be done
by exact (case-sensitive) match.

Thus, the following example is correct with respect to string matching and must be considered a match by
user agents:
<P><A href="#xxx">...</A>
...more document...
<P><A name="xxx">...</A>

ILLEGAL EXAMPLE:
The following example is illegal with respect to uniqueness since the two names are the same except for
case:
<P><A name="xxx">...</A>
<P><A name="XXX">...</A>

141
12.2.2 Nested links are illegal

Although the following excerpt is legal HTML, the behavior of the user agent is not defined; some user
agents may (incorrectly) consider this a match and others may not.
<P><A href="#xxx">...</A>
...more document...
<P><A name="XXX">...</A>

Anchor names should be restricted to ASCII characters. Please consult the appendix for more information
about non-ASCII characters in URI attribute values [p.310] .

12.2.2 Nested links are illegal


Links and anchors defined by the A element must not be nested; an A element must not contain any other
A elements.

Since the DTD defines LINK element to be empty, LINK elements may not be nested either.

12.2.3 Anchors with the id attribute


The id attribute may be used to create an anchor at the start tag of any element (including the A element).

This example illustrates the use of the id attribute to position an anchor in an H2 element. The anchor is
linked to via the A element.
You may read more about this in <A href="#section2">Section Two</A>.
...later in the document
<H2 id="section2">Section Two</H2>
...later in the document
<P>Please refer to <A href="#section2">Section Two</A> above
for more details.

The following example names a destination anchor with the id attribute:


I just returned from vacation! Here’s a
<A id="anchor-two">photo of my family at the lake.</A>.

The id and name attributes share the same name space. This means that they cannot both define an
anchor with the same name in the same document.

ILLEGAL EXAMPLE:
The following excerpt is illegal HTML since these attributes declare the same name twice in the same
document.
<A href="#a1">...</A>
...
<H1 id="a1">
...pages and pages...
<A name="a1"></A>

142
12.3 Document relationships: the LINK element

Because of its specification in the HTML DTD, the name attribute may contain character references
[p.40] . Thus, the value D&#xfc;rst is a valid name attribute value, as is D&uuml;rst . The id
attribute, on the other hand, may not contain character references.

Use id or name? Authors should consider the following issues when deciding whether to use id or
name for an anchor name:

The id attribute can act as more than just an anchor name (e.g., style sheet selector, processing
identifier, etc.).
Some older user agents don’t support anchors created with the id attribute.
The name attribute allows richer anchors names (with entities [p.40] ).

12.2.4 Unavailable and unidentifiable resources


A reference to an unavailable or unidentifiable resource is an error. Although user agents may vary in how
they handle such an error, we recommend the following behavior:

If a user agent cannot locate a linked resource, it should alert the user.
If a user agent cannot identify the type of a linked resource, it should still attempt to process it. It
should alert the user and may allow the user to intervene and identify the document type.

12.3 Document relationships: the LINK element


<!ELEMENT LINK - O EMPTY -- a media-independent link -->
<!ATTLIST LINK
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
type %ContentType; #IMPLIED -- advisory content type --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
media %MediaDesc; #IMPLIED -- for rendering on these media --
>

Start tag: required, End tag: forbidden

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
href, hreflang, type, rel, rev (links and anchors [p.135] )
target (target frame information [p.200] )
media (header style information [p.174] )

143
12.3.1 Forward and reverse links

charset(character encodings [p.37] )

This element defines a link. Unlike A, it may only appear in the HEAD section of a document, although it
may appear any number of times. Although LINK has no content, it conveys relationship information that
may be rendered by user agents in a variety of ways (e.g., a tool-bar with a drop-down menu of links).

This example illustrates how several LINK definitions may appear in the HEAD section of a document.
The current document is "[Link]". The rel attribute specifies the relationship of the linked
document with the current document. The values "Index", "Next", and "Prev" are explained in the section
on link types [p.48] .
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>Chapter 2</TITLE>
<LINK rel="Index" href="../[Link]">
<LINK rel="Next" href="[Link]">
<LINK rel="Prev" href="[Link]">
</HEAD>
...the rest of the document...

12.3.1 Forward and reverse links


The rel and rev attributes play complementary roles -- the rel attribute specifies a forward link and
the rev attribute specifies a reverse link.

Consider two documents A and B.


Document A: <LINK href="docB" rel="foo">

Has exactly the same meaning as:


Document B: <LINK href="docA" rev="foo">

Both attributes may be specified simultaneously.

12.3.2 Links and external style sheets


When the LINK element links an external style sheet to a document, the type attribute specifies the style
sheet language and the media attribute specifies the intended rendering medium or media. User agents
may save time by retrieving from the network only those style sheets that apply to the current device.

Media types [p.177] are further discussed in the section on style sheets.

144
12.3.3 Links and search engines

12.3.3 Links and search engines


Authors may use the LINK element to provide a variety of information to search engines, including:

Links to alternate versions of a document, written in another human language.


Links to alternate versions of a document, designed for different media, for instance a version
especially suited for printing.
Links to the starting page of a collection of documents.

The examples below illustrate how language information, media types, and link types may be combined to
improve document handling by search engines.

In the following example, we use the hreflang attribute to tell search engines where to find Dutch,
Portuguese, and Arabic versions of a document. Note the use of the dir and charset attributes for the
Arabic manual, and the use of the lang attribute to indicate that the value of the title attribute for the
LINK element designating the French manual is in French.
<HEAD>
<TITLE>The manual in English</TITLE>
<LINK title="The manual in Dutch"
type="text/html"
rel="alternate"
hreflang="nl"
href="[Link]
<LINK title="The manual in Portuguese"
type="text/html"
rel="alternate"
hreflang="pt"
href="[Link]
<LINK title="The manual in Arabic"
dir="rtl"
type="text/html"
rel="alternate"
charset="ISO-8859-6"
hreflang="ar"
href="[Link]
<LINK lang="fr" title="La documentation en Fran&ccedil;ais"
type="text/html"
rel="alternate"
hreflang="fr"
href="[Link]
</HEAD>

In the following example, we tell search engines where to find the printed version of a manual.
<HEAD>
<TITLE>Reference manual</TITLE>
<LINK media="print" title="The manual in postscript"
type="application/postscript"
rel="alternate"
href="[Link]
</HEAD>

145
12.4 Path information: the BASE element

In the following example, we tell search engines where to find the front page of a collection of documents.
<HEAD>
<TITLE>Reference manual -- Page 5</TITLE>
<LINK rel="Start" title="The first page of the manual"
type="text/html"
href="[Link]
</HEAD>

Further information is given in the notes in the appendix on helping search engines index your Web site
[p.315] .

12.4 Path information: the BASE element


<!ELEMENT BASE - O EMPTY -- document base URI -->
<!ATTLIST BASE
href %URI; #REQUIRED -- URI that acts as base URI --
>

Start tag: required, End tag: forbidden

Attribute definitions

href = uri [p.44] [CT] [p.43]


This attribute specifies an absolute URI that acts as the base URI for resolving relative URIs.

Attributes defined elsewhere

target (target frame information [p.200] )

In HTML, links and references to external images, applets, form-processing programs, style sheets, etc.
are always specified by a URI. Relative URIs are resolved [p.147] according to a base URI, which may
come from a variety of sources. The BASE element allows authors to specify a document’s base URI
explicitly.

When present, the BASE element must appear in the HEAD section of an HTML document, before any
element that refers to an external source. The path information specified by the BASE element only affects
URIs in the document where the element appears.

For example, given the following BASE declaration and A declaration:


<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>Our Products</TITLE>
<BASE href="[Link]
</HEAD>

146
12.4.1 Resolving relative URIs

<BODY>
<P>Have you seen our <A href="../cages/[Link]">Bird Cages</A>?
</BODY>
</HTML>

the relative URI "../cages/[Link]" would resolve to:


[Link]

12.4.1 Resolving relative URIs


User agents must calculate the base URI for resolving relative URIs according to [RFC1808] [p.328] ,
section 3. The following describes how [RFC1808] [p.328] applies specifically to HTML.

User agents must calculate the base URI according to the following precedences (highest priority to
lowest):

1. The base URI is set by the BASE element.


2. The base URI is given by meta data discovered during a protocol interaction, such as an HTTP
header (see [RFC2068] [p.328] ).
3. By default, the base URI is that of the current document. Not all HTML documents have a base URI
(e.g., a valid HTML document may appear in an email and may not be designated by a URI). Such
HTML documents are considered erroneous if they contain relative URIs and rely on a default base
URI.

Additionally, the OBJECT and APPLET elements define attributes that take precedence over the value set
by the BASE element. Please consult the definitions of these elements for more information about URI
issues specific to them.

Link elements specified by HTTP headers are handled exactly as LINK elements that appear explicitly in
a document.

147
12.4.1 Resolving relative URIs

148
13 Objects, Images, and Applets

13 Objects, Images, and Applets


Contents

1. Introduction to objects, images, and applets . . . . . . . . . . . . 149


.
2. Including an image: the IMG element . . . . . . . . . . . . . 150
.
3. Generic inclusion: the OBJECT element . . . . . . . . . . . . 152
.
1. Rules for rendering objects . . . . . . . . . . . . . . 154
.
2. Object initialization: the PARAM element . . . . . . . . . . . 156
.
3. Global naming schemes for objects . . . . . . . . . . . . 158
.
4. Object declarations and instantiations . . . . . . . . . . . . 158
.
4. Including an applet: the APPLET element . . . . . . . . . . . . 160
.
5. Notes on embedded documents . . . . . . . . . . . . . . 162
.
6. Image maps . . . . . . . . . . . . . . . . . . . 162
.
1. Client-side image maps: the MAP and AREA elements . . . . . . . . 163
.
Client-side image map examples . . . . . . . . . . . . 165
.
2. Server-side image maps . . . . . . . . . . . . . . . 167
.
7. Visual presentation of images, objects, and applets . . . . . . . . . . 168
.
1. Width and height . . . . . . . . . . . . . . . . 168
.
2. White space around images and objects . . . . . . . . . . . . 168
.
3. Borders . . . . . . . . . . . . . . . . . . . 168
.
4. Alignment . . . . . . . . . . . . . . . . . . 169
.
8. How to specify alternate text . . . . . . . . . . . . . . . 169
.

13.1 Introduction to objects, images, and applets


HTML’s multimedia features allow authors to include images, applets (programs that are automatically
downloaded and run on the user’s machine), video clips, and other HTML documents in their pages.

For example, to include a PNG image in a document, authors may write:


<BODY>
<P>Here’s a closeup of the Grand Canyon:
<OBJECT data="[Link]" type="image/png">
This is a <EM>closeup</EM> of the Grand Canyon.
</OBJECT>
</BODY>

Previous versions of HTML allowed authors to include images (via IMG) and applets (via APPLET).
These elements have several limitations:

They fail to solve the more general problem of how to include new and future media types.
The APPLET element only works with Java-based applets. This element is deprecated [p.34] in favor
of OBJECT.
They pose accessibility problems.

149
13.2 Including an image: the IMG element

To address these issues, HTML 4.0 introduces the OBJECT element, which offers an all-purpose solution
to generic object inclusion. The OBJECT element allows HTML authors to specify everything required by
an object for its presentation by a user agent: source code, initial values, and run-time data. In this
specification, the term "object" is used to describe the things that people want to place in HTML
documents; other commonly used terms for these things are: applets, plug-ins, media handlers, etc.

The new OBJECT element thus subsumes some of the tasks carried out by existing elements. Consider the
following chart of functionalities:

Type of inclusion Specific element Generic element


Image IMG OBJECT
Applet APPLET (Deprecated [p.34] .) OBJECT
Another HTML document IFRAME OBJECT

The chart indicates that each type of inclusion has a specific and a general solution. The generic OBJECT
element will serve as the solution for implementing future media types.

To include images, authors may use the OBJECT element or the IMG element.

To include applets, authors should use the OBJECT element as the APPLET element is deprecated [p.34] .

To include one HTML document in another, authors may use either the new IFRAME element or the
OBJECT element. In both cases, the embedded document remains independent of the main document.
Visual user agents may present the embedded document in a distinct window within the main document.
Please consult the notes on embedded documents [p.162] for a comparison of OBJECT and IFRAME for
document inclusion.

Images and other included objects may have hyperlinks associated with them, both through the standard
linking mechanisms [p.135] , but also via image maps [p.162] . An image map specifies active geometric
regions of an included object and assigns a link to each region. When activated, these links may cause a
document to be retrieved, may run a program on the server, etc.

In the following sections, we discuss the various mechanisms available to authors for multimedia
inclusions and creating image maps for those inclusions.

13.2 Including an image: the IMG element


<!-- To avoid problems with text-only UAs as well as
to make image content understandable and navigable
to users of non-visual UAs, you need to provide
a description with ALT, and avoid server-side image maps -->
<!ELEMENT IMG - O EMPTY -- Embedded image -->
<!ATTLIST IMG
%attrs; -- %coreattrs, %i18n, %events --
src %URI; #REQUIRED -- URI of image to embed --
alt %Text; #REQUIRED -- short description --
longdesc %URI; #IMPLIED -- link to long description

150
13.2 Including an image: the IMG element

(complements alt) --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
ismap (ismap) #IMPLIED -- use server-side image map --
>

Start tag: required, End tag: forbidden

Attribute definitions

src = uri [p.44] [CT] [p.43]


This attribute specifies the location of the image resource. Examples of widely recognized image
formats include GIF, JPEG, and PNG.
longdesc = uri [p.44] [CT] [p.43]
This attribute specifies a link to a long description of the image. This description should supplement
the short description provided using the alt attribute. When the image has an associated image map
[p.162] , this attribute should provide information about the image map’s contents. This is
particularly important for server-side image maps.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


alt (alternate text [p.169] )
lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
ismap, usemap (client side image maps [p.163] )
align, width, height, border, hspace, vspace (visual presentation of objects, images, and
applets [p.168] )

The IMG element embeds an image in the current document at the location of the element’s definition.
The IMG element has no content; it is usually replaced inline by the image designated by the src
attribute, the exception being for left or right-aligned images that are "floated" [p.185] out of line.

In an earlier example, we defined a link to a family photo. Here, we insert the photo directly into the
current document:
<BODY>
<P>I just returned from vacation! Here’s a photo of my family at the lake:
<IMG src="[Link]
alt="A photo of my family at the lake.">
</BODY>

This inclusion may also be achieved with the OBJECT element as follows:

151
13.3 Generic inclusion: the OBJECT element

<BODY>
<P>I just returned from vacation! Here’s a photo of my family at the lake:
<OBJECT data="[Link]
type="image/png">
A photo of my family at the lake.
</OBJECT>
</BODY>

The alt attribute specifies alternate text that is rendered when the image cannot be displayed (see below
for information on how to specify alternate text [p.169] ). User agents must render alternate text when
they cannot support images, they cannot support a certain image type or when they are configured not to
display images.

The following example shows how the longdesc attribute can be used to link to a richer description:
<BODY>
<P>
<IMG src="[Link]"
alt="HP Labs Site Map"
longdesc="[Link]">
</BODY>

The alt attribute provides a short description of the image. This should be sufficient to allow users to
decide whether they want to follow the link given by the longdesc attribute to the longer description,
here "[Link]".

Please consult the section on the visual presentation of objects, images, and applets [p.168] for
information about image size, alignment, and borders.

13.3 Generic inclusion: the OBJECT element


<!ELEMENT OBJECT - - (PARAM | %flow;)*
-- generic embedded object -->
<!ATTLIST OBJECT
%attrs; -- %coreattrs, %i18n, %events --
declare (declare) #IMPLIED -- declare but don’t instantiate flag --
classid %URI; #IMPLIED -- identifies an implementation --
codebase %URI; #IMPLIED -- base URI for classid, data, archive--
data %URI; #IMPLIED -- reference to object’s data --
type %ContentType; #IMPLIED -- content type for data --
codetype %ContentType; #IMPLIED -- content type for code --
archive %URI; #IMPLIED -- space separated archive list --
standby %Text; #IMPLIED -- message to show while loading --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
name CDATA #IMPLIED -- submit as part of form --
tabindex NUMBER #IMPLIED -- position in tabbing order --
>

Start tag: required, End tag: required

152
13.3 Generic inclusion: the OBJECT element

Attribute definitions

classid = uri [p.44] [CT] [p.43]


This attribute may be used to specify the location of an object’s implementation via a URI. It may be
used together with, or as an alternative to the data attribute, depending on the type of object
involved.
codebase = uri [p.44] [CT] [p.43]
This attribute specifies the base path used to resolve relative URIs specified by the classid, data,
and archive attributes. When absent, its default value is the base URI of the current document.
codetype = content-type [p.46] [CI] [p.43]
This attribute specifies the content type of data expected when downloading the object specified by
classid. This attribute is optional but recommended when classid is specified since it allows
the user agent to avoid loading information for unsupported content types. When absent, it defaults to
the value of the type attribute.
data = uri [p.44] [CT] [p.43]
This attribute may be used to specify the location of the object’s data, for instance image data for
objects defining images, or more generally, a serialized form of an object which can be used to
recreate it. If given as a relative URI, it should be interpreted relative to the codebase attribute.
type = content-type [p.46] [CI] [p.43]
This attribute specifies the content type for the data specified by data. This attribute is optional but
recommended when data is specified since it allows the user agent to avoid loading information for
unsupported content types.
archive = uri list [p.44] [CT] [p.43]
This attribute may be used to specify a space-separated list of URIs for archives containing resources
relevant to the object, which may include the resources specified by the classid and data
attributes. Preloading archives will generally result in reduced load times for objects. Archives
specified as relative URIs should be interpreted relative to the codebase attribute.
declare [CI] [p.43]
When present, this boolean attribute makes the current OBJECT definition a declaration only. The
object must be instantiated by a subsequent OBJECT definition referring to this declaration.
standby = text [p.44] [CS] [p.43]
This attribute specifies a message that a user agent may render while loading the object’s
implementation and data.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
tabindex (tabbing navigation [p.228] )
usemap (client side image maps [p.163] )
name (form submission [p.231] )
align, width, height, border, hspace, vspace (visual presentation of objects, images, and

153
13.3.1 Rules for rendering objects

applets [p.168] )

Most user agents have built-in mechanisms for rendering common data types such as text, GIF images,
colors, fonts, and a handful of graphic elements. To render data types they don’t support natively, user
agents generally run external applications. The OBJECT element allows authors to control whether data
should be rendered externally or by some program, specified by the author, that renders the data within the
user agent.

In the most general case, an author may need to specify three types of information:

The implementation of the included object. For instance, if the included object is a clock applet, the
author must indicate the location of the applet’s executable code.
The data to be rendered. For instance, if the included object is a program that renders font data, the
author must indicate the location of that data.
Additional values required by the object at run-time. For example, some applets may require initial
values for parameters.

The OBJECT element allows authors to specify all three types of data, but authors may not have to specify
all three at once. For example, some objects may not require data (e.g., a self-contained applet that
performs a small animation). Others may not require run-time initialization. Still others may not require
additional implementation information, i.e., the user agent itself may already know how to render that type
of data (e.g., GIF images).

Authors specify an object’s implementation and the location of the data to be rendered via the OBJECT
element. To specify run-time values, however, authors use the PARAM element, which is discussed in the
section on object initialization. [p.156]

The OBJECT element may also appear in the content of the HEAD element. Since user agents generally do
not render elements in the HEAD, authors should ensure that any OBJECT elements in the HEAD do not
specify content that may be rendered. Please consult the section on sharing frame data [p.196] for an
example of including the OBJECT element in the HEAD element.

Please consult the section on form controls [p.208] for information about OBJECT elements in forms.

13.3.1 Rules for rendering objects


A user agent must interpret an OBJECT element according to the following precedence rules:

1. The user agent must first try to render the object. It should not render the element’s contents, but it
must examine them in case the element contains any direct children that are PARAM elements (see
object initialization [p.156] ) or MAP elements (see client-side image maps [p.163] ).
2. If the user agent is not able to render the object for whatever reason (configured not to, lack of
resources, wrong architecture, etc.), it must try to render its contents.

Authors should not include content in OBJECT elements that appear in the HEAD element.

154
13.3.1 Rules for rendering objects

In the following example, we insert an analog clock applet in a document via the OBJECT element. The
applet, written in the Python language, requires no additional data or run-time values. The classid
attribute specifies the location of the applet:

<P><OBJECT classid="[Link]
</OBJECT>

Note that the clock will be rendered as soon as the user agent interprets this OBJECT declaration. It is
possible to delay rendering of an object by first declaring the object (described below).

Authors should complete this declaration by including alternate text as the contents of OBJECT in case the
user agent cannot render the clock.

<P><OBJECT classid="[Link]
An animated clock.
</OBJECT>

One significant consequence of the OBJECT element’s design is that it offers a mechanism for specifying
alternate object renderings; each embedded OBJECT declaration may specify alternate content types. If a
user agent cannot render the outermost OBJECT, it tries to render the contents, which may be another
OBJECT element, etc.

In the following example, we embed several OBJECT declarations to illustrate how alternate renderings
work. A user agent will attempt to render the first OBJECT element it can, in the following order: (1) an
Earth applet written in the Python language, (2) an MPEG animation of the Earth, (3) a GIF image of the
Earth, (4) alternate text.
<P> <!-- First, try the Python applet -->
<OBJECT title="The Earth as seen from space"
classid="[Link]
<!-- Else, try the MPEG video -->
<OBJECT data="[Link]" type="application/mpeg">
<!-- Else, try the GIF image -->
<OBJECT data="[Link]" type="image/gif">
<!-- Else render the text -->
The <STRONG>Earth</STRONG> as seen from space.
</OBJECT>
</OBJECT>
</OBJECT>

The outermost declaration specifies an applet that requires no data or initial values. The second
declaration specifies an MPEG animation and, since it does not define the location of an implementation
to handle MPEG, relies on the user agent to handle the animation. We also set the type attribute so that a
user agent that knows it cannot render MPEG will not bother to retrieve "[Link]" from the
network. The third declaration specifies the location of a GIF file and furnishes alternate text in case all
other mechanisms fail.

155
13.3.2 Object initialization: the PARAM element

Inline vs. external data. Data to be rendered may be supplied in two ways: inline and from an external
resource. While the former method will generally lead to faster rendering, it is not convenient when
rendering large quantities of data.

Here’s an example that illustrates how inline data may be fed to an OBJECT:
<P>
<OBJECT id="clock1"
classid="clsid:663C8FEF-1EF9-11CF-A3DB-080036F12502"
data="data:application/x-oleobject;base64, ...base64 data...">
A clock.
</OBJECT>

Please consult the section on the visual presentation of objects, images, and applets [p.168] for
information about object size, alignment, and borders.

13.3.2 Object initialization: the PARAM element


<!ELEMENT PARAM - O EMPTY -- named property value -->
<!ATTLIST PARAM
id ID #IMPLIED -- document-wide unique id --
name CDATA #REQUIRED -- property name --
value CDATA #IMPLIED -- property value --
valuetype (DATA|REF|OBJECT) DATA -- How to interpret value --
type %ContentType; #IMPLIED -- content type for value
when valuetype=ref --
>

Start tag: required, End tag: forbidden

Attribute definitions

name = cdata [p.44]


This attribute defines the name of a run-time parameter, assumed to be known by the inserted object.
Whether the property name is case-sensitive depends on the specific object implementation.
value = cdata [p.44]
This attribute specifies the value of a run-time parameter specified by name. Property values have no
meaning to HTML; their meaning is determined by the object in question.
valuetype = data|ref|object [CI] [p.43]
This attribute specifies the type of the value attribute. Possible values:
data: This is default value for the attribute. It means that the value specified by value will
be evaluated and passed to the object’s implementation as a string.
ref: The value specified by value is a URI that designates a resource where run-time values
are stored. This allows support tools to identify URIs given as parameters. The URI must be
passed to the object as is, i.e., unresolved.
object: The value specified by value is an identifier that refers to an OBJECT declaration
in the same document. The identifier must be the value of the id attribute set for the declared
OBJECT element.

156
13.3.2 Object initialization: the PARAM element

type = content-type [p.46] [CI] [p.43]


This attribute specifies the content type of the resource designated by the value attribute only in the
case where valuetype is set to "ref". This attribute thus specifies for the user agent, the type of
values that will be found at the URI designated by value.

Attributes defined elsewhere

id (document-wide identifiers [p.65] )

PARAM elements specify a set of values that may be required by an object at run-time. Any number of
PARAM elements may appear in the content of an OBJECT or APPLET element, in any order, but must be
placed at the start of the content of the enclosing OBJECT or APPLET element.

The syntax of names and values is assumed to be understood by the object’s implementation. This
document does not specify how user agents should retrieve name/value pairs nor how they should
interpret parameter names that appear twice.

We return to the clock example to illustrate the use of PARAM: suppose that the applet is able to handle
two run-time parameters that define its initial height and width. We can set the initial dimensions to 40x40
pixels with two PARAM elements.

<P><OBJECT classid="[Link]
<PARAM name="height" value="40" valuetype="data">
<PARAM name="width" value="40" valuetype="data">
This user agent cannot render Python applications.
</OBJECT>

In the following example, run-time data for the object’s "Init_values" parameter is specified as an external
resource (a GIF file). The value of the valuetype attribute is thus set to "ref" and the value is a URI
designating the resource.
<P><OBJECT classid="[Link]
standby="Loading Elvis...">
<PARAM name="Init_values"
value="./images/[Link]">
valuetype="ref">
</OBJECT>

Note that we have also set the standby attribute so that the user agent may display a message while the
rendering mechanism loads.

When an OBJECT element is rendered, user agents must search the content for only those PARAM
elements that are direct children and "feed" them to the OBJECT.

Thus, in the following example, if "obj1" is rendered, "param1" applies to "obj1" (and not "obj2"). If
"obj1" is not rendered and "obj2" is, "param1" is ignored, and "param2" applies to "obj2". If neither
OBJECT is rendered, neither PARAM applies.

157
13.3.3 Global naming schemes for objects

<P>
<OBJECT id="obj1">
<PARAM name="param1">
<OBJECT id="obj2">
<PARAM name="param2">
</OBJECT>
</OBJECT>

13.3.3 Global naming schemes for objects


The location of an object’s implementation is given by a URI. As we discussed in the introduction to URIs
[p.17] , the first segment of an absolute URI specifies the naming scheme used to transfer the data
designated by the URI. For HTML documents, this scheme is frequently "http". Some applets might
employ other naming schemes. For instance, when specifying a Java applet, authors may use URIs that
begin with "java" and for ActiveX applets, authors may use "clsid".

In the following example, we insert a Java applet into an HTML document.


<P><OBJECT classid="java:[Link]">
</OBJECT>

By setting the codetype attribute, a user agent can decide whether to retrieve the Java application based
on its ability to do so.
<OBJECT codetype="application/java-archive"
classid="java:[Link]">
</OBJECT>

Some rendering schemes require additional information to identify their implementation and must be told
where to find that information. Authors may give path information to the object’s implementation via the
codebase attribute.
<OBJECT codetype="application/java-archive"
classid="java:[Link]">
codebase="[Link]
</OBJECT>

The following example specifies (with the classid attribute) an ActiveX object via a URI that begins
with the naming scheme "clsid". The data attribute locates the data to render (another clock).
<P><OBJECT classid="clsid:663C8FEF-1EF9-11CF-A3DB-080036F12502"
data="[Link]
This application is not supported.
</OBJECT>

13.3.4 Object declarations and instantiations


The preceding examples have only illustrated isolated object definitions. When a document is to contain
more than one instance of the same object, it is possible to separate the declaration of the object from its
instantiations. Doing so has several advantages:

158
13.3.4 Object declarations and instantiations

Data may be retrieved from the network by the user agent one time (during the declaration) and
reused for each instantiation.
It is possible to instantiate an object from a location other than the object’s declaration, for example,
from a link.
It is possible to specify objects as run-time data for other objects.

To declare an object so that it is not executed when read by the user agent, set the boolean declare
attribute in the OBJECT element. At the same time, authors must identify the declaration by setting the id
attribute in the OBJECT element to a unique value. Later instantiations of the object will refer to this
identifier.

A declared OBJECT must appear in a document before the first instance of that OBJECT.

An object defined with the declare attribute is instantiated every time an element that refers to that
object requires it to be rendered (e.g., a link that refers to it is activated, an object that refers to it is
activated, etc.).

In the following example, we declare an OBJECT and cause it so be instantiated by referring to it from a
link. Thus, the object can be activated by clicking on some highlighted text, for example.
<P><OBJECT declare
id="[Link]"
data="[Link]"
type="application/mpeg">
The <STRONG>Earth</STRONG> as seen from space.
</OBJECT>
...later in the document...
<P>A neat <A href="#[Link]"> animation of The Earth!</A>

The following example illustrates how to specify run-time values that are other objects. In this example,
we send text (a poem, in fact) to a hypothetical mechanism for viewing poems. The object recognizes a
run-time parameter named "font" (say, for rendering the poem text in a certain font). The value for this
parameter is itself an object that inserts (but does not render) the font object. The relationship between the
font object and the poem viewer object is achieved by (1) assigning the id "tribune" to the font object
declaration and (2) referring to it from the PARAM element of the poem viewer object (with valuetype
and value).
<P><OBJECT declare
id="tribune"
type="application/x-webfont"
data="[Link]">
</OBJECT>
...view the poem in [Link] here...
<P><OBJECT classid="[Link]
data="[Link]">
<PARAM name="font" valuetype="object" value="#tribune">
<P>You’re missing a really cool poem viewer ...
</OBJECT>

159
13.4 Including an applet: the APPLET element

User agents that don’t support the declare attribute must render the contents of the OBJECT
declaration.

13.4 Including an applet: the APPLET element


APPLET is deprecated (with all its attributes) [p.34] in favor of OBJECT.

See the Transitional DTD [p.275] for the formal definition.

Attribute definitions

codebase = uri [p.44] [CT] [p.43]


This attribute specifies the base URI for the applet. If this attribute is not specified, then it defaults
the same base URI as for the current document. Values for this attribute may only refer to
subdirectories of the directory containing the current document.
code = cdata [p.44] [CS] [p.43]
This attribute specifies either the name of the class file that contains the applet’s compiled applet
subclass or the path to get the class, including the class file itself. It is interpreted with respect to the
applet’s codebase. One of code or object must be present.
name = cdata [p.44] [CS] [p.43]
This attribute specifies a name for the applet instance, which makes it possible for applets on the
same page to find (and communicate with) each other.
archive = uri-list [p.44] [CT] [p.43]
This attribute specifies a comma-separated list of URIs for archives containing classes and other
resources that will be "preloaded". The classes are loaded using an instance of an AppletClassLoader
with the given codebase. Relative URIs for archives are interpreted with respect to the applet’s
codebase. Preloading resources can significantly improve the performance of applets.
object = cdata [p.44] [CS] [p.43]
This attribute names a resource containing a serialized representation of an applet’s state. It is
interpreted relative to the applet’s codebase. The serialized data contains the applet’s class name but
not the implementation. The class name is used to retrieve the implementation from a class file or
archive.

When the applet is "deserialized" the start() method is invoked but not the init() method.
Attributes valid when the original object was serialized are not restored. Any attributes passed to this
APPLET instance will be available to the applet. Authors should use this feature with extreme
caution. An applet should be stopped before it is serialized.

Either code or object must be present. If both code and object are given, it is an error if they
provide different class names.

width = length [p.46] [CI] [p.43]


This attribute specifies the initial width of the applet’s display area (excluding any windows or
dialogs that the applet creates).
height = length [p.46] [CI] [p.43]
This attribute specifies the initial height of the applet’s display area (excluding any windows or
dialogs that the applet creates).

160
13.4 Including an applet: the APPLET element

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


title (element title [p.57] )
style (inline style information [p.174] )
alt (alternate text [p.169] )
align, hspace, vspace (visual presentation of objects, images, and applets [p.168] )

This element, supported by all Java-enabled browsers, allows designers to embed a Java applet in an
HTML document. It has been deprecated [p.34] in favor of the OBJECT element.

The content of the APPLET acts as alternate information for user agents that don’t support this element or
are currently configured not to support applets. User agents must ignore the content otherwise.

DEPRECATED EXAMPLE:
In the following example, the APPLET element includes a Java applet in the document. Since no
codebase is supplied, the applet is assumed to be in the same directory as the current document.
<APPLET code="[Link]" width="500" height="500">
Java applet that draws animated bubbles.
</APPLET>

This example may be rewritten as follows with OBJECT as follows:


<P><OBJECT codetype="application/java"
classid="java:[Link]"
width="500" height="500">
Java applet that draws animated bubbles.
</OBJECT>

Initial values may be supplied to the applet via the PARAM element.

DEPRECATED EXAMPLE:
The following sample Java applet:
<APPLET code="AudioItem" width="15" height="15">
<PARAM name="snd" value="[Link]|[Link]">
Java applet that plays a welcoming sound.
</APPLET>

may be rewritten as follows with OBJECT:


<OBJECT codetype="application/java"
classid="AudioItem"
width="15" height="15">
<PARAM name="snd" value="[Link]|[Link]">
Java applet that plays a welcoming sound.
</OBJECT>

161
13.5 Notes on embedded documents

13.5 Notes on embedded documents


Sometimes, rather than linking [p.135] to a document, an author may want to embed it directly into a
primary HTML document. Authors may use either the IFRAME element or the OBJECT element for this
purpose, but the elements differ in some ways. Not only do the two elements have different content
models, the IFRAME element may be a target frame (see the section on specifying target frame
information [p.200] for details) and may be "selected" by a user agent as the focus for printing, viewing
HTML source, etc. User agents may render selected frames elements in ways that distinguish them from
unselected frames (e.g., by drawing a border around the selected frame).

An embedded document is entirely independent of the document in which it is embedded. For instance,
relative URIs within the embedded document resolve [p.147] according to the base URI of the embedded
document, not that of the main document. An embedded document is only rendered within another
document (e.g., in a subwindow); it remains otherwise independent.

For instance, the following line embeds the contents of embed_me.html at the location where the
OBJECT definition occurs.
...text before...
<OBJECT data="embed_me.html">
Warning: embed_me.html could not be embedded.
</OBJECT>
...text after...

Recall that the contents of OBJECT must only be rendered if the file specified by the data attribute
cannot be loaded.

The behavior of a user agent in cases where a file includes itself is not defined.

13.6 Image maps


Image maps allow authors to specify regions of an image or object and assign a specific action to each
region (e.g., retrieve a document, run a program, etc.) When the region is activated by the user, the action
is executed.

An image map is created by associating an object with a specification of sensitive geometric areas on the
object.

There are two types of image maps:

Client-side. When a user activates a region of a client-side image map with a mouse, the pixel
coordinates are interpreted by the user agent. The user agent selects a link that was specified for the
activated region and follows it.
Server-side. When a user activates a region of a server-side image map with a mouse, the pixel
coordinates of the click are sent to the server-side agent specified by the href attribute of the A
element. The server-side agent interprets the coordinates and performs some action.

162
13.6.1 Client-side image maps: the MAP and AREA elements

Client-side image maps are preferred over server-side image maps for at least two reasons: they are
accessible to people browsing with non-graphical user agents and they offer immediate feedback as to
whether or not the pointer is over an active region.

13.6.1 Client-side image maps: the MAP and AREA elements


<!ELEMENT MAP - - ((%block;)+ | AREA+) -- client-side image map -->
<!ATTLIST MAP
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #REQUIRED -- for reference by usemap --
>

Start tag: required, End tag: required


<!ELEMENT AREA - O EMPTY -- client-side image map area -->
<!ATTLIST AREA
%attrs; -- %coreattrs, %i18n, %events --
shape %Shape; rect -- controls interpretation of coords --
coords %Coords; #IMPLIED -- comma separated list of lengths --
href %URI; #IMPLIED -- URI for linked resource --
nohref (nohref) #IMPLIED -- this region has no action --
alt %Text; #REQUIRED -- short description --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

Start tag: required, End tag: forbidden

MAP attribute definitions

name = cdata [p.44] [CI] [p.43]


This attribute assigns a name to the image map defined by a MAP element.

AREA attribute definitions

shape = default|rect|circle|poly [CI] [p.43]


This attribute specifies the shape of a region. Possible values:
default: Specifies the entire region.
rect: Define a rectangular region.
circle: Define a circular region.
poly: Define a polygonal region.
coords = coordinates [CN] [p.43]
This attribute specifies the position a shape on the screen. The number and order of values depends
on the shape being defined. Possible combinations:
rect: left-x, top-y, right-x, bottom-y.
circle: center-x, center-y, radius. Note. When the radius value is a percentage value, user
agents should calculate the final radius value based on the associated object’s width and height.
The radius should be the smaller value of the two.

163
13.6.1 Client-side image maps: the MAP and AREA elements

poly: x1, y1, x2, y2, ..., xN, yN.

Coordinates are relative to the top, left corner of the object. All values are lengths [p.46] . All values
are separated by commas.
nohref [CI] [p.43]
When set, this boolean attribute specifies that a region has no associated link.

Attribute to associate an image map with an element

usemap = uri [p.44] [CT] [p.43]


This attribute associates an image map with an element. The image map is defined by a MAP element.
The value of usemap must match the value of the name attribute of the associated MAP element.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
name (submitting objects with forms [p.231] )
alt (alternate text [p.169] )
href (anchor reference [p.138] ) target (frame target information [p.200] )
tabindex (tabbing navigation [p.228] )
accesskey (access keys [p.229] )
shape (image maps [p.162] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup, onfocus, onblur (intrinsic events
[p.240] )

The MAP element specifies a client-side image map that may be associated with one or more elements
(IMG, OBJECT, or INPUT). An image map is associated with an element via the element’s usemap
attribute.

The presence of the usemap attribute for an OBJECT implies that the object being included is an image.
Furthermore, when the OBJECT element has an associated client-side image map, user agents may
implement user interaction with the OBJECT solely in terms of the client-side image map. This allows
user agents (such as an audio browser or robot) to interact with the OBJECT without having to process it;
the user agent may even elect not to retrieve (or process) the object. When an OBJECT has an associated
image map, authors should not expect that the object will be retrieved or processed by every user agent.

Each MAP element may contain either one of the following:

1. One or more AREA elements. These elements have no content but specify the geometric regions of
the image map and the link associated with each region. Note that when this method is used, the MAP
has no rendered content. Therefore, authors must provide alternate text for each AREA with the alt
attribute (see below for information on how to specify alternate text [p.169] ).
2. Block-level content. This content should include A elements that specify the geometric regions of the

164
13.6.1 Client-side image maps: the MAP and AREA elements

image map and the link associated with each region. Note that when this method is used, the MAP
element content may be rendered by the user agent. Authors should use this method to create more
accessible documents.

If two or more defined regions overlap, the region-defining element that appears earliest in the document
takes precedence (i.e., responds to user input).

User agents and authors should offer textual alternates to graphical image maps for cases when graphics
are not available or the user cannot access them. For example, user agents may use alt text to create
textual links in place of a graphical image map. Such links may be activated in a variety of ways
(keyboard, voice activation, etc.).

Note. MAP is not backwards compatible with HTML 2.0 user agents.

Client-side image map examples


In the following example, we create a client-side image map for the OBJECT element. We do not want to
render the image map’s contents when the OBJECT is rendered, so we "hide" the MAP element within the
OBJECT element’s content. Consequently, the MAP element’s contents will only be rendered if the
OBJECT cannot be rendered.
<HTML>
<HEAD>
<TITLE>The cool site!</TITLE>
</HEAD>
<BODY>
<P><OBJECT data="[Link]" type="image/gif" usemap="#map1">
<MAP name="map1">
<P>Navigate the site:
<A href="[Link]" shape="rect" coords="0,0,118,28">Access Guide</a> |
<A href="[Link]" shape="rect" coords="118,0,184,28">Go</A> |
<A href="[Link]" shape="circle" coords="184,200,60">Search</A> |
<A href="[Link]" shape="poly" coords="276,0,373,28,50,50,100,120">Top Ten</A><
</MAP>
</OBJECT>
</BODY>
</HTML>

We may want to render the image map’s contents even when a user agent can render the OBJECT. For
instance, we may want to associate an image map with an OBJECT element and include a text navigation
bar at the bottom of the page. To do so, we define the MAP element outside the OBJECT:
<HTML>
<HEAD>
<TITLE>The cool site!</TITLE>
</HEAD>
<BODY>
<P><OBJECT data="[Link]" type="image/gif" usemap="#map1">
</OBJECT>

...the rest of the page here...

<MAP name="map1">

165
13.6.1 Client-side image maps: the MAP and AREA elements

<P>Navigate the site:


<A href="[Link]" shape="rect" coords="0,0,118,28">Access Guide</a> |
<A href="[Link]" shape="rect" coords="118,0,184,28">Go</A> |
<A href="[Link]" shape="circle" coords="184,200,60">Search</A> |
<A href="[Link]" shape="poly" coords="276,0,373,28,50,50,100,120">Top Ten</A>
</MAP>
</BODY>
</HTML>

In the following example, we create a similar image map, this time using the AREA element. Note the use
of alt text:
<P><OBJECT data="[Link]" type="image/gif" usemap="#map1">
<P>This is a navigation bar.
</OBJECT>

<MAP name="map1">
<AREA href="[Link]"
alt="Access Guide"
shape="rect"
coords="0,0,118,28">
<AREA href="[Link]"
alt="Search"
shape="rect"
coords="184,0,276,28">
<AREA href="[Link]"
alt="Go"
shape="circle"
coords="184,200,60">
<AREA href="[Link]"
alt="Top Ten"
shape="poly"
coords="276,0,373,28,50,50,100,120">
</MAP>

Here is a similar version using the IMG element instead of OBJECT (with the same MAP declaration):
<P><IMG src="[Link]" usemap="#map1" alt="navigation bar">

The following example illustrates how image maps may be shared.

Nested OBJECT elements are useful for providing fallbacks in case a user agent doesn’t support certain
formats. For example:
<P>
<OBJECT data="[Link]" type="image/png">
<OBJECT data="[Link]" type="image/gif">
text describing the image...
</OBJECT>
</OBJECT>

If the user agent doesn’t support the PNG format, it tries to render the GIF image. If it doesn’t support GIF
(e.g., it’s a speech-based user agent), it defaults to the text description provided as the content of the inner
OBJECT element. When OBJECT elements are nested this way, authors may share image maps among
them:

166
13.6.2 Server-side image maps

<P>
<OBJECT data="[Link]" type="image/png" usemap="#map1">
<OBJECT data="[Link]" type="image/gif" usemap="#map1">
<MAP name="map1">
<P>Navigate the site:
<A href="[Link]" shape="rect" coords="0,0,118,28">Access Guide</a> |
<A href="[Link]" shape="rect" coords="118,0,184,28">Go</A> |
<A href="[Link]" shape="circle" coords="184,200,60">Search</A> |
<A href="[Link]" shape="poly" coords="276,0,373,28,50,50,100,120">Top Ten</A>
</MAP>
</OBJECT>
</OBJECT>

The following example illustrates how anchors may be specified to create inactive zones within an image
map. The first anchor specifies a small circular region with no associated link. The second anchor
specifies a larger circular region with the same center coordinates. Combined, the two form a ring whose
center is inactive and whose rim is active. The order of the anchor definitions is important, since the
smaller circle must override the larger circle.
<MAP name="map1">
<P>
<A shape="circle" coords="100,200,50">I’m inactive.</A>
<A href="[Link]" shape="circle" coords="100,200,250">I’m active.</A>
</MAP>

Similarly, the nohref attribute for the AREA element declares that geometric region has no associated
link.

13.6.2 Server-side image maps


Server-side image maps may be interesting in cases where the image map is too complicated for a
client-side image map.

It is only possible to define a server-side image map for the IMG and INPUT elements. In the case of IMG,
the IMG must be inside an A element and the boolean attribute ismap ([CI] [p.43] ) must be set. In the
case of INPUT, the INPUT must be of type "image".

When the user activates the link by clicking on the image, the screen coordinates are sent directly to the
server where the document resides. Screen coordinates are expressed as screen pixel values relative to the
image. For normative information about the definition of a pixel and how to scale it, please consult
[CSS1] [p.327] .

In the following example, the active region defines a server-side link. Thus, a click anywhere on the image
will cause the click’s coordinates to be sent to the server.
<P><A href="[Link]
<IMG src="[Link]" ismap alt="target"></A>

The location clicked is passed to the server as follows. The user agent derives a new URI from the URI
specified by the href attribute of the A element, by appending ‘?’ followed by the x and y coordinates,
separated by a comma. The link is then followed using the new URI. For instance, in the given example, if

167
13.7 Visual presentation of images, objects, and applets

the user clicks at the location x=10, y=27 then the derived URI is
"[Link]

User agents that do not offer the user a means to select specific coordinates (e.g., non-graphical user
agents that rely on keyboard input, speech-based user agents, etc.) should send the coordinates "0,0" to the
server when the link is activated.

13.7 Visual presentation of images, objects, and applets


All IMG and OBJECT attributes that concern visual alignment and presentation have been deprecated
[p.34] in favor of style sheets.

13.7.1 Width and height


Attribute definitions

width = length [p.46] [CN] [p.43]


Image and object width override.
height = length [p.46] [CN] [p.43]
Image and object override.

When specified, the width and height attributes tell user agents to override the natural image or object
size in favor of these values.

When the object is an image, it is scaled. User agents should do their best to scale an object or image to
match the width and height specified by the author. Note that lengths expressed as percentages are based
on the horizontal or vertical space currently available, not on the natural size of the image, object, or
applet.

The height and width attributes give user agents an idea of the size of an image or object so that they
may reserve space for it and continue rendering the document while waiting for the image data.

13.7.2 White space around images and objects


The vspace and hspace attributes specify the amount of white space to be inserted to the left and right
(hspace) and above and below (vspace) an IMG, APPLET, OBJECT. The default value for these attributes
is not specified, but is generally a small, non-zero length. Both attributes take values of type length [p.46]
.

13.7.3 Borders
An image or object may be surrounded by a border (e.g., when a border is specified by the user or when
the image is the content of an A element).

Attribute definitions

168
13.8 How to specify alternate text

border = pixels [p.46]


Deprecated. [p.34] The border attribute specifies the width of this border in pixels. The default
value for this attribute depends on the user agent.

13.7.4 Alignment
The align attribute specifies the position of an IMG, OBJECT, or APPLET with respect to its context.

The following values for align concern the object’s position with respect to surrounding text:

bottom: means that the bottom of the object should be vertically aligned with the current baseline.
This is the default value.
middle: means that the center of the object should be vertically aligned with the current baseline.
top: means that the top of the object should be vertically aligned with the top of the current text
line.

Two other values, left and right, cause the image to float to the current left or right margin. They are
discussed in the section on floating objects [p.185] .

Differing interpretations of align. User agents vary in their interpretation of the align attribute. Some
only take into account what has occurred on the text line prior to the element, some take into account the
text on both sides of the element.

13.8 How to specify alternate text


Attribute definitions

alt = text [p.44] [CS] [p.43]


For user agents that cannot display images, forms, or applets, this attribute specifies alternate text.
The language of the alternate text is specified by the lang attribute.

Several non-textual elements (IMG, AREA, APPLET, and INPUT) let authors specify alternate text to
serve as content when the element cannot be rendered normally. Specifying alternate text assists users
without graphic display terminals, users whose browsers don’t support forms, visually impaired users,
those who use speech synthesizers, those who have configured their graphical user agents not to display
images, etc.

The alt attribute must be specified for the IMG and AREA elements. It is optional for the INPUT and
APPLET elements.

While alternate text may be very helpful, it must be handled with care. Authors should observe the
following guidelines:

Do not specify irrelevant alternate text when including images intended to format a page, for
instance, alt="red ball" would be inappropriate for an image that adds a red ball for decorating
a heading or paragraph. In such cases, the alternate text should be the empty string (""). Authors are
in any case advised to avoid using images to format pages; style sheets should be used instead.

169
13.8 How to specify alternate text

Do not specify meaningless alternate text (e.g., "dummy text"). Not only will this frustrate users, it
will slow down user agents that must convert text to speech or braille output.

Implementors should consult the section on generating alternate text [p.325] for information about how to
handle cases of omitted alternate text.

Note. For more information about designing accessible HTML documents, please consult [WAIGUIDE]
[p.331] .

170
14 Style Sheets

14 Style Sheets
Contents

1. Introduction to style sheets . . . . . . . . . . . . . . . 171


.
2. Adding style to HTML . . . . . . . . . . . . . . . . 173
.
1. Setting the default style sheet language . . . . . . . . . . . . 173
.
2. Inline style information . . . . . . . . . . . . . . . 174
.
3. Header style information: the STYLE element . . . . . . . . . . 174
.
4. Media types . . . . . . . . . . . . . . . . . . 177
.
3. External style sheets . . . . . . . . . . . . . . . . . 177
.
1. Preferred and alternate style sheets . . . . . . . . . . . . . 178
.
2. Specifying external style sheets . . . . . . . . . . . . . 178
.
4. Cascading style sheets . . . . . . . . . . . . . . . . 179
.
1. Media-dependent cascades . . . . . . . . . . . . . . 180
.
2. Inheritance and cascading . . . . . . . . . . . . . . . 180
.
5. Hiding style data from user agents . . . . . . . . . . . . . . 181
.
6. Linking to style sheets with HTTP headers . . . . . . . . . . . . 181
.

14.1 Introduction to style sheets


Style sheets represent a major breakthrough for Web page designers, expanding their ability to improve
the appearance of their pages. In the scientific environments in which the Web was conceived, people are
more concerned with the content of their documents than the presentation. As people from wider walks of
life discovered the Web, the limitations of HTML became a source of continuing frustration and authors
were forced to sidestep HTML’s stylistic limitations. While the intentions have been good -- to improve
the presentation of Web pages -- the techniques for doing so have had unfortunate side effects. These
techniques work for some of the people, some of the time, but not for all of the people, all of the time.
They include:

Using proprietary HTML extensions


Converting text into images
Using images for white space control
Use of tables for page layout
Writing a program instead of using HTML

These techniques considerably increase the complexity of Web pages, offer limited flexibility, suffer from
interoperability problems, and create hardships for people with disabilities.

Style sheets solve these problems at the same time they supersede the limited range of presentation
mechanisms in HTML. Style sheets make it easy to specify the amount of white space between text lines,
the amount lines are indented, the colors used for the text and the backgrounds, the font size and style, and
a host of other details.

171
14.1 Introduction to style sheets

For example, the following short CSS style sheet (stored in the file "[Link]"), sets the text color of a
paragraph to green and surrounds it with a solid red border:
[Link] {
color : green;
border: solid red;
}

Authors may link this style sheet to their source HTML document with the LINK element:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<LINK href="[Link]" rel="stylesheet" type="text/css">
</HEAD>
<BODY>
<P class="special">This paragraph should have special green text.
</BODY>
</HTML>

HTML 4.0 provides support for the following style sheet features:

Flexible placement of style information


Placing style sheets in separate files makes them easy to reuse. Sometimes it’s useful to include
rendering instructions within the document to which they apply, either grouped at the start of the
document, or in attributes of the elements throughout the body of the document. To make it easier to
manage style on a site basis, this specification describes how to use HTTP headers to set the style
sheets to be applied to a document.
Independence from specific style sheet languages
This specification doesn’t tie HTML to any particular style sheet language. This allows for a range of
such languages to be used, for instance simple ones for the majority of users and much more complex
ones for the minority of users with highly specialized needs. The examples included below all use the
CSS (Cascading Style Sheets) language [CSS1] [p.327] , but other style sheet languages would be
possible.
Cascading
This is the capability provided by some style sheet languages such as CSS to allow style information
from several sources to be blended together. These could be, for instance, corporate style guidelines,
styles common to a group of documents, and styles specific to a single document. By storing these
separately, style sheets can be reused, simplifying authoring and making more effective use of
network caching. The cascade defines an ordered sequence of style sheets where rules in later sheets
have greater precedence than earlier ones. Not all style sheet languages support cascading.
Media dependencies
HTML allows authors to specify documents in a media-independent way. This allows users to access
Web pages using a wide variety of devices and media, e.g., graphical displays for computers running
Windows, Macintosh OS, and X11, devices for television sets, specially adapted phones and
PDA-based portable devices, speech-based browsers, and braille-based tactile devices.

172
14.2 Adding style to HTML

Style sheets, by contrast, apply to specific media or media groups. A style sheet intended for screen
use may be applicable when printing, but is of little use for speech-based browsers. This specification
allows you to define the broad categories of media a given style sheet is applicable to. This allows
user agents to avoid retrieving inappropriate style sheets. Style sheet languages may include features
for describing media dependencies within the same style sheet.
Alternate styles
Authors may wish to offer readers several ways to view a document. For instance, a style sheet for
rendering compact documents with small fonts, or one that specifies larger fonts for increased
legibility. This specification allows authors to specify a preferred style sheet as well as alternates that
target specific users or media. User agents should give users the opportunity to select from among
alternate style sheets or to switch off style sheets altogether.
Performance concerns
Some people have voiced concerns over performance issues for style sheets. For instance, retrieving
an external style sheet may delay the full presentation for the user. A similar situation arises if the
document head includes a lengthy set of style rules.

The current proposal addresses these issues by allowing authors to include rendering instructions
within each HTML element. The rendering information is then always available by the time the user
agent wants to render each element.

In many cases, authors will take advantage of a common style sheet for a group of documents. In this
case, distributing style rules throughout the document will actually lead to worse performance than
using a linked style sheet, since for most documents, the style sheet will already be present in the
local cache. The public availability of good style sheets will encourage this effect.

14.2 Adding style to HTML


Note. The sample default style sheet for HTML 4.0 that is included in [CSS2] [p.329] expresses generally
accepted default style information for each element. Authors and implementors alike might find this a
useful resource.

HTML documents may contain style sheet rules directly in them or they may import style sheets.

Any style sheet language may be used with HTML. A simple style sheet language may suffice for the
needs of most users, but other languages may be more suited to highly specialized needs. This
specification uses the style language "Cascading Style Sheets" ([CSS1] [p.327] ), abbreviated CSS, for
examples.

The syntax of style data [p.51] depends on the style sheet language.

14.2.1 Setting the default style sheet language


Authors must specify the style sheet language of style information associated with an HTML document.

Authors should use the META element to set the default style sheet language for a document. For example,
to set the default to CSS, authors should put the following declaration in the HEAD of their documents:

173
14.2.2 Inline style information

<META http-equiv="Content-Style-Type" content="text/css">

The default style sheet language may also be set with HTTP headers. The above META declaration is
equivalent to the HTTP header:
Content-Style-Type: text/css

User agents should determine the default style sheet language for a document according to the following
steps (highest to lowest priority):

1. If any META declarations specify the "Content-Style-Type", the last one in the character stream
determines the default style sheet language.
2. Otherwise, if any HTTP headers specify the "Content-Style-Type", the last one in the character
stream determines the default style sheet language.
3. Otherwise, the default style sheet language is "text/css".

Documents that include elements that set the style attribute but which don’t define a default style sheet
language are incorrect. Authoring tools should generate default style sheet language information (typically
a META declaration) so that user agents do not have to rely on a default of "text/css".

14.2.2 Inline style information


Attribute definitions

style = style [p.51] [CN] [p.43]


This attribute specifies style information for the current element.

The style attribute specifies style information for a single element. The style sheet language of inline
style rules is given by the default style sheet language [p.173] . The syntax of style data [p.51] depends on
the style sheet language.

This example sets color and font size information for the text in a specific paragraph.
<P style="font-size: 12pt; color: fuchsia">Aren’t style sheets wonderful?

In CSS, property declarations have the form "name : value" and are separated by a semi-colon.

The style attribute may be used to apply a particular style to an individual HTML element. If the style
will be reused for several elements, authors should use the STYLE element to regroup that information.
For optimal flexibility, authors should define styles in external style sheets.

14.2.3 Header style information: the STYLE element


<!ELEMENT STYLE - - %StyleSheet -- style info -->
<!ATTLIST STYLE
%i18n; -- lang, dir, for use with title --
type %ContentType; #REQUIRED -- content type of style language --
media %MediaDesc; #IMPLIED -- designed for use with these media --
title %Text; #IMPLIED -- advisory title --
>

174
14.2.3 Header style information: the STYLE element

Start tag: required, End tag: required

Attribute definitions

type = content-type [p.46] [CI] [p.43]


This attribute specifies the style sheet language of the element’s contents and overrides the default
style sheet language. The style sheet language is specified as a content type (e.g., "text/css"). Authors
must supply a value for this attribute; there is no default value for this attribute.
media = media-descriptors [p.49] [CI] [p.43]
This attribute specifies the intended destination medium for style information. It may be a single
media descriptor or a comma-separated list. The default value for this attribute is "screen".

Attributes defined elsewhere

lang (language information [p.71] ), dir (text direction [p.73] )


title (element title [p.57] )

The STYLE element allows authors to put style sheet rules in the head of the document. HTML permits
any number of STYLE elements in the HEAD section of a document.

User agents that don’t support style sheets, or don’t support the specific style sheet language used by a
STYLE element, must hide the contents of the STYLE element. It is an error to render the content as part
of the document’s text. Some style sheet languages support syntax for hiding the content [p.181] from
non-conforming user agents.

The syntax of style data [p.51] depends on the style sheet language.

Some style sheet implementations may allow a wider variety of rules in the STYLE element than in the
style attribute. For example, with CSS, rules may be declared within a STYLE element for:

All instances of a specific HTML element (e.g., all P elements, all H1 elements, etc.)
All instances of an HTML element belonging to a specific class (i.e., whose class attribute is set to
some value).
Single instances of an HTML element (i.e., whose id attribute is set to some value).

Rules for style rule precedences and inheritance depend on the style sheet language.

The following CSS STYLE declaration puts a border around every H1 element in the document and
centers it on the page.
<HEAD>
<STYLE type="text/css">
H1 {border-width: 1; border: solid; text-align: center}
</STYLE>
</HEAD>

To specify that this style information should only apply to H1 elements of a specific class, we modify it as
follows:

175
14.2.3 Header style information: the STYLE element

<HEAD>
<STYLE type="text/css">
[Link] {border-width: 1; border: solid; text-align: center}
</STYLE>
</HEAD>
<BODY>
<H1 class="myclass"> This H1 is affected by our style </H1>
<H1> This one is not affected by our style </H1>
</BODY>

Finally, to limit the scope of the style information to a single instance of H1, set the id attribute:
<HEAD>
<STYLE type="text/css">
#myid {border-width: 1; border: solid; text-align: center}
</STYLE>
</HEAD>
<BODY>
<H1 class="myclass"> This H1 is not affected </H1>
<H1 id="myid"> This H1 is affected by style </H1>
<H1> This H1 is not affected </H1>
</BODY>

Although style information may be set for almost every HTML element, two elements, DIV and SPAN,
are particularly useful in that they do not impose any presentation semantics (besides block-level vs. inline
[p.66] ). When combined with style sheets, these elements allow users to extend HTML indefinitely,
particularly when used with the class and id attributes.

In the following example, we use the SPAN element to set the font style of the first few words of a
paragraph to small caps.
<HEAD>
<STYLE type="text/css">
[Link]-ex { font-variant: small-caps }
</STYLE>
</HEAD>
<BODY>
<P><SPAN class="sc-ex">The first</SPAN> few words of
this paragraph are in small-caps.
</BODY>

In the following example, we use DIV and the class attribute to set the text justification for a series of
paragraphs that make up the abstract section of a scientific article. This style information could be reused
for other abstract sections by setting the class attribute elsewhere in the document.
<HEAD>
<STYLE type="text/css">
[Link] { text-align: justify }
</STYLE>
</HEAD>
<BODY>
<DIV class="Abstract">
<P>The Chieftain product range is our market winner for
the coming year. This report sets out how to position
Chieftain against competing products.

176
14.3 External style sheets

<P>Chieftain replaces the Commander range, which will


remain on the price list until further notice.
</DIV>
</BODY>

14.2.4 Media types


HTML allows authors to design documents that take advantage of the characteristics of the media where
the document is to be rendered (e.g., graphical displays, television screens, handheld devices,
speech-based browsers, braille-based tactile devices, etc.). By specifying the media attribute, authors
allow user agents to load and apply style sheets selectively. Please consult the list of recognized media
descriptors [p.49] .

The following sample declarations apply to H1 elements. When projected in a business meeting, all
instances will be blue. When printed, all instances will be centered.
<HEAD>
<STYLE type="text/css" media="projection">
H1 { color: blue}
</STYLE>

<STYLE type="text/css" media="print">


H1 { text-align: center }
</STYLE>

This example adds sound effects to anchors for use in speech output:
<STYLE type="text/css" media="aural">
A { cue-before: uri([Link]); cue-after: uri([Link])}
</STYLE>
</HEAD>

Media control is particularly interesting when applied to external style sheets since user agents can save
time by retrieving from the network only those style sheets that apply to the current device. For instance,
speech-based browsers can avoid downloading style sheets designed for visual rendering. See the section
on media-dependent cascades [p.180] for more information.

14.3 External style sheets


Authors may separate style sheets from HTML documents. This offers several benefits:

Authors and Web site managers may share style sheets across a number of documents (and sites).
Authors may change the style sheet without requiring modifications to the document.
User agents may load style sheets selectively (based on media descriptions).

177
14.3.1 Preferred and alternate style sheets

14.3.1 Preferred and alternate style sheets


HTML allows authors to associate any number of external style sheets with a document. The style sheet
language defines how multiple external style sheets interact (for example, the CSS "cascade" rules).

Authors may specify a number of mutually exclusive style sheets called alternate style sheets. Users may
select their favorite among these depending on their preferences. For instance, an author may specify one
style sheet designed for small screens and another for users with weak vision (e.g., large fonts). User
agents should allow users to select from alternate style sheets.

The author may specify that one of the alternates is a preferred style sheet. User agents should apply the
author’s preferred style sheet unless the user has selected a different alternate.

Authors may group several alternate style sheets (including the author’s preferred style sheets) under a
single style name. When a user selects a named style, the user agent must apply all style sheets with that
name. User agents must not apply alternate style sheets with a different style name. The section on
specifying external style sheets [p.178] explains how to name a group of style sheets.

Authors may also specify persistent style sheets that user agents must apply in addition to any alternate
style sheet.

User agents must respect media descriptors [p.49] when applying any style sheet.

User agents should also allow users to disable the author’s style sheets entirely, in which case the user
agent must not apply any persistent or alternate style sheets.

14.3.2 Specifying external style sheets


Authors specify external style sheets with the following attributes of the LINK element:

Set the value of href to the location of the style sheet file. The value of href is a URI [p.44] .
Set the value of the type attribute to indicate the language of the linked (style sheet) resource. This
allows the user agent to avoid downloading a style sheet for an unsupported style sheet language.
Specify that the style sheet is persistent, preferred, or alternate:
To make a style sheet persistent, set the rel attribute to "stylesheet" and don’t set the title
attribute.
To make a style sheet preferred, set the rel attribute to "stylesheet" and name the style sheet
with the title attribute.
To specify an alternate style sheet, set the rel attribute to "alternate stylesheet" and name the
style sheet with the title attribute.

User agents should provide a means for users to view and pick from the list of alternate styles. The value
of the title attribute is recommended as the name of each choice.

In this example, we first specify a persistent style sheet located in the file [Link]:

178
14.4 Cascading style sheets

<LINK href="[Link]" rel="stylesheet" type="text/css">

Setting the title attribute makes this the author’s preferred style sheet:
<LINK href="[Link]" title="compact" rel="stylesheet" type="text/css">

Adding the keyword "alternate" to the rel attribute makes it an alternate style sheet:
<LINK href="[Link]" title="Medium" rel="alternate stylesheet" type="text/css">

For more information on external style sheets, please consult the section on links and external style sheets.
[p.144]

Authors may also use the META element to set the document’s preferred style sheet. For example, to set
the preferred style sheet to "compact" (see the preceding example), authors may include the following line
in the HEAD:
<META http-equiv="Default-Style" content="compact">

The preferred style sheet may also be specified with HTTP headers. The above META declaration is
equivalent to the HTTP header:
Default-Style: "compact"

If two or more META declarations or HTTP headers specify the preferred style sheet, the last one takes
precedence. HTTP headers are considered to occur earlier than the document HEAD for this purpose.

If two or more LINK elements specify a preferred style sheet, the first one takes precedence.

Preferred style sheets specified with META or HTTP headers have precedence over those specified with
the LINK element.

14.4 Cascading style sheets


Cascading style sheet languages such as CSS allow style information from several sources to be blended
together. However, not all style sheet languages support cascading. To define a cascade, authors specify a
sequence of LINK and/or STYLE elements. The style information is cascaded in the order the elements
appear in the HEAD.

Note. This specification does not specify how style sheets from different style languages cascade. Authors
should avoid mixing style sheet languages.

In the following example, we specify two alternate style sheets named "compact". If the user selects the
"compact" style, the user agent must apply both external style sheets, as well as the persistent
"[Link]" style sheet. If the user selects the "big print" style, only the alternate style sheet
"[Link]" and the persistent "[Link]" will be applied.

179
14.4.1 Media-dependent cascades

<LINK rel="alternate stylesheet" title="compact" href="[Link]" type="text/css">


<LINK rel="alternate stylesheet" title="compact" href="[Link]" type="text/css">
<LINK rel="alternate stylesheet" title="big print" href="[Link]" type="text/css">
<LINK rel="stylesheet" href="[Link]" type="text/css">

Here is a cascade example that involves both the LINK and STYLE elements.
<LINK rel="stylesheet" href="[Link]" type="text/css">
<LINK rel="stylesheet" href="[Link]" type="text/css">
<STYLE type="text/css">
[Link] { color: rgb(230, 100, 180) }
</STYLE>

14.4.1 Media-dependent cascades


A cascade may include style sheets applicable to different media. Both LINK and STYLE may be used
with the media attribute. The user agent is then responsible for filtering out those style sheets that do not
apply to the current medium.

In the following example, we define a cascade where the "corporate" style sheet is provided in several
versions: one suited to printing, one for screen use and one for speech-based browsers (useful, say, when
reading email in the car). The "techreport" stylesheet applies to all media. The color rule defined by the
STYLE element is used for print and screen but not for aural rendering.
<LINK rel="stylesheet" media="aural" href="[Link]" type="text/css">
<LINK rel="stylesheet" media="screen" href="[Link]" type="text/css">
<LINK rel="stylesheet" media="print" href="[Link]" type="text/css">
<LINK rel="stylesheet" href="[Link]" type="text/css">
<STYLE type="text/css">
[Link] { color: rgb(230, 100, 180) }
</STYLE>

14.4.2 Inheritance and cascading


When the user agent wants to render a document, it needs to find values for style properties, e.g. the font
family, font style, size, line height, text color and so on. The exact mechanism depends on the style sheet
language, but the following description is generally applicable:

The cascading mechanism is used when a number of style rules all apply directly to an element. The
mechanism allows the user agent to sort the rules by specificity, to determine which rule to apply. If no
rule can be found, the next step depends on whether the style property can be inherited or not. Not all
properties can be inherited. For these properties the style sheet language provides default values for use
when there are no explicit rules for a particular element.

If the property can be inherited, the user agent examines the immediately enclosing element to see if a rule
applies to that. This process continues until an applicable rule is found. This mechanism allows style
sheets to be specified compactly. For instance, authors may specify the font family for all elements within
the BODY by a single rule that applies to the BODY element.

180
14.5 Hiding style data from user agents

14.5 Hiding style data from user agents


Some style sheet languages support syntax intended to allow authors to hide the content of STYLE
elements from non-conforming user agents.

This example illustrates for CSS how to comment out the content of STYLE elements to ensure that older
non-conforming user agents will not render them as text.
<STYLE type="text/css">
<!--
H1 { color: red }
P { color: blue}
-->
</STYLE>

14.6 Linking to style sheets with HTTP headers


Web server managers may find it convenient to configure a server so that a style sheet will be applied to a
group of pages. The HTTP Link header described in [RFC2068] [p.328] , section [Link], has the same
effect as a LINK element with the same attributes and values. Multiple Link headers correspond to
multiple LINK elements occurring in the same order. For instance,
Link: <[Link] REL=stylesheet

corresponds to:
<LINK rel="stylesheet" href="[Link]

It is possible to specify several alternate styles using multiple Link headers, and then use the rel
attribute to determine the default style.

In the following example, "compact" is applied by default since it omits the "alternate" keyword for the
rel attribute.
Link: <[Link]>; rel="stylesheet"; title="compact"
Link: <[Link]>; rel="alternate stylesheet"; title="big print"

This should also work when HTML documents are sent by email. Some email agents can alter the
ordering of [RFC822] [p.330] headers. To protect against this affecting the cascading order for style
sheets specified by Link headers, authors can use header concatenation to merge several instances of the
same header field. The quote marks are only needed when the attribute values include whitespace. Use
SGML entities to reference characters that are otherwise not permitted within HTTP or email headers, or
that are likely to be affected by transit through gateways.

LINK and META elements implied by HTTP headers are defined as occurring before any explicit LINK
and META elements in the document’s HEAD.

181
14.6 Linking to style sheets with HTTP headers

182
15 Alignment, font styles, and horizontal rules

15 Alignment, font styles, and horizontal rules


Contents

1. Formatting . . . . . . . . . . . . . . . . . . . 183
.
1. Background color . . . . . . . . . . . . . . . . 183
.
2. Alignment . . . . . . . . . . . . . . . . . . 183
.
3. Floating objects . . . . . . . . . . . . . . . . . 185
.
Float an object . . . . . . . . . . . . . . . . 185
.
Float text around an object . . . . . . . . . . . . . 186
.
2. Fonts . . . . . . . . . . . . . . . . . . . . 187
.
1. Font style elements: the TT, I, B, BIG, SMALL, STRIKE, S, and U elements . . . 187
.
2. Font modifier elements: FONT and BASEFONT . . . . . . . . . . 188
.
3. Rules: the HR element . . . . . . . . . . . . . . . . . 190
.

This section of the specification discusses some HTML elements and attributes that may be used for visual
formatting of elements. Many of them are deprecated [p.34] .

15.1 Formatting
15.1.1 Background color
Attribute definitions

bgcolor = color [p.45] [CI] [p.43]


Deprecated. [p.34] This attribute sets the background color for the document body or table cells.

This attribute sets the background color of the canvas for the document body (the BODY element) or for
tables (the TABLE, TR, TH, and TD elements). Additional attributes for specifying text color can be used
with the BODY element.

This attribute has been deprecated [p.34] in favor of style sheets for specifying background color
information.

15.1.2 Alignment
It is possible to align block elements (tables, images, objects, paragraphs, etc.) on the canvas with the
align attribute. Although this attribute may be set for many HTML elements, its range of possible
values sometimes differs from element to element. Here we only discuss the meaning of the align attribute
for text.

Attribute definitions

183
15.1.2 Alignment

align = left|center|right|justify [CI] [p.43]


Deprecated. [p.34] This attribute specifies the horizontal alignment of its element with respect to the
surrounding context. Possible values:
left: text lines are rendered flush left.
center: text lines are centered.
right: text lines are rendered flush right.
justify: text lines are justified to both margins.

The default depends on the base text direction. For left to right text, the default is align=left, while
for right to left text, the default is align=right.

DEPRECATED EXAMPLE:
This example centers a heading on the canvas.
<H1 align="center"> How to Carve Wood </H1>

Using CSS, for example, you could achieve the same effect as follows:
<HEAD>
<TITLE>How to Carve Wood</TITLE>
<STYLE type="text/css">
H1 { text-align: center}
</STYLE>
<BODY>
<H1> How to Carve Wood </H1>

Note that this would center all H1 declarations. You could reduce the scope of the style by setting the
class attribute on the element:
<HEAD>
<TITLE>How to Carve Wood</TITLE>
<STYLE type="text/css">
[Link] {text-align: center}
</STYLE>
<BODY>
<H1 class="wood"> How to Carve Wood </H1>

DEPRECATED EXAMPLE:
Similarly, to right align a paragraph on the canvas with HTML’s align attribute you could have:
<P align="right">...Lots of paragraph text...

which, with CSS, would be:


<HEAD>
<TITLE>How to Carve Wood</TITLE>
<STYLE type="text/css">
[Link] {text-align: right}
</STYLE>
<BODY>
<P class="mypar">...Lots of paragraph text...

184
15.1.3 Floating objects

DEPRECATED EXAMPLE:
To right align a series of paragraphs, group them with the DIV element:
<DIV align="right">
<P>...text in first paragraph...
<P>...text in second paragraph...
<P>...text in third paragraph...
</DIV>

With CSS, the text-align property is inherited from the parent element, you can therefore use:
<HEAD>
<TITLE>How to Carve Wood</TITLE>
<STYLE type="text/css">
[Link] {text-align: right}
</STYLE>
<BODY>
<DIV class="mypars">
<P>...text in first paragraph...
<P>...text in second paragraph...
<P>...text in third paragraph...
</DIV>

To center the entire document with CSS:


<HEAD>
<TITLE>How to Carve Wood</TITLE>
<STYLE type="text/css">
BODY {text-align: center}
</STYLE>
<BODY>
...the body is centered...
</BODY>

The CENTER element is exactly equivalent to specifying the DIV element with the align attribute set to
"center". The CENTER element is deprecated [p.34] .

15.1.3 Floating objects


Images and objects may appear directly "in-line" or may be floated to one side of the page, temporarily
altering the margins of text that may flow on either side of the object.

Float an object
The align attribute for object, images, tables, frames, etc., causes the object to float to the left or right
margin. Floating objects generally begin a new line. This attribute takes the following values:

left: Floats the object to the current left margin. Subsequent text flows along the image’s right
side.
right: Floats the object to the current right margin. Subsequent text flows along the image’s left
side.

185
15.1.3 Floating objects

DEPRECATED EXAMPLE:
The following example shows how to float an IMG element to the current left margin of the canvas.
<IMG align="left" src="[Link] alt="my boat">

Some alignment attributes also permit the "center" value, which does not cause floating, but centers the
object within the current margins. However, for P and DIV, the value "center" causes the contents of the
element to be centered.

Float text around an object


Another attribute, defined for the BR element, controls text flow around floating objects.

Attribute definitions

clear = none|left|right|all [CI] [p.43]


Deprecated. [p.34] Specifies where the next line should appear in a visual browser after the line
break caused by this element. This attribute takes into account floating objects (images, tables, etc.).
Possible values:
none: The next line will begin normally. This is the default value.
left: The next line will begin at nearest line below any floating objects on the left-hand
margin.
right: The next line will begin at nearest line below any floating objects on the right-hand
margin.
all: The next line will begin at nearest line below any floating objects on either margin.

Consider the following visual scenario, where text flows to the right of an image until a line is broken by a
BR:
********* -------
| | -------
| image | --<BR>
| |
*********

If the clear attribute is set to none, the line following BR will begin immediately below it at the right
margin of the image:
********* -------
| | -------
| image | --<BR>
| | ------
*********

DEPRECATED EXAMPLE:
If the clear attribute is set to left or all, next line will appear as follows:

186
15.2 Fonts

********* -------
| | -------
| image | --<BR clear="left">
| |
*********
-----------------

Using style sheets, you could specify that all line breaks should behave this way for objects (images,
tables, etc.) floating against the left margin. With CSS, you could achieve this as follows:
<STYLE type="text/css">
BR { clear: left }
</STYLE>

To specify this behavior for a specific instance of the BR element, you could combine style information
and the id attribute:
<HEAD>
...
<STYLE type="text/css">
BR#mybr { clear: left }
</STYLE>
</HEAD>
<BODY>
<P>...
********* -------
| | -------
| table | --<BR id="mybr">
| |
*********
-----------------
...
</BODY>

15.2 Fonts
The following HTML elements specify font information. Although they are not all deprecated [p.34] , their
use is discouraged in favor of style sheets.

15.2.1 Font style elements: the TT, I, B, BIG, SMALL, STRIKE, S, and U
elements
<!ENTITY % fontstyle
"TT | I | B | BIG | SMALL">
<!ELEMENT (%fontstyle;|%phrase;) - - (%inline;)*>
<!ATTLIST (%fontstyle;|%phrase;)
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

187
15.2.2 Font modifier elements: FONT and BASEFONT

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown onkeyup (intrinsic events [p.240] )

Rendering of font style elements depends on the user agent. The following is an informative description
only.

TT: Renders as teletype or monospaced text.


I: Renders as italic text style.
B: Renders as bold text style.
BIG: Renders text in a "large" font.
SMALL: Renders text in a "small" font.
STRIKE and S: Deprecated. [p.34] Render strike-through style text.
U: Deprecated. [p.34] Renders underlined text.

The following sentence shows several types of text:


<P><b>bold</b>,
<i>italic</i>, <b><i>bold italic</i></b>, <tt>teletype text</tt>, and
<big>big</big> and <small>small</small> text.

These words might be rendered as follows:

It is possible to achieve a much richer variety of font effects using style sheets. To specify blue, italic text
in a paragraph with CSS:
<HEAD>
<STYLE type="text/css">
[Link] {font-style: italic; color: blue}
</STYLE>
</HEAD>
<P id="mypar">...Lots of blue italic text...

Font style elements must be properly nested. Rendering of nested font style elements depends on the user
agent.

15.2.2 Font modifier elements: FONT and BASEFONT


FONT and BASEFONT are deprecated [p.34] .

188
15.2.2 Font modifier elements: FONT and BASEFONT

See the Transitional DTD [p.271] for the formal definition.

Attribute definitions

size = cdata [p.44] [CN] [p.43]


Deprecated. [p.34] This attribute sets the size of the font. Possible values:
An integer between 1 and 7. This sets the font to some fixed size, whose rendering depends on
the user agent. Not all user agents may render all seven sizes.
A relative increase in font size. The value "+1" means one size larger. The value "-3" means
three sizes smaller. All sizes belong to the scale of 1 to 7.
color = color [p.45] [CI] [p.43]
Deprecated. [p.34] This attribute sets the text color.
face = cdata [p.44] [CI] [p.43]
Deprecated. [p.34] This attribute defines a comma-separated list of font names the user agent should
search for in order of preference.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )

The FONT element changes the font size and color for text in its contents.

The BASEFONT element sets the base font size (using the size attribute). Font size changes achieved
with FONT are relative to the base font size set by BASEFONT. If BASEFONT is not used, the default base
font size is 3.

DEPRECATED EXAMPLE:
The following example will show the difference between the seven font sizes available with FONT:
<P><font size=1>size=1</font>
<font size=2>size=2</font>
<font size=3>size=3</font>
<font size=4>size=4</font>
<font size=5>size=5</font>
<font size=6>size=6</font>
<font size=7>size=7</font>

This might be rendered as:

The following shows an example of the effect of relative font sizes using a base font size of 3:

189
15.3 Rules: the HR element

The base font size does not apply to headings, except where these are modified using the FONT element
with a relative font size change.

15.3 Rules: the HR element


<!ELEMENT HR - O EMPTY -- horizontal rule -->
<!ATTLIST HR
%coreattrs; -- id, class, style, title --
%events;
>

Start tag: required, End tag: forbidden

Attribute definitions

align = left|center|right [CI] [p.43]


Deprecated. [p.34] This attribute specifies the horizontal alignment of the rule with respect to the
surrounding context. Possible values:
left: the rule is rendered flush left.
center: the rule is centered.
right: the rule is rendered flush right.

The default is align=center.


noshade [CI] [p.43]
Deprecated. [p.34] When set, this boolean attribute requests that the user agent render the rule in a
solid color rather than as the traditional two-color "groove".
size = pixels [p.46] [CI] [p.43]
Deprecated. [p.34] This attribute specifies the height of the rule. The default value for this attribute
depends on the user agent.
width = length [p.46] [CI] [p.43]
Deprecated. [p.34] This attribute specifies the width of the rule. The default width is 100%, i.e., the
rule extends across the entire canvas.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )
align (alignment [p.183] )

190
15.3 Rules: the HR element

The HR element causes a horizontal rule to be rendered by visual user agents.

The amount of vertical space inserted between a rule and the content that surrounds it depends on the user
agent.

DEPRECATED EXAMPLE:
This example centers the rules, sizing them to half the available width between the margins. The top rule
has the default thickness while the bottom two are set to 5 pixels. The bottom rule should be rendered in a
solid color without shading:
<HR width="50%" align="center">
<HR size="5" width="50%" align="center">
<HR noshade size="5" width="50%" align="center">

These rules might be rendered as follows:

191
15.3 Rules: the HR element

192
16 Frames

16 Frames
Contents

1. Introduction to frames . . . . . . . . . . . . . . . . 193


.
2. Layout of frames . . . . . . . . . . . . . . . . . . 194
.
1. The FRAMESET element . . . . . . . . . . . . . . . 194
.
Rows and columns . . . . . . . . . . . . . . . 195
.
Nested frame sets . . . . . . . . . . . . . . . 196
.
Sharing data among frames . . . . . . . . . . . . . 196
.
2. The FRAME element . . . . . . . . . . . . . . . . 197
.
Setting the initial contents of a frame . . . . . . . . . . . 198
.
Visual rendering of a frame . . . . . . . . . . . . . 199
.
3. Specifying target frame information . . . . . . . . . . . . . 200
.
1. Setting the default target for links . . . . . . . . . . . . . 201
.
2. Target semantics . . . . . . . . . . . . . . . . . 202
.
4. Alternate content . . . . . . . . . . . . . . . . . . 202
.
1. The NOFRAMES element . . . . . . . . . . . . . . . 202
.
2. Long descriptions of frames . . . . . . . . . . . . . . 203
.
5. Inline frames: the IFRAME element . . . . . . . . . . . . . . 204
.

16.1 Introduction to frames


HTML frames allow authors to present documents in multiple views, which may be independent windows
or subwindows. Multiple views offer designers a way to keep certain information visible, while other
views are scrolled or replaced. For example, within the same window, one frame might display a static
banner, a second a navigation menu, and a third the main document that can be scrolled though or
replaced by navigating in the second frame.

Here is a simple frame document:


<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A simple frameset document</TITLE>
</HEAD>
<FRAMESET cols="20%, 80%">
<FRAMESET rows="100, 200">
<FRAME src="contents_of_frame1.html">
<FRAME src="contents_of_frame2.gif">
</FRAMESET>
<FRAME src="contents_of_frame3.html">
<NOFRAMES>
<P>This frameset document contains:
<UL>
<LI><A href="contents_of_frame1.html">Some neat contents</A>
<LI><IMG src="contents_of_frame2.gif" alt="A neat image">

193
16.2 Layout of frames

<LI><A href="contents_of_frame3.html">Some other neat contents</A>


</UL>
</NOFRAMES>
</FRAMESET>
</HTML>

that might create a frame layout something like this:


---------------------------------------
| | |
| | |
| Frame 1 | |
| | |
| | |
|---------| |
| | Frame 3 |
| | |
| | |
| | |
| Frame 2 | |
| | |
| | |
| | |
| | |
---------------------------------------

If the user agent can’t display frames or is configured not to, it will render the contents of the NOFRAMES
element.

16.2 Layout of frames


An HTML document that describes frame layout (called a frameset document) has a different makeup
than an HTML document without frames. A standard document has one HEAD section and one BODY. A
frameset document has a HEAD, and a FRAMESET in place of the BODY.

The FRAMESET section of a document specifies the layout of views in the main user agent window. In
addition, the FRAMESET section can contain a NOFRAMES element to provide alternate content [p.202]
for user agents that do not support frames or are configured not to display frames.

Elements that might normally be placed in the BODY element must not appear before the first FRAMESET
element or the FRAMESET will be ignored.

16.2.1 The FRAMESET element


<![ %[Link]; [
<!ELEMENT FRAMESET - - ((FRAMESET|FRAME)+ & NOFRAMES?) -- window subdivision-->
<!ATTLIST FRAMESET
%coreattrs; -- id, class, style, title --
rows %MultiLengths; #IMPLIED -- list of lengths,
default: 100% (1 row) --
cols %MultiLengths; #IMPLIED -- list of lengths,
default: 100% (1 col) --

194
16.2.1 The FRAMESET element

onload %Script; #IMPLIED -- all the frames have been loaded --


onunload %Script; #IMPLIED -- all the frames have been removed --
>
]]>

Attribute definitions

rows = multi-length-list [p.46] [CN] [p.43]


This attribute specifies the layout of horizontal frames. It is a comma-separated list of pixels,
percentages, and relative lengths. The default value is 100%, meaning one row.
cols = multi-length-list [p.46] [CN] [p.43]
This attribute specifies the layout of vertical frames. It is a comma-separated list of pixels,
percentages, and relative lengths. The default value is 100%, meaning one column.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


title (element title [p.57] )
style (inline style information [p.174] )
onload, onunload (intrinsic events [p.240] )

The FRAMESET element specifies the layout of the main user window in terms of rectangular subspaces.

Rows and columns


Setting the rows attribute defines the number of horizontal subspaces in a frameset. Setting the cols
attribute defines the number of vertical subspaces. Both attributes may be set simultaneously to create a
grid.

If the rows attribute is not set, each column extends the entire length of the page. If the cols attribute is
not set, each row extends the entire width of the page. If neither attribute is set, the frame takes up exactly
the size of the page.

Frames are created left-to-right for columns and top-to-bottom for rows. When both attributes are
specified, views are created left-to-right in the top row, left-to-right in the second row, etc.

The first example divides the screen vertically in two (i.e., creates a top half and a bottom half).
<FRAMESET rows="50%, 50%">
...the rest of the definition...
</FRAMESET>

The next example creates three columns: the second has a fixed width of 250 pixels (useful, for example,
to hold an image with a known size). The first receives 25% of the remaining space and the third 75% of
the remaining space.
<FRAMESET cols="1*,250,3*">
...the rest of the definition...
</FRAMESET>

195
16.2.1 The FRAMESET element

The next example creates a 2x3 grid of subspaces.


<FRAMESET rows="30%,70%" cols="33%,34%,33%">
...the rest of the definition...
</FRAMESET>

For the next example, suppose the browser window is currently 1000 pixels high. The first view is allotted
30% of the total height (300 pixels). The second view is specified to be exactly 400 pixels high. This
leaves 300 pixels to be divided between the other two frames. The fourth frame’s height is specified as
"2*", so it is twice as high as the third frame, whose height is only "*" (equivalent to 1*). Therefore the
third frame will be 100 pixels high and the fourth will be 200 pixels high.
<FRAMESET rows="30%,400,*,2*">
...the rest of the definition...
</FRAMESET>

Absolute lengths that do not sum to 100% of the real available space should be adjusted by the user agent.
When underspecified, remaining space should be allotted proportionally to each view. When
overspecified, each view should be reduced according to its specified proportion of the total space.

Nested frame sets


Framesets may be nested to any level.

In the following example, the outer FRAMESET divides the available space into three equal columns. The
inner FRAMESET then divides the second area into two rows of unequal height.
<FRAMESET cols="33%, 33%, 34%">
...contents of first frame...
<FRAMESET rows="40%, 50%">
...contents of second frame, first row...
...contents of second frame, second row...
</FRAMESET>
...contents of third frame...
</FRAMESET>

Sharing data among frames


Authors may share data among several frames by including this data via an OBJECT element. Authors
should include the OBJECT element in the HEAD element of a frameset document and name it with the id
attribute. Any document that is the contents of a frame in the frameset may refer to this identifier.

The following example illustrates how a script might refer to an OBJECT element defined for an entire
frameset:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>This is a frameset with OBJECT in the HEAD</TITLE>
<!-- This OBJECT is not rendered! -->
<OBJECT id="myobject" data="[Link]"></OBJECT>

196
16.2.2 The FRAME element

</HEAD>
<FRAMESET>
<FRAME src="[Link]" name="bianca">
</FRAMESET>
</HTML>

<!-- In [Link] -->


<HTML>
<HEAD>
<TITLE>Bianca’s page</TITLE>
</HEAD>
<BODY>
...the beginning of the document...
<P>
<SCRIPT type="text/javascript">
[Link]
</SCRIPT>
...the rest of the document...
</BODY>
</HTML>

16.2.2 The FRAME element


<![ %[Link]; [
<!-- reserved frame names start with "_" otherwise starts with letter -->
<!ELEMENT FRAME - O EMPTY -- subwindow -->
<!ATTLIST FRAME
%coreattrs; -- id, class, style, title --
longdesc %URI; #IMPLIED -- link to long description
(complements title) --
name CDATA #IMPLIED -- name of frame for targetting --
src %URI; #IMPLIED -- source of frame content --
frameborder (1|0) 1 -- request frame borders? --
marginwidth %Pixels; #IMPLIED -- margin widths in pixels --
marginheight %Pixels; #IMPLIED -- margin height in pixels --
noresize (noresize) #IMPLIED -- allow users to resize frames? --
scrolling (yes|no|auto) auto -- scrollbar or none --
>
]]>

Attribute definitions

name = cdata [p.44] [CI] [p.43]


This attribute assigns a name to the current frame. This name may be used as the target of subsequent
links.
longdesc = uri [p.44] [CT] [p.43]
This attribute specifies a link to a long description of the frame. This description should supplement
the short description provided using the title attribute, and may be particularly useful for
non-visual user agents.
src = uri [p.44] [CT] [p.43]
This attribute specifies the location of the initial contents to be contained in the frame.

197
16.2.2 The FRAME element

noresize [CI] [p.43]


When present, this boolean attribute tells the user agent that the frame window must not be
resizeable.
scrolling = auto|yes|no [CI] [p.43]
This attribute specifies scroll information for the frame window. Possible values
auto: This value tells the user agent to provide scrolling devices for the frame window when
necessary. This is the default value.
yes: This value tells the user agent to always provide scrolling devices for the frame window.
no: This value tells the user agent not to provide scrolling devices for the frame window.
frameborder = 1|0 [CN] [p.43]
This attribute provides the user agent with information about the frame border. Possible values:
1: This value tells the user agent to draw a separator between this frame and every adjoining
frame. This is the default value.
0: This value tells the user agent not to draw a separator between this frame and every
adjoining frame. Note that separators may be drawn next to this frame nonetheless if specified
by other frames.
marginwidth = pixels [p.46] [CN] [p.43]
This attribute specifies the amount of space to be left between the frame’s contents in its left and
right margins. The value must be greater than one pixel. The default value depends on the user agent.
marginheight = pixels [p.46] [CN] [p.43]
This attribute specifies the amount of space to be left between the frame’s contents in its top and
bottom margins. The value must be greater than one pixel. The default value depends on the user
agent.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


title (element title [p.57] )
style (inline style information [p.174] )
target (target frame information [p.200] )

The FRAME element defines the contents and appearance of a single frame.

Setting the initial contents of a frame


The src attribute specifies the initial document the frame will contain.

The following example HTML document:


<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A frameset document</TITLE>
</HEAD>
<FRAMESET cols="33%,33%,33%">
<FRAMESET rows="*,200">
<FRAME src="contents_of_frame1.html">
<FRAME src="contents_of_frame2.gif">

198
16.2.2 The FRAME element

</FRAMESET>
<FRAME src="contents_of_frame3.html">
<FRAME src="contents_of_frame4.html">
</FRAMESET>
</HTML>

should create a frame layout something like this:


------------------------------------------
|Frame 1 |Frame 3 |Frame 4 |
| | | |
| | | |
| | | |
| | | |
| | | |
| | | |
| | | |
-------------| | |
|Frame 2 | | |
| | | |
| | | |
------------------------------------------

and cause the user agent to load each file into a separate view.

The contents of a frame must not be in the same document as the frame’s definition.

ILLEGAL EXAMPLE:
The following frameset definition is not legal HTML since the contents of the second frame are in the
same document as the frameset.
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A frameset document</TITLE>
</HEAD>
<FRAMESET cols="50%,50%">
<FRAME src="contents_of_frame1.html">
<FRAME src="#anchor_in_same_document">
<NOFRAMES>
...some text...
<H2><A name="anchor_in_same_document">Important section</A></H2>
...some text...
</NOFRAMES>
</FRAMESET>
</HTML>

Visual rendering of a frame


The following example illustrates the usage of the decorative FRAME attributes. We specify that frame 1
will allow no scroll bars. Frame 2 will leave white space around its contents (initially, an image file) and
the frame will not be resizeable. No border will be drawn between frames 3 and 4. Borders will be drawn
(by default) between frames 1, 2, and 3.

199
16.3 Specifying target frame information

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A frameset document</TITLE>
</HEAD>
<FRAMESET cols="33%,33%,33%">
<FRAMESET rows="*,200">
<FRAME src="contents_of_frame1.html" scrolling="no">
<FRAME src="contents_of_frame2.gif"
marginwidth="10" marginheight="15"
noresize>
</FRAMESET>
<FRAME src="contents_of_frame3.html" frameborder="0">
<FRAME src="contents_of_frame4.html" frameborder="0">
</FRAMESET>
</HTML>

16.3 Specifying target frame information


Note. For information about current practice in determining the target of a frame, please consult the
notes on frames [p.324] in the appendix.

Attribute definitions

target = frame-target [p.51] [CI] [p.43]


This attribute specifies the name of a frame where a document is to be opened.

By assigning a name to a frame via the name attribute, authors can refer to it as the "target" of links
defined by other elements. The target attribute may be set for elements that create links (A, LINK),
image maps (AREA), and forms (FORM).

Please consult the section on target frame names [p.51] for information about recognized frame names.

This example illustrates how targets allow the dynamic modification of a frame’s contents. First we define
a frameset in the document [Link], shown here:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A frameset document</TITLE>
</HEAD>
<FRAMESET rows="50%,50%">
<FRAME name="fixed" src="init_fixed.html">
<FRAME name="dynamic" src="init_dynamic.html">
</FRAMESET>
</HTML>

Then, in init_dynamic.html, we link to the frame named "dynamic".

200
16.3.1 Setting the default target for links

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A document with anchors with specific targets</TITLE>
</HEAD>
<BODY>
...beginning of the document...
<P>Now you may advance to
<A href="[Link]" target="dynamic">slide 2.</A>
...more document...
<P>You’re doing great. Now on to
<A href="[Link]" target="dynamic">slide 3.</A>
</BODY>
</HTML>

Activating either link opens a new document in the frame named "dynamic" while the other frame,
"fixed", maintains its initial contents.

Note. A frameset definition never changes, but the contents of one of its frames can. Once the initial
contents of a frame change, the frameset definition no longer reflects the current state of its frames.

There is currently no way to encode the entire state of a frameset in a URI. Therefore, many user agents
do not allow users to assign a bookmark to a frameset.

Framesets may make navigation forward and backward through your user agent’s history more difficult
for users.

16.3.1 Setting the default target for links


When many links in the same document designate the same target, it is possible to specify the target once
and dispense with the target attribute of each element. This is done by setting the target attribute of
the BASE element.

We return to the previous example, this time factorizing the target information by defining it in the BASE
element and removing it from the A elements.
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A document with BASE with a specific target</TITLE>
<BASE href="[Link] target="dynamic">
</HEAD>
<BODY>
...beginning of the document...
<P>Now you may advance to <A href="[Link]">slide 2.</A>
...more document...
<P>You’re doing great. Now on to
<A href="[Link]">slide 3.</A>
</BODY>
</HTML>

201
16.4 Alternate content

16.3.2 Target semantics


User agents should determine the target frame in which to load a linked resource according to the
following precedences (highest priority to lowest):

1. If an element has its target attribute set to a known frame, when the element is activated (i.e., a
link is followed or a form is processed), the resource designated by the element should be loaded into
the target frame.
2. If an element does not have the target attribute set but the BASE element does, the BASE
element’s target attribute determines the frame.
3. If neither the element nor the BASE element refers to a target, the resource designated by the element
should be loaded into the frame containing the element.
4. If any target attribute refers to an unknown frame F, the user agent should create a new window
and frame, assign the name F to the frame, and load the resource designated by the element in the
new frame.

User agents may provide users with a mechanism to override the target attribute.

16.4 Alternate content


Authors should supply alternate content for those user agents that do not support frames or are configured
not to display frames.

16.4.1 The NOFRAMES element


<![ %[Link]; [
<!ENTITY % [Link] "(BODY) -(NOFRAMES)">
]]>

<!ENTITY % [Link] "(%flow;)*">

<!ELEMENT NOFRAMES - - %[Link];


-- alternate content container for non frame-based rendering -->
<!ATTLIST NOFRAMES
%attrs; -- %coreattrs, %i18n, %events --
>

The NOFRAMES element specifies content that should be displayed only when frames are not being
displayed. User agents that support frames must only display the contents of a NOFRAMES declaration
when configured not to display frames. User agents that do not support frames must display the contents
of NOFRAMES in any case.

NOFRAMES can be used in the FRAMESET section of a frameset document.

For example:

202
16.4.2 Long descriptions of frames

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A frameset document with NOFRAMES</TITLE>
</HEAD>
<FRAMESET cols="50%, 50%">
<FRAME src="[Link]">
<FRAME src="table_of_contents.html">
<NOFRAMES>
<P>Here is the <A href="[Link]">
non-frame based version of the document.</A>
</NOFRAMES>
</FRAMESET>
</HTML>

16.4.2 Long descriptions of frames


The longdesc attribute allows authors to make frame documents more accessible to people using
non-visual user agents. This attribute designates a resource that provides a long description of the frame.
Authors should note that long descriptions associated with frames are attached to the frame, not the
frame’s contents. Since the contents may vary over time, the initial long description is likely to become
inappropriate for the frame’s later contents. In particular, authors should not include an image as the sole
content of a frame.

The following frameset document describes two frames. The left frame contains a table of contents and
the right frame initially contains an image of an ostrich:
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A poorly-designed frameset document</TITLE>
</HEAD>
<FRAMESET cols="20%, 80%">
<FRAME src="table_of_contents.html">
<FRAME src="[Link]" longdesc="[Link]">
</FRAMESET>
</HTML>

Note that the image has been included in the frame independently of any HTML element, so the author
has no means of specifying alternate text other than via the longdesc attribute. If the contents of the
right frame change (e.g., the user selects a rattlesnake from the table of contents), users will have no
textual access to the frame’s new content.

Thus, authors should not put an image directly in a frame. Instead, the image should be specified in a
separate HTML document, and therein annotated with the appropriate alternate text:

203
16.5 Inline frames: the IFRAME element

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A well-designed frameset document</TITLE>
</HEAD>
<FRAMESET cols="20%, 80%">
<FRAME src="table_of_contents.html">
<FRAME src="[Link]">
</FRAMESET>
</HTML>

<!-- In [Link]: -->


<HTML>
<HEAD>
<TITLE>The fast and powerful ostrich</TITLE>
</HEAD>
<P>
<OBJECT data="[Link]" type="image/gif">
These ostriches sure taste good!
</OBJECT>
</HTML>

16.5 Inline frames: the IFRAME element


<!ELEMENT IFRAME - - (%flow;)* -- inline subwindow -->
<!ATTLIST IFRAME
%coreattrs; -- id, class, style, title --
longdesc %URI; #IMPLIED -- link to long description
(complements title) --
name CDATA #IMPLIED -- name of frame for targetting --
src %URI; #IMPLIED -- source of frame content --
frameborder (1|0) 1 -- request frame borders? --
marginwidth %Pixels; #IMPLIED -- margin widths in pixels --
marginheight %Pixels; #IMPLIED -- margin height in pixels --
scrolling (yes|no|auto) auto -- scrollbar or none --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --
height %Length; #IMPLIED -- frame height --
width %Length; #IMPLIED -- frame width --
>

Attribute definitions

longdesc = uri [p.44] [CT] [p.43]


This attribute specifies a link to a long description of the frame. This description should supplement
the short description provided using the title attribute, and is particularly useful for non-visual
user agents.
name = cdata [p.44] [CI] [p.43]
This attribute assigns a name to the current frame. This name may be used as the target of subsequent
links.
width = length [p.46] [CN] [p.43]
The width of the inline frame.

204
16.5 Inline frames: the IFRAME element

height = length [p.46] [CN] [p.43]


The height of the inline frame.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


title (element title [p.57] )
style (inline style information [p.174] )
name, src, frameborder, marginwidth, marginheight, scrolling (frame controls and
decoration [p.197] )
target (target frame information [p.200] )
align (alignment [p.183] )

The IFRAME element allows authors to insert a frame within a block of text. Inserting an inline frame
within a section of text is much like inserting an object via the OBJECT element: they both allow you to
insert an HTML document in the middle of another, they may both be aligned with surrounding text, etc.

The information to be inserted inline is designated by the src attribute of this element. The contents of
the IFRAME element, on the other hand, should only be displayed by user agents that do not support
frames or are configured not to display frames.

For user agents that support frames, the following example will place an inline frame surrounded by a
border in the middle of the text.
<IFRAME src="[Link]" width="400" height="500"
scrolling="auto" frameborder="1">
[Your user agent does not support frames or is currently configured
not to display frames. However, you may visit
<A href="[Link]">the related document.</A>]
</IFRAME>

Inline frames may not be resized (and thus, they do not take the noresize attribute).

Note. HTML documents may also be embedded in other HTML documents with the OBJECT element. See
the section on embedded documents [p.162] for details.

205
16.5 Inline frames: the IFRAME element

206
17 Forms

17 Forms
Contents

1. Introduction to forms . . . . . . . . . . . . . . . . . 207


.
2. Controls . . . . . . . . . . . . . . . . . . . . 208
.
1. Control types . . . . . . . . . . . . . . . . . 208
.
3. The FORM element . . . . . . . . . . . . . . . . . 210
.
4. The INPUT element . . . . . . . . . . . . . . . . . 211
.
1. Control types created with INPUT . . . . . . . . . . . . . 213
.
2. Examples of forms containing INPUT controls . . . . . . . . . . 214
.
5. The BUTTON element . . . . . . . . . . . . . . . . . 215
.
6. The SELECT, OPTGROUP, and OPTION elements . . . . . . . . . . 217
.
1. Preselected options . . . . . . . . . . . . . . . . 218
.
7. The TEXTAREA element . . . . . . . . . . . . . . . . 221
.
8. The ISINDEX element . . . . . . . . . . . . . . . . 223
.
9. Labels . . . . . . . . . . . . . . . . . . . . 223
.
1. The LABEL element . . . . . . . . . . . . . . . . 224
.
10. Adding structure to forms: the FIELDSET and LEGEND elements . . . . . . . 225
.
11. Giving focus to an element . . . . . . . . . . . . . . . 227
.
1. Tabbing navigation . . . . . . . . . . . . . . . . 228
.
2. Access keys . . . . . . . . . . . . . . . . . . 229
.
12. Disabled and read-only controls . . . . . . . . . . . . . . 230
.
1. Disabled controls . . . . . . . . . . . . . . . . 230
.
2. Read-only controls . . . . . . . . . . . . . . . . 231
.
13. Form submission . . . . . . . . . . . . . . . . . . 231
.
1. Form submission method . . . . . . . . . . . . . . . 231
.
2. Successful controls . . . . . . . . . . . . . . . . 232
.
3. Processing form data . . . . . . . . . . . . . . . . 233
.
Step one: Identify the successful controls . . . . . . . . . . 233
.
Step two: Build a form data set . . . . . . . . . . . . 233
.
Step three: Encode the form data set . . . . . . . . . . . 233
.
Step four: Submit the encoded form data set . . . . . . . . . . 233
.
4. Form content types . . . . . . . . . . . . . . . . 234
.
application/x-www-form-urlencoded . . . . . . . . . . . 234
.
multipart/form-data . . . . . . . . . . . . . . . 234
.

17.1 Introduction to forms


An HTML form is a section of a document containing normal content, markup, special elements called
controls [p.208] (checkboxes, radio buttons, menus, etc.), and labels on those controls. Users generally
"complete" a form by modifying its controls (entering text selecting menu items, etc.), before submitting
the form to an agent for processing (e.g., to a Web server, to a mail server, etc.)

207
17.2 Controls

Here’s a simple form that includes labels, radio buttons, and push buttons (reset the form or submit it):
<FORM action="[Link] method="post">
<P>
<LABEL for="firstname">First name: </LABEL>
<INPUT type="text" id="firstname"><BR>
<LABEL for="lastname">Last name: </LABEL>
<INPUT type="text" id="lastname"><BR>
<LABEL for="email">email: </LABEL>
<INPUT type="text" id="email"><BR>
<INPUT type="radio" name="sex" value="Male"> Male<BR>
<INPUT type="radio" name="sex" value="Female"> Female<BR>
<INPUT type="submit" value="Send"> <INPUT type="reset">
</P>
</FORM>

Note. This specification includes more detailed information about forms in the subsections on form
display issues [p.322] .

17.2 Controls
Users interact with forms through named controls.

A control’s "control name" is given by its name attribute. The scope of the name attribute for a control
within a FORM element is the FORM element.

Each control has both an initial value and a current value, both of which are character strings. Please
consult the definition of each control for information about initial values and possible constraints on
values imposed by the control. In general, a control’s "initial value" may be specified with the control
element’s value attribute. However, the initial value of a TEXTAREA element is given by its contents,
and the initial value of an OBJECT element in a form is determined by the object implementation (i.e., it
lies outside the scope of this specification).

The control’s "current value" is first set to the initial value. Thereafter, the control’s current value may be
modified through user interaction and scripts. [p.237]

A control’s initial value does not change. Thus, when a form is reset, each control’s current value is reset
to its initial value. If a control does not have an initial value, the effect of a form reset on that control is
undefined.

When a form is submitted for processing, some controls have their name paired with their current value
and these pairs are submitted [p.231] with the form. Those controls for which name/value pairs are
submitted are called successful controls [p.232] .

17.2.1 Control types


HTML defines the following control types:

208
17.2.1 Control types

buttons
Authors may create three types of buttons:
submit buttons: When activated, a submit button submits a form. [p.231] A form may contain
more than one submit button.
reset buttons: When activated, a reset button resets all controls to their initial values. [p.208]
push buttons: Push buttons have no default behavior. Each push button may have client-side
scripts [p.237] associated with the element’s event [p.240] attributes. When an event occurs
(e.g., the user presses the button, releases it, etc.), the associated script is triggered.

Authors should specify the scripting language of a push button script through a default script
declaration [p.239] (with the META element).

Authors create buttons with the BUTTON element or the INPUT element. Please consult the
definitions of these elements for details about specifying different button types.

Note. Authors should note that the BUTTON element offers richer rendering capabilities than the
INPUT element.
checkboxes
Checkboxes (and radio buttons) are on/off switches that may be toggled by the user. A switch is "on"
when the control element’s selected attribute is set.

When a form is submitted, only "on" checkbox controls can become successful [p.232] . Several
checkboxes in a form may share the same control name. [p.208] Thus, for example, checkboxes
allow users to select several values for the same property. The INPUT element is used to create a
checkbox control.
radio buttons
Radio buttons are like checkboxes except that when several share the same control name [p.208] ,
they are mutually exclusive: when one is switched "on", all others with the same name are switched
"off". The INPUT element is used to create a radio button control.
menus
Menus offer users options from which to choose. The SELECT element creates a menu, in
combination with the OPTGROUP and OPTION elements.
text input
Authors may create two types of controls that allow users to input text. The INPUT element creates a
single-line input control and the TEXTAREA element creates a multi-line input control. In both cases,
the input text becomes the control’s current value [p.208] .
file select
This control type allows the user to select files so that their contents may be submitted with a form.
The INPUT element is used to create a file select control.
hidden controls
Authors may create controls that are not rendered but whose values are submitted with a form.
Authors generally use this control type to store information between client/server exchanges that
would otherwise be lost due to the stateless nature of HTTP (see [RFC2068] [p.328] ). The INPUT
element is used to create a hidden control.
object controls
Authors may insert generic objects in forms such that associated values are submitted along with
other controls. Authors create object controls with the OBJECT element.

209
17.3 The FORM element

The elements used to create controls generally appear inside a FORM element, but may also appear outside
of a FORM element declaration when they are used to build user interfaces. This is discussed in the section
on intrinsic events. [p.240] Note that controls outside a form cannot be successful controls [p.232] .

17.3 The FORM element


<!ELEMENT FORM - - (%block;|SCRIPT)+ -(FORM) -- interactive form -->
<!ATTLIST FORM
%attrs; -- %coreattrs, %i18n, %events --
action %URI; #REQUIRED -- server-side form handler --
method (GET|POST) GET -- HTTP method used to submit the form--
enctype %ContentType; "application/x-www-form-urlencoded"
onsubmit %Script; #IMPLIED -- the form was submitted --
onreset %Script; #IMPLIED -- the form was reset --
accept-charset %Charsets; #IMPLIED -- list of supported charsets --
>

Start tag: required, End tag: required

Attribute definitions

action = uri [p.44] [CT] [p.43]


This attribute specifies a form processing agent. For example, the value might be a HTTP URI (to
submit the form to a program) or a mailto URI (to email the form).
method = get|post [CI] [p.43]
This attribute specifies which HTTP method will be used to submit the form data set [p.233] .
Possible (case-insensitive) values are "get" (the default) and "post". See the section on form
submission [p.231] for usage information.
enctype = content-type [p.46] [CI] [p.43]
This attribute specifies the content type [p.234] used to submit the form to the server (when the value
of method is "post"). The default value for this attribute is "application/x-www-form-urlencoded".
The value "multipart/form-data" should be used in combination with the INPUT element,
type="file".
accept-charset = charset list [p.47] [CI] [p.43]
This attribute specifies the list of character encodings [p.37] for input data that must be accepted by
the server processing this form. The value is a space- and/or comma-delimited list of charset [p.47]
values. The server must interpret this list as an exclusive-or list, i.e., the server must be able to accept
any single character encoding per entity received.

The default value for this attribute is the reserved string "UNKNOWN". User agents may interpret
this value as the character encoding that was used to transmit the document containing this FORM
element.
accept = content-type-list [p.46] [CI] [p.43]
This attribute specifies a comma-separated list of content types that a server processing this form will
handle correctly. User agents may use this information to filter out non-conforming files when
prompting a user to select files to be sent to the server (cf. the INPUT element when type="file").

210
17.4 The INPUT element

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
style (inline style information [p.174] )
title (element title [p.57] )
target (target frame information [p.200] )
onsubmit, onreset, onclick, ondblclick, onmousedown, onmouseup,
onmouseover, onmousemove, onmouseout, onkeypress, onkeydown, onkeyup
(intrinsic events [p.240] )

The FORM element acts as a container for controls [p.208] . It specifies:

The layout of the form (given by the contents of the element).


The program that will handle the completed and submitted form (the action attribute). The
receiving program must be able to parse name/value pairs in order to make use of them.
The method by which user data will be sent to the server (the method attribute).
A character encoding that must be accepted by the server in order to handle this form (the
accept-charset attribute). User agents may advise the user of the value of the
accept-charset attribute and/or restrict the user’s ability to enter unrecognized characters.

A form can contain text and markup (paragraphs, lists, etc.) in addition to form controls. [p.208]

The following example shows a form that is to be processed by the "adduser" program when submitted.
The form will be sent to the program using the HTTP "post" method.
<FORM action="[Link] method="post">
...form contents...
</FORM>

The next example shows how to send a submitted form to an email address:
<FORM action="[Link] method="post">
...form contents...
</FORM>

Please consult the section on form submission [p.231] for information about how user agents must prepare
form data for servers and how user agents should handle expected responses.

Note. Further discussion on the behavior of servers that receive form data is beyond the scope of this
specification.

17.4 The INPUT element


<!ENTITY % InputType
"(TEXT | PASSWORD | CHECKBOX |
RADIO | SUBMIT | RESET |
FILE | HIDDEN | IMAGE | BUTTON)"
>

211
17.4 The INPUT element

<!-- attribute name required for all but submit & reset -->
<!ELEMENT INPUT - O EMPTY -- form control -->
<!ATTLIST INPUT
%attrs; -- %coreattrs, %i18n, %events --
type %InputType; TEXT -- what kind of widget is needed --
name CDATA #IMPLIED -- submit as part of form --
value CDATA #IMPLIED -- required for radio and checkboxes --
checked (checked) #IMPLIED -- for radio buttons and check boxes --
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED -- for text and passwd --
size CDATA #IMPLIED -- specific to each type of field --
maxlength NUMBER #IMPLIED -- max chars for text fields --
src %URI; #IMPLIED -- for fields with images --
alt CDATA #IMPLIED -- short description --
usemap %URI; #IMPLIED -- use client-side image map --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
accept %ContentTypes; #IMPLIED -- list of MIME types for file upload --
>

Start tag: required, End tag: forbidden

Attribute definitions

type =
text|password|checkbox|radio|submit|reset|file|hidden|image|button [CI]
[p.43]
This attribute specifies the type of control [p.213] to create. The default value for this attribute is
"text".
name = cdata [p.44] [CI] [p.43]
This attribute assigns the control name [p.208] .
value = cdata [p.44] [CA] [p.43]
This attribute specifies the initial value [p.208] of the control. It is optional except when the type
attribute has the value "radio".
size = cdata [p.44] [CN] [p.43]
This attribute tells the user agent the initial width of the control. The width is given in pixels [p.46]
except when type attribute has the value "text" or "password". In that case, its value refers to the
(integer) number of characters.
maxlength = number [p.44] [CN] [p.43]
When the type attribute has the value "text" or "password", this attribute specifies the maximum
number of characters the user may enter. This number may exceed the specified size, in which case
the user agent should offer a scrolling mechanism. The default value for this attribute is an unlimited
number.
checked [CI] [p.43]
When the type attribute has the value "radio" or "checkbox", this boolean attribute specifies that the
button is on. User agents must ignore this attribute for other control types.

212
17.4.1 Control types created with INPUT

src = uri [p.44] [CT] [p.43]


When the type attribute has the value "image", this attribute specifies the location of the image to
be used to decorate the graphical submit button.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
alt (alternate text [p.169] )
align (alignment [p.183] )
accept (legal content types for a server [p.210] )
readonly (read-only input controls [p.231] )
disabled (disabled input controls [p.230] )
tabindex (tabbing navigation [p.228] )
accesskey (access keys [p.229] )
usemap (client-side image maps [p.163] )
onfocus, onblur, onselect, onchange, onclick, ondblclick, onmousedown,
onmouseup, onmouseover, onmousemove, onmouseout, onkeypress, onkeydown,
onkeyup (intrinsic events [p.240] )

17.4.1 Control types created with INPUT


The control type [p.208] defined by the INPUT element depends on the value of the type attribute:

text
Creates a single-line text input [p.209] control.
password
Like "text", but the input text is rendered in such a way as to hide the characters (e.g., a series of
asterisks). This control type is often used for sensitive input such as passwords. Note that the current
value [p.208] is the text entered by the user, not the text rendered by the user agent.

Note. Application designers should note that this mechanism affords only light security protection.
Although the password is masked by user agents from casual observers, it is transmitted to the server
in clear text, and may be read by anyone with low-level access to the network.
checkbox
Creates a checkbox. [p.209]
radio
Creates a radio button. [p.209]
submit
Creates a submit button. [p.209]
image
Creates a graphical submit button. [p.209] The value of the src attribute specifies the URI of the
image that will decorate the button. For accessibility reasons, authors should provide alternate text
[p.169] for the image via the alt attribute.

213
17.4.2 Examples of forms containing INPUT controls

When a pointing device is used to click on the image, the form is submitted and the click coordinates
passed to the server. The x value is measured in pixels [p.46] from the left of the image, and the y
value in pixels [p.46] from the top of the image. The submitted data includes name.x=x-value and
name.y=y-value where "name" is the value of the name attribute, and x-value and y-value are the x
and y coordinate values, respectively.

If the server takes different actions depending on the location clicked, users of non-graphical
browsers will be disadvantaged. For this reason, authors should consider alternate approaches:

Use multiple submit buttons (each with its own image) in place of a single graphical submit
button. Authors may use style sheets to control the positioning of these buttons.
Use a client-side image map [p.162] together with scripting.
reset
Creates a reset button. [p.209]
button
Creates a push button. [p.209] User agents should use the value of the value attribute as the
button’s label.
hidden
Creates a hidden control. [p.209]
file
Creates a file select [p.209] control. User agents may use the value of the value attribute as the
initial file name.

17.4.2 Examples of forms containing INPUT controls


The following sample HTML fragment defines a simple form that allows the user to enter a first name,
last name, email address, and gender. When the submit button is activated, the form will be sent to the
program specified by the action attribute.
<FORM action="[Link] method="post">
<P>
First name: <INPUT type="text" name="firstname"><BR>
Last name: <INPUT type="text" name="lastname"><BR>
email: <INPUT type="text" name="email"><BR>
<INPUT type="radio" name="sex" value="Male"> Male<BR>
<INPUT type="radio" name="sex" value="Female"> Female<BR>
<INPUT type="submit" value="Send"> <INPUT type="reset">
</P>
</FORM>

This form might be rendered as follows:

214
17.5 The BUTTON element

In the section on the LABEL element, we discuss marking up labels such as "First name".

In this next example, the JavaScript function name verify is triggered when the "onclick" event occurs:
<HEAD>
<META http-equiv="Content-Script-Type" content="text/javascript">
</HEAD>
<BODY>
<FORM action="..." method="post">
<P>
<INPUT type="button" value="Click Me" onclick="verify()">
</FORM>
</BODY>

Please consult the section on intrinsic events [p.240] for more information about scripting and events.

The following example shows how the contents of a user-specified file may be submitted with a form. The
user is prompted for his or her name and a list of file names whose contents should be submitted with the
form. By specifying the enctype value of "multipart/form-data", each file’s contents will be packaged
for submission in a separate section of a multipart document.
<FORM action="[Link]
enctype="multipart/form-data"
method="post">
<P>
What is your name? <INPUT type="text" name="name_of_sender">
What files are you sending? <INPUT type="file" name="name_of_files">
</P>
</FORM>

17.5 The BUTTON element


<!ELEMENT BUTTON - -
(%flow;)* -(A|%formctrl;|FORM|FIELDSET)
-- push button -->
<!ATTLIST BUTTON
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED

215
17.5 The BUTTON element

value CDATA #IMPLIED -- sent to server when submitted --


type (button|submit|reset) submit -- for use as form button --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

Start tag: required, End tag: required

Attribute definitions

name = cdata [p.44] [CI] [p.43]


This attribute assigns the control name. [p.208]
value = cdata [p.44] [CS] [p.43]
This attribute assigns the initial value [p.208] to the button.
type = submit|button|reset [CI] [p.43]
This attribute declares the type of the button. Possible values:
submit: Creates a submit button. [p.209] This is the default value.
reset: Creates a reset button. [p.209]
button: Creates a push button. [p.209]

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
disabled (disabled input controls [p.230] )
accesskey (access keys [p.229] )
tabindex (tabbing navigation [p.228] )
onfocus, onblur, onclick, ondblclick, onmousedown, onmouseup, onmouseover,
onmousemove, onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

Buttons created with the BUTTON element function just like buttons created with the INPUT element, but
they offer richer rendering possibilities: the BUTTON element may have content. For example, a BUTTON
element that contains an image functions like and may resemble an INPUT element whose type is set to
"image", but the BUTTON element type allows content.

Visual user agents may render BUTTON buttons with relief and an up/down motion when clicked, while
they may render INPUT buttons as a "flat" images.

The following example expands a previous example, but creates submit [p.209] and reset [p.209] buttons
with BUTTON instead of INPUT. The buttons contain images by way of the IMG element.

216
17.6 The SELECT, OPTGROUP, and OPTION elements

<FORM action="[Link] method="post">


<P>
First name: <INPUT type="text" name="firstname"><BR>
Last name: <INPUT type="text" name="lastname"><BR>
email: <INPUT type="text" name="email"><BR>
<INPUT type="radio" name="sex" value="Male"> Male<BR>
<INPUT type="radio" name="sex" value="Female"> Female<BR>
<BUTTON name="submit" value="submit" type="submit">
Send<IMG src="/icons/[Link]" alt="wow"></BUTTON>
<BUTTON name="reset" type="reset">
Reset<IMG src="/icons/[Link]" alt="oops"></BUTTON>
</P>
</FORM>

Recall that authors must provide alternate text [p.169] for an IMG element.

It is illegal to associate an image map with an IMG that appears as the contents of a BUTTON element.

ILLEGAL EXAMPLE:
The following is not legal HTML.
<BUTTON>
<IMG src="[Link]" usemap="...">
</BUTTON>

17.6 The SELECT, OPTGROUP, and OPTION elements


<!ELEMENT SELECT - - (OPTGROUP|OPTION)+ -- option selector -->
<!ATTLIST SELECT
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED -- field name --
size NUMBER #IMPLIED -- rows visible --
multiple (multiple) #IMPLIED -- default is single selection --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onchange %Script; #IMPLIED -- the element value was changed --
>

Start tag: required, End tag: required

SELECT Attribute definitions

name = cdata [p.44] [CI] [p.43]


This attribute assigns the control name. [p.208]
size = number [p.44] [CN] [p.43]
If a SELECT element is presented as a scrolled list box, this attribute specifies the number of rows in
the list that should be visible at the same time. Visual user agents are not required to present a
SELECT element as a list box; they may use any other mechanism, such as a drop-down menu.
multiple [CI] [p.43]
If set, this boolean attribute allows multiple selections. If not set, the SELECT element only permits

217
17.6.1 Preselected options

single selections.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
disabled (disabled input controls [p.230] )
tabindex (tabbing navigation [p.228] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The SELECT element creates a menu [p.209] . Each choice offered by the menu is represented by an
OPTION element. A SELECT element must contain at least one OPTION element.

The OPTGROUP element allows authors to group choices logically. This is particularly helpful when the
user must choose from a long list of options; groups of related choices are easier to grasp and remember
than a single long list of options. In HTML 4.0, all OPTGROUP elements must be specified directly within
a SELECT element (i.e., groups may not be nested).

17.6.1 Preselected options


Zero or more choices may be pre-selected for the user. User agents should determine which choices are
pre-selected as follows:

If no OPTION element has the selected attribute set, no options should be pre-selected.
If one OPTION element has the selected attribute set, it should be pre-selected.
If the SELECT element has the multiple attribute set and more than one OPTION element has the
selected attribute set, they should all be pre-selected.
It is considered an error if more than one OPTION element has the selected attribute set and the
SELECT element does not have the multiple attribute set. User agents may vary in how they
handle this error, but should not pre-select more than one choice.
<!ELEMENT OPTGROUP - - (OPTION)+ -- option group -->
<!ATTLIST OPTGROUP
%attrs; -- %coreattrs, %i18n, %events --
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #REQUIRED -- for use in hierarchical menus --
>

Start tag: required, End tag: required

OPTGROUP Attribute definitions

label = text [p.44] [CS] [p.43]


This attribute specifies the label for the option group.

218
17.6.1 Preselected options

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
disabled (disabled input controls [p.230] )
onfocus, onblur, onchange, onclick, ondblclick, onmousedown, onmouseup,
onmouseover, onmousemove, onmouseout, onkeypress, onkeydown, onkeyup
(intrinsic events [p.240] )

Note. Implementors are advised that future versions of HTML may extend the grouping mechanism to
allow for nested groups (i.e., OPTGROUP elements may nest). This will allow authors to represent a richer
hierarchy of choices.
<!ELEMENT OPTION - O (#PCDATA) -- selectable choice -->
<!ATTLIST OPTION
%attrs; -- %coreattrs, %i18n, %events --
selected (selected) #IMPLIED
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #IMPLIED -- for use in hierarchical menus --
value CDATA #IMPLIED -- defaults to element content --
>

Start tag: required, End tag: optional

OPTION Attribute definitions

selected [CI] [p.43]


When set, this boolean attribute specifies that this option is pre-selected.
value = cdata [p.44] [CS] [p.43]
This attribute specifies the initial value [p.208] of the control. If this attribute is not set, the initial
value [p.208] is set to the contents of the OPTION element.
label = text [p.44] [CS] [p.43]
This attribute allows authors to specify a shorter label for an option than the content of the OPTION
element. When specified, user agents should use the value of this attribute rather than the content of
the OPTION element as the option label.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
disabled (disabled input controls [p.230] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

219
17.6.1 Preselected options

When rendering a menu choice, user agents should use the value of the label attribute of the OPTION
element as the choice. If this attribute is not specified, user agents should use the contents of the OPTION
element.

The label attribute of the OPTGROUP element specifies the label for a group of choices.

In this example, we create a menu that allows the user to select which of seven software components to
install. The first and second components are pre-selected but may be deselected by the user. The
remaining components are not pre-selected. The size attribute states that the menu should only have 4
rows even though the user may select from among 7 options. The other options should be made available
through a scrolling mechanism.

The SELECT is followed by submit and reset buttons.


<FORM action="[Link] method="post">
<P>
<SELECT multiple size="4" name="component-select">
<OPTION selected value="Component_1_a">Component_1</OPTION>
<OPTION selected value="Component_1_b">Component_2</OPTION>
<OPTION>Component_3</OPTION>
<OPTION>Component_4</OPTION>
<OPTION>Component_5</OPTION>
<OPTION>Component_6</OPTION>
<OPTION>Component_7</OPTION>
</SELECT>
<INPUT type="submit" value="Send"><INPUT type="reset">
</P>
</FORM>

Only selected options will be successful [p.232] (using the control name [p.208] "component-select").
Note that where the value attribute is set, it determines the control’s initial value [p.208] , otherwise it’s
the element’s contents.

In this example we use the OPTGROUP element to group choices. The following markup:
<FORM action="[Link] method="post">
<P>
<SELECT name="ComOS">
<OPTGROUP label="PortMaster 3">
<OPTION label="3.7.1" value="pm3_3.7.1">PortMaster 3 with ComOS 3.7.1
<OPTION label="3.7" value="pm3_3.7">PortMaster 3 with ComOS 3.7
<OPTION label="3.5" value="pm3_3.5">PortMaster 3 with ComOS 3.5
</OPTGROUP>
<OPTGROUP label="PortMaster 2">
<OPTION label="3.7" value="pm2_3.7">PortMaster 2 with ComOS 3.7
<OPTION label="3.5" value="pm2_3.5">PortMaster 2 with ComOS 3.5
</OPTGROUP>
<OPTGROUP label="IRX">
<OPTION label="3.7R" value="IRX_3.7R">IRX with ComOS 3.7R
<OPTION label="3.5R" value="IRX_3.5R">IRX with ComOS 3.5R
</OPTGROUP>
</SELECT>
</FORM>

220
17.7 The TEXTAREA element

represents the following grouping:


PortMaster 3
3.7.1
3.7
3.5
PortMaster 2
3.7
3.5
IRX
3.7R
3.5R

Visual user agents may allow users to select from option groups through a hierarchical menu or some
other mechanism that reflects the structure of choices.

A graphical user agent might render this as:

This image shows a SELECT element rendered as cascading menus. The top label of the menu displays
the currently selected value (PortMaster 3, 3.7.1). The user has unfurled two cascading menus, but has not
yet selected the new value (PortMaster 2, 3.7). Note that each cascading menu displays the label of an
OPTGROUP or OPTION element.

17.7 The TEXTAREA element


<!ELEMENT TEXTAREA - - (#PCDATA) -- multi-line text field -->
<!ATTLIST TEXTAREA
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED
rows NUMBER #REQUIRED
cols NUMBER #REQUIRED
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
>

Start tag: required, End tag: required

221
17.7 The TEXTAREA element

Attribute definitions

name = cdata [p.44] [CI] [p.43]


This attribute assigns the control name. [p.208]
rows = number [p.44] [CN] [p.43]
This attribute specifies the number of visible text lines. Users should be able to enter more lines than
this, so user agents should provide some means to scroll through the contents of the control when the
contents extend beyond the visible area.
cols = number [p.44] [CN] [p.43]
This attribute specifies the visible width in average character widths. Users should be able to enter
longer lines than this, so user agents should provide some means to scroll through the contents of the
control when the contents extend beyond the visible area. User agents may wrap visible text lines to
keep long lines visible without the need for scrolling.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
readonly (read-only input controls [p.231] )
disabled (disabled input controls [p.230] )
tabindex (tabbing navigation [p.228] )
onfocus, onblur, onselect, onchange, onclick, ondblclick, onmousedown,
onmouseup, onmouseover, onmousemove, onmouseout, onkeypress, onkeydown,
onkeyup (intrinsic events [p.240] )

The TEXTAREA element creates a multi-line text input [p.209] control. User agents should use the
contents of this element as the initial value [p.208] of the control and should render this text initially.

This example creates a TEXTAREA control that is 20 rows by 80 columns and contains two lines of text
initially. The TEXTAREA is followed by submit and reset buttons.
<FORM action="[Link] method="post">
<P>
<TEXTAREA name="thetext" rows="20" cols="80">
First line of initial text.
Second line of initial text.
</TEXTAREA>
<INPUT type="submit" value="Send"><INPUT type="reset">
</P>
</FORM>

Setting the readonly attribute allows authors to display unmodifiable text in a TEXTAREA. This differs
from using standard marked-up text in a document because the value of TEXTAREA is submitted with the
form.

222
17.8 The ISINDEX element

17.8 The ISINDEX element


ISINDEX is deprecated [p.34] . This element creates a single-line text input [p.209] control. Authors
should use the INPUT element to create text input [p.209] controls.

See the Transitional DTD [p.285] for the formal definition.

Attribute definitions

prompt = text [p.44] [CS] [p.43]


Deprecated. [p.34] This attribute specifies a prompt string for the input field.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )

The ISINDEX element creates a single-line text input [p.209] control that allows any number of
characters. User agents may use the value of the prompt attribute as a title for the prompt.

DEPRECATED EXAMPLE:
The following ISINDEX declaration:
<ISINDEX prompt="Enter your search phrase: ">

could be rewritten with INPUT as follows:


<FORM action="..." method="post">
<P>Enter your search phrase: <INPUT type="text"></P>
</FORM>

Semantics of ISINDEX. Currently, the semantics for ISINDEX are only well-defined when the base
URI for the enclosing document is an HTTP URI. In practice, the input string is restricted to Latin-1 as
there is no mechanism for the URI to specify a different character set.

17.9 Labels
Some form controls automatically have labels associated with them (press buttons) while most do not (text
fields, checkboxes and radio buttons, and menus).

For those controls that have implicit labels, user agents should use the value of the value attribute as the
label string.

The LABEL element is used to specify labels for controls that do not have implicit labels,

223
17.9.1 The LABEL element

17.9.1 The LABEL element


<!ELEMENT LABEL - - (%inline;)* -(LABEL) -- form field label text -->
<!ATTLIST LABEL
%attrs; -- %coreattrs, %i18n, %events --
for IDREF #IMPLIED -- matches field ID value --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

Start tag: required, End tag: required

Attribute definitions

for = idref [p.44] [CS] [p.43]


This attribute explicitly associates the label being defined with another control. When present, the
value of this attribute must be the same as the value of the id attribute of some other control in the
same document. When absent, the label being defined is associated with the element’s contents.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
accesskey (access keys [p.229] )
onfocus, onblur, onclick, ondblclick, onmousedown, onmouseup, onmouseover,
onmousemove, onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The LABEL element may be used to attach information to controls. Each LABEL element is associated
with exactly one form control.

The for attribute associates a label with another control explicitly: the value of the for attribute must be
the same as the value of the id attribute of the associated control element. More than one LABEL may be
associated with the same control by creating multiple references via the for attribute.

This example creates a table that is used to align two text input [p.209] controls and their associated
labels. Each label is associated explicitly with one text input [p.209] :
<FORM action="..." method="post">
<TABLE>
<TR>
<TD><LABEL for="fname">First Name</LABEL>
<TD><INPUT type="text" name="firstname" id="fname">
<TR>
<TD><LABEL for="lname">Last Name</LABEL>
<TD><INPUT type="text" name="lastname" id="lname">
</TABLE>
</FORM>

224
17.10 Adding structure to forms: the FIELDSET and LEGEND elements

This example extends a previous example form to include LABEL elements.


<FORM action="[Link] method="post">
<P>
<LABEL for="firstname">First name: </LABEL>
<INPUT type="text" id="firstname"><BR>
<LABEL for="lastname">Last name: </LABEL>
<INPUT type="text" id="lastname"><BR>
<LABEL for="email">email: </LABEL>
<INPUT type="text" id="email"><BR>
<INPUT type="radio" name="sex" value="Male"> Male<BR>
<INPUT type="radio" name="sex" value="Female"> Female<BR>
<INPUT type="submit" value="Send"> <INPUT type="reset">
</P>
</FORM>

To associate a label with another control implicitly, the control element must be within the contents of the
LABEL element. In this case, the LABEL may only contain one control element. The label itself may be
positioned before or after the associated control.

In this example, we implicitly associate two labels with two text input [p.209] controls:
<FORM action="..." method="post">
<P>
<LABEL>
First Name
<INPUT type="text" name="firstname">
</LABEL>
<LABEL>
<INPUT type="text" name="lastname">
Last Name
</LABEL>
</P>
</FORM>

Note that this technique cannot be used when a table is being used for layout, with the label in one cell and
its associated control in another cell.

When a LABEL element receives focus [p.227] , it passes the focus on to its associated control. See the
section below on access keys [p.229] for examples.

Labels may be rendered by user agents in a number of ways (e.g., visually, read by speech synthesizers,
etc.)

17.10 Adding structure to forms: the FIELDSET and LEGEND


elements
<!--
#PCDATA is to solve the mixed content problem,
per specification only whitespace is allowed there!
-->
<!ELEMENT FIELDSET - - (#PCDATA,LEGEND,(%flow;)*) -- form control group -->

225
17.10 Adding structure to forms: the FIELDSET and LEGEND elements

<!ATTLIST FIELDSET
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT LEGEND - - (%inline;)* -- fieldset legend -->


<!ENTITY % LAlign "(top|bottom|left|right)">

<!ATTLIST LEGEND
%attrs; -- %coreattrs, %i18n, %events --
accesskey %Character; #IMPLIED -- accessibility key character --
>

Start tag: required, End tag: required

LEGEND Attribute definitions

align = top|bottom|left|right [CI] [p.43]


Deprecated. [p.34] This attribute specifies the position of the legend with respect to the fieldset.
Possible values:
top: The legend is at the top of the fieldset. This is the default value.
bottom: The legend is at the bottom of the fieldset.
left: The legend is at the left side of the fieldset.
right: The legend is at the right side of the fieldset.

Attributes defined elsewhere

id, class (document-wide identifiers [p.65] )


lang (language information [p.71] ), dir (text direction [p.73] )
title (element title [p.57] )
style (inline style information [p.174] )
accesskey (access keys [p.229] )
onclick, ondblclick, onmousedown, onmouseup, onmouseover, onmousemove,
onmouseout, onkeypress, onkeydown, onkeyup (intrinsic events [p.240] )

The FIELDSET element allows authors to group thematically related controls and labels. Grouping
controls makes it easier for users to understand their purpose while simultaneously facilitating tabbing
navigation for visual user agents and speech navigation for speech-oriented user agents. The proper use of
this element makes documents more accessible.

The LEGEND element allows authors to assign a caption to a FIELDSET. The legend improves
accessibility when the FIELDSET is rendered non-visually.

In this example, we create a form that one might fill out at the doctor’s office. It is divided into three
sections: personal information, medical history, and current medication. Each section contains controls for
inputting the appropriate information.
<FORM action="..." method="post">
<P>
<FIELDSET>
<LEGEND>Personal Information</LEGEND>

226
17.11 Giving focus to an element

Last Name: <INPUT name="personal_lastname" type="text" tabindex="1">


First Name: <INPUT name="personal_firstname" type="text" tabindex="2">
Address: <INPUT name="personal_address" type="text" tabindex="3">
...more personal information...
</FIELDSET>
<FIELDSET>
<LEGEND>Medical History</LEGEND>
<INPUT name="history_illness"
type="checkbox"
value="Smallpox" tabindex="20"> Smallpox
<INPUT name="history_illness"
type="checkbox"
value="Mumps" tabindex="21"> Mumps
<INPUT name="history_illness"
type="checkbox"
value="Dizziness" tabindex="22"> Dizziness
<INPUT name="history_illness"
type="checkbox"
value="Sneezing" tabindex="23"> Sneezing
...more medical history...
</FIELDSET>
<FIELDSET>
<LEGEND>Current Medication</LEGEND>
Are you currently taking any medication?
<INPUT name="medication_now"
type="radio"
value="Yes" tabindex="35">Yes
<INPUT name="medication_now"
type="radio"
value="No" tabindex="35">No

If you are currently taking medication, please indicate


it in the space below:
<TEXTAREA name="current_medication"
rows="20" cols="50"
tabindex="40">
</TEXTAREA>
</FIELDSET>
</FORM>

Note that in this example, we might improve the visual presentation of the form by aligning elements
within each FIELDSET (with style sheets), adding color and font information (with style sheets), adding
scripting (say, to only open the "current medication" text area if the user indicates he or she is currently on
medication), etc.

17.11 Giving focus to an element


In an HTML document, an element must receive focus from the user in order to become active and
perform its tasks. For example, users must activate a link specified by the A element in order to follow the
specified link. Similarly, users must give a TEXTAREA focus in order to enter text into it.

227
17.11.1 Tabbing navigation

There are several ways to give focus to an element:

Designate the element with a pointing device.


Navigate from one element to the next with the keyboard. The document’s author may define a
tabbing order that specifies the order in which elements will receive focus if the user navigates the
document with the keyboard (see tabbing navigation [p.228] ). Once selected, an element may be
activated by some other key sequence.
Select an element through an access key [p.229] (sometimes called "keyboard shortcut" or "keyboard
accelerator").

17.11.1 Tabbing navigation


Attribute definitions

tabindex = number [p.44] [CN] [p.43]


This attribute specifies the position of the current element in the tabbing order for the current
document. This value must be a number between 0 and 32767. User agents should ignore leading
zeros.

The tabbing order defines the order in which elements will receive focus when navigated by the user via
the keyboard. The tabbing order may include elements nested within other elements.

Elements that may receive focus should be navigated by user agents according to the following rules:

1. Those elements that support the tabindex attribute and assign a positive value to it are navigated
first. Navigation proceeds from the element with the lowest tabindex value to the element with the
highest value. Values need not be sequential nor must they begin with any particular value. Elements
that have identical tabindex values should be navigated in the order they appear in the character
stream.
2. Those elements that do not support the tabindex attribute or support it and assign it a value of "0"
are navigated next. These elements are navigated in the order they appear in the character stream.
3. Elements that are disabled [p.230] do not participate in the tabbing order.

The following elements support the tabindex attribute: A, AREA, BUTTON, INPUT, OBJECT,
SELECT, and TEXTAREA.

In this example, the tabbing order will be the BUTTON, the INPUT elements in order (note that "field1"
and the button share the same tabindex, but "field1" appears later in the character stream), and finally the
link created by the A element.
<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"
"[Link]
<HTML>
<HEAD>
<TITLE>A document with FORM</TITLE>
</HEAD>
<BODY>
...some text...
<P>Go to the

228
17.11.2 Access keys

<A tabindex="10" href="[Link] Web site.</A>


...some more...
<BUTTON type="button" name="get-database"
tabindex="1" onclick="get-database">
Get the current database.
</BUTTON>
...some more...
<FORM action="..." method="post">
<P>
<INPUT tabindex="1" type="text" name="field1">
<INPUT tabindex="2" type="text" name="field2">
<INPUT tabindex="3" type="submit" name="submit">
</P>
</FORM>
</BODY>
</HTML>

Tabbing keys. The actual key sequence that causes tabbing navigation or element activation depends on
the configuration of the user agent (e.g., the "tab" key is used for navigation and the "enter" key is used to
activate a selected element).

User agents may also define key sequences to navigate the tabbing order in reverse. When the end (or
beginning) of the tabbing order is reached, user agents may circle back to the beginning (or end).

17.11.2 Access keys


Attribute definitions

accesskey = character [p.47] [CN] [p.43]


This attribute assigns an access key to an element. An access key is a single character from the
document character [Link]. Authors should consider the input method of the expected reader when
specifying an accesskey.

Pressing an access key assigned to an element gives focus to the element. The action that occurs when an
element receives focus depends on the element. For example, when a user activates a link defined by the A
element, the user agent generally follows the link. When a user activates a radio button, the user agent
changes the value of the radio button. When the user activates a text field, it allows input, etc.

The following elements support the accesskey attribute: A, AREA, BUTTON, INPUT, LABEL, and
LEGEND, and TEXTAREA.

This example assigns the access key "U" to a label associated with an INPUT control. Typing the access
key gives focus to the label which in turn gives it to the associated control. The user may then enter text
into the INPUT area.

229
17.12 Disabled and read-only controls

<FORM action="..." method="post">


<P>
<LABEL for="fuser" accesskey="U">
User Name
</LABEL>
<INPUT type="text" name="user" id="fuser">
</P>
</FORM>

In this example, we assign an access key to a link defined by the A element. Typing this access key takes
the user to another document, in this case, a table of contents.
<P><A accesskey="C"
rel="contents"
href="[Link]
Table of Contents</A>

The invocation of access keys depends on the underlying system. For instance, on machines running MS
Windows, one generally has to press the "alt" key in addition to the access key. On Apple systems, one
generally has to press the "cmd" key in addition to the access key.

The rendering of access keys depends on the user agent. We recommend that authors include the access
key in label text or wherever the access key is to apply. User agents should render the value of an access
key in such a way as to emphasize its role and to distinguish it from other characters (e.g., by underlining
it).

17.12 Disabled and read-only controls


In contexts where user input is either undesirable or irrelevant, it is important to be able to disable a
control or render it read-only. For example, one may want to disable a form’s submit button until the user
has entered some required data. Similarly, an author may want to include a piece of read-only text that
must be submitted as a value along with the form. The following sections describe disabled and read-only
controls.

17.12.1 Disabled controls


Attribute definitions

disabled [CI] [p.43]


When set for a form control, this boolean attribute disables the control for user input.

When set, the disabled attribute has the following effects on an element:

Disabled controls do not receive focus [p.227] .


Disabled controls are skipped in tabbing navigation [p.228] .
Disabled controls cannot be successful [p.232] .

230
17.13 Form submission

The following elements support the disabled attribute: BUTTON INPUT, OPTGROUP, OPTION,
SELECT, and TEXTAREA.

This attribute is inherited but local declarations override the inherited value.

How disabled elements are rendered depends on the user agent. For example, some user agents "gray out"
disabled menu items, button labels, etc.

In this example, the INPUT element is disabled. Therefore, it cannot receive user input nor will its value
be submitted with the form.
<INPUT disabled name="fred" value="stone">

Note. The only way to modify dynamically the value of the disabled attribute is through a script.
[p.237]

17.12.2 Read-only controls


Attribute definitions

readonly [CI] [p.43]


When set for a form control, this boolean attribute prohibits changes to the control.

The readonly attribute specifies whether the control may be modified by the user.

When set, the readonly attribute has the following effects on an element:

Read-only elements receive focus [p.227] but cannot be modified by the user.
Read-only elements are included in tabbing navigation [p.228] .
Read-only elements may be successful [p.232] .

The following elements support the readonly attribute: INPUT and TEXTAREA.

How read-only elements are rendered depends on the user agent.

Note. The only way to modify dynamically the value of the readonly attribute is through a script.
[p.237]

17.13 Form submission


The following sections explain how user agents submit form data to form processing agents.

17.13.1 Form submission method


The method attribute of the FORM element specifies the HTTP method used to send the form to the
processing agent. This attribute may take two values:

231
17.13.2 Successful controls

get: With the HTTP "get" method, the form data set [p.233] is appended to the URI specified by
the action attribute (with a question-mark ("?") as separator) and this new URI is sent to the
processing agent.
post: With the HTTP "post" method, the form data set [p.233] is included in the body of the form
and sent to the processing agent.

The "get" method should be used when the form is idempotent (i.e., causes no side-effects). Many
database searches have no visible side-effects and make ideal applications for the "get" method.

If the service associated with the processing of a form causes side effects (for example, if the form
modifies a database or subscription to a service), the "post" method should be used.

Note. The "get" method restricts form data set [p.233] values to ASCII characters. Only the "post" method
(with enctype="multipart/form-data") is specified to cover the entire [ISO10646] [p.327] character
set.

17.13.2 Successful controls


A successful control is "valid" for submission. Every successful control has its control name [p.208]
paired with its current value [p.208] as part of the submitted form data set [p.233] . A successful control
must be defined within a FORM element and must have a control name. [p.208]

However:

Controls that are disabled [p.230] cannot be successful.


If a form contains more than one submit button [p.209] , only the activated submit button is
successful.
All "on" checkboxes [p.209] may be successful.
For radio buttons [p.209] that share the same value of the name attribute, only the "on" radio button
may be successful.
For menus [p.209] , the control name [p.208] is provided by a SELECT element and values are
provided by OPTION elements. Only selected options may be successful.
The current value [p.208] of a file select [p.209] is a list of one or more file names. Upon submission
of the form, the contents of each file are submitted with the rest of the form data. The file contents
are packaged according to the form’s content type [p.234] .
The current value of an object control is determined by the object’s implementation.

If a control doesn’t have a current value [p.208] when the form is submitted, user agents are not required
to treat it as a successful control.

Furthermore, user agents should not consider the following controls successful:

Reset buttons. [p.209]


OBJECT elements whose declare attribute has been set.

232
17.13.3 Processing form data

Hidden controls [p.209] and controls that are not rendered because of style sheet [p.171] settings may still
be successful. For example:
<FORM action="..." method="post">
<P>
<INPUT type="password" style="display:none"
name="invisible-password"
value="mypassword">
</FORM>

will still cause a value to be paired with the name "invisible-password" and submitted with the form.

17.13.3 Processing form data


When the user submits a form (e.g., by activating a submit button [p.209] ), the user agent processes it as
follows.

Step one: Identify the successful controls

Step two: Build a form data set


A form data set is a sequence of control-name [p.208] /current-value [p.208] pairs constructed from
successful controls [p.232]

Step three: Encode the form data set


The form data set is then encoded according to the content type [p.234] specified by the enctype
attribute of the FORM element.

Step four: Submit the encoded form data set


Finally, the encoded data is sent to the processing agent designated by the action attribute using the
protocol specified by the method attribute.

This specification does not specify all valid submission methods or content types [p.234] that may be used
with forms. However, HTML 4.0 user agents must support the established conventions in the following
cases:

If the method is "get" and the action is an HTTP URI, the user agent takes the value of action,
appends a ‘?’ to it, then appends the form data set [p.233] , encoded using the
"application/x-www-form-urlencoded" content type [p.234] . The user agent then traverses the link to
this URI. In this scenario, form data are restricted to ASCII codes.
If the method is "post" and the action is an HTTP URI, the user agent conducts an HTTP "post"
transaction using the value of the action attribute and a message created according to the content
type [p.234] specified by the enctype attribute.

233
17.13.4 Form content types

For any other value of action or method, behavior is unspecified.

User agents should render the response from the HTTP "get" and "post" transactions.

17.13.4 Form content types


The enctype attribute of the FORM element specifies the content type [p.46] used to encode the form
data set [p.233] for submission to the server. User agents must support the content types listed below.
Behavior for other content types is unspecified.

Please also consult the section on escaping ampersands in URI attribute values [p.311] .

application/x-www-form-urlencoded
This is the default content type. Forms submitted with this content type must be encoded as follows:

1. Control names and values are escaped. Space characters are replaced by ‘+’, and then reserved
characters are escaped as described in [RFC1738] [p.328] , section 2.2: Non-alphanumeric characters
are replaced by ‘%HH’, a percent sign and two hexadecimal digits representing the ASCII code of
the character. Line breaks are represented as "CR LF" pairs (i.e., ‘%0D%0A’).
2. The control names/values are listed in the order they appear in the document. The name is separated
from the value by ‘=’ and name/value pairs are separated from each other by ‘&’.

multipart/form-data
Note. Please consult [RFC1867] [p.330] for additional information about file uploads, including
backwards compatibility issues, the relationship between "multipart/form-data" and other content types,
performance issues, etc.

Please consult the appendix for information about security issues for forms [p.325] .

The content type "application/x-www-form-urlencoded" is inefficient for sending large quantities of


binary data or text containing non-ASCII characters. The content type "multipart/form-data" should be
used for submitting forms that contain files, non-ASCII data, and binary data.

The content "multipart/form-data" follows the rules of all multipart MIME data streams as outlined in
[RFC2045] [p.328] . The definition of "multipart/form-data" is available at the [IANA] [p.327] registry.

A "multipart/form-data" message contains a series of parts, each representing a successful control [p.232] .
The parts are sent to the processing agent in the same order the corresponding controls appear in the
document stream. Part boundaries should not occur in any of the data; how this is done lies outside the
scope of this specification.

As with all multipart MIME types, each part has an optional "Content-Type" header that defaults to
"text/plain". User agents should supply the "Content-Type" header, accompanied by a "charset"
parameter.

234
17.13.4 Form content types

Each part is expected to contain:

1. a "Content-Disposition" header whose value is "form-data".


2. a name attribute specifying the control name [p.208] of the corresponding control. Control names
originally encoded in non-ASCII character sets [p.37] may be encoded using the method outlined in
[RFC2045] [p.328] .

Thus, for example, for a control named "mycontrol", the corresponding part would be specified:
Content-Disposition: form-data; name="mycontrol"

As with all MIME transmissions, "CR LF" (i.e., ‘%0D%0A’) is used to separate lines of data.

Each part may be encoded and the "Content-Transfer-Encoding" header supplied if the value of that part
does not conform to the default (7BIT) encoding (see [RFC2045] [p.328] , section 6)

If the contents of a file are submitted with a form, the file input should be identified by the appropriate
content type [p.46] (e.g., "application/octet-stream"). If multiple files are to be returned as the result of a
single form entry, they should be returned as "multipart/mixed" embedded within the
"multipart/form-data".

The user agent should attempt to supply a file name for each submitted file. The file name may be
specified with the "filename" parameter of the ’Content-Disposition: form-data’ header, or, in the case of
multiple files, in a ’Content-Disposition: file’ header of the subpart. If the file name of the client’s
operating system is not in US-ASCII, the file name might be approximated or encoded using the method
of [RFC2045] [p.328] . This is convenient for those cases where, for example, the uploaded files might
contain references to each other (e.g., a TeX file and its ".sty" auxiliary style description).

The following example illustrates "multipart/form-data" encoding. Suppose we have the following form:
<FORM action="[Link]
enctype="multipart/form-data"
method="post">
<P>
What is your name? <INPUT type="text" name="submit-name"><BR>
What files are you sending? <INPUT type="file" name="files"><BR>
<INPUT type="submit" value="Send"> <INPUT type="reset">
</FORM>

If the user enters "Larry" in the text input, and selects the text file "[Link]", the user agent might send
back the following data:
Content-Type: multipart/form-data; boundary=AaB03x

--AaB03x
Content-Disposition: form-data; name="submit-name"

Larry
--AaB03x
Content-Disposition: form-data; name="files"; filename="[Link]"

235
17.13.4 Form content types

Content-Type: text/plain

... contents of [Link] ...


--AaB03x--

If the user selected a second (image) file "[Link]", the user agent might construct the parts as follows:
Content-Type: multipart/form-data; boundary=AaB03x

--AaB03x
Content-Disposition: form-data; name="submit-name"

Larry
--AaB03x
Content-Disposition: form-data; name="files"
Content-Type: multipart/mixed; boundary=BbC04y

--BbC04y
Content-Disposition: attachment; filename="[Link]"
Content-Type: text/plain

... contents of [Link] ...


--BbC04y
Content-Disposition: attachment; filename="[Link]"
Content-Type: image/gif
Content-Transfer-Encoding: binary

...contents of [Link]...
--BbC04y--
--AaB03x--

236
18 Scripts

18 Scripts
Contents

1. Introduction to scripts . . . . . . . . . . . . . . . . . 237


.
2. Designing documents for user agents that support scripting . . . . . . . . 238
.
1. The SCRIPT element . . . . . . . . . . . . . . . 238
.
2. Specifying the scripting language . . . . . . . . . . . . . 239
.
The default scripting language . . . . . . . . . . . . 239
.
Local declaration of a scripting language . . . . . . . . . . 239
.
References to HTML elements from a script . . . . . . . . . . 240
.
3. Intrinsic events . . . . . . . . . . . . . . . . . 240
.
4. Dynamic modification of documents . . . . . . . . . . . . 243
.
3. Designing documents for user agents that don’t support scripting . . . . . . . 244
.
1. The NOSCRIPT element . . . . . . . . . . . . . . . 244
.
2. Hiding script data from user agents . . . . . . . . . . . . . 245
.

18.1 Introduction to scripts


A client-side script is a program that may accompany an HTML document or be embedded directly in it.
The program executes on the client’s machine when the document loads, or at some other time such as
when a link is activated. HTML’s support for scripts is independent of the scripting language.

Scripts offer authors a means to extend HTML documents in highly active and interactive ways. For
example:

Scripts may be evaluated as a document loads to modify the contents of the document dynamically.
Scripts may accompany a form to process input as it is entered. Designers may dynamically fill out
parts of a form based on the values of other fields. They may also ensure that input data conforms to
predetermined ranges of values, that fields are mutually consistent, etc.
Scripts may be triggered by events that affect the document, such as loading, unloading, element
focus, mouse movement, etc.
Scripts may be linked to form controls (e.g., buttons) to produce graphical user interface elements.

There are two types of scripts authors may attach to an HTML document:

Those that are executed one time when the document is loaded by the user agent. Scripts that appear
within a SCRIPT element are executed when the document is loaded. For user agents that cannot or
will not handle scripts, authors may include alternate content via the NOSCRIPT element.
Those that are executed every time a specific event occurs. These scripts may be assigned to a
number of elements via the intrinsic event [p.240] attributes.

Note. This specification includes more detailed information about scripting in sections on script macros
[p.323] .

237
18.2 Designing documents for user agents that support scripting

18.2 Designing documents for user agents that support scripting


The following sections discuss issues that concern user agents that support scripting.

18.2.1 The SCRIPT element


<!ELEMENT SCRIPT - - %Script; -- script statements -->
<!ATTLIST SCRIPT
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #REQUIRED -- content type of script language --
src %URI; #IMPLIED -- URI for an external script --
defer (defer) #IMPLIED -- UA may defer execution of script --
>

Start tag: required, End tag: required

Attribute definitions

src = uri [p.44] [CT] [p.43]


This attribute specifies the location of an external script.
type = content-type [p.46] [CI] [p.43]
This attribute specifies the scripting language of the element’s contents and overrides the default
scripting language. The scripting language is specified as a content type (e.g., "text/javascript").
Authors must supply a value for this attribute. There is no default value for this attribute.
language = cdata [p.44] [CI] [p.43]
Deprecated. [p.34] This attribute specifies the scripting language of the contents of this element. Its
value is an identifier for the language, but since these identifiers are not standard, this attribute has
been deprecated [p.34] in favor of type.
defer [CI] [p.43]
When set, this boolean attribute provides a hint to the user agent that the script is not going to
generate any document content (e.g., no "[Link]" in javascript) and thus, the user agent can
continue parsing and rendering.

Attributes defined elsewhere

charset(character encodings [p.37] )

The SCRIPT element places a script within a document. This element may appear any number of times in
the HEAD or BODY of an HTML document.

The script may be defined within the contents of the SCRIPT element or in an external file. If the src
attribute is not set, user agents must interpret the contents of the element as the script. If the src has a
URI value, user agents must ignore the element’s contents and retrieve the script via the URI. Note that
the charset attribute refers to the character encoding [p.37] of the script designated by the src
attribute; it does not concern the content of the SCRIPT element.

238
18.2.2 Specifying the scripting language

Scripts are evaluated by script engines that must be known to a user agent.

The syntax of script data [p.50] depends on the scripting language.

18.2.2 Specifying the scripting language


As HTML does not rely on a specific scripting language, document authors must explicitly tell user agents
the language of each script. This may be done either through a default declaration or a local declaration.

The default scripting language


Authors should specify the default scripting language for all scripts in a document by including the
following META declaration in the HEAD:
<META http-equiv="Content-Script-Type" content="type">

where "type" is an content type [p.46] naming the scripting language. Examples of values include
"text/tcl", "text/javascript", "text/vbscript".

In the absence of a META declaration, the default can be set by a "Content-Script-Type" HTTP header.
Content-Script-Type: type

where "type" is again an content type [p.46] naming the scripting language.

User agents should determine the default scripting language for a document according to the following
steps (highest to lowest priority):

1. If any META declarations specify the "Content-Script-Type", the last one in the character stream
determines the default scripting language.
2. Otherwise, if any HTTP headers specify the "Content-Script-Type", the last one in the character
stream determines the default scripting language.

Documents that do not specify a default scripting language information and that contain elements that
specify an intrinsic event [p.240] script are incorrect. User agents may still attempt to interpret incorrectly
specified scripts but are not required to. Authoring tools should generate default scripting language
information to help authors avoid creating incorrect documents.

Local declaration of a scripting language


The type attribute must be specified for each SCRIPT element instance in a document. The value of the
type attribute for a SCRIPT element overrides the default scripting language for that element.

In this example, we declare the default scripting language to be "text/tcl". We include one SCRIPT in the
header, whose script is located in an external file and is in the scripting language "text/vbscript". We also
include one SCRIPT in the body, which contains its own script written in "text/javascript".

239
18.2.3 Intrinsic events

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"


"[Link]
<HTML>
<HEAD>
<TITLE>A document with SCRIPT</TITLE>
<META http-equiv="Content-Script-Type" content="text/tcl">
<SCRIPT type="text/vbscript" src="[Link]
</SCRIPT>
</HEAD>
<BODY>
<SCRIPT type="text/javascript">
...some JavaScript...
</SCRIPT>
</BODY>
</HTML>

References to HTML elements from a script


Each scripting language has its own conventions for referring to HTML objects from within a script. This
specification does not define a standard mechanism for referring to HTML objects.

However, scripts should refer to an element according to its assigned name. Scripting engines should
observe the following precedence rules when identifying an element: a name attribute takes precedence
over an id if both are set. Otherwise, one or the other may be used.

18.2.3 Intrinsic events


Note. Authors of HTML documents are advised that changes are likely to occur in realm of intrinsic
events (e.g., how scripts are bound to events). Research in this realm is carried on by members of the
W3C Document Object Model Working Group (see the W3C Web Site at [Link] for more
information).

Attribute definitions

onload = script [p.50] [CT] [p.43]


The onload event occurs when the user agent finishes loading a window or all frames within a
FRAMESET. This attribute may be used with BODY and FRAMESET elements.
onunload = script [p.50] [CT] [p.43]
The onunload event occurs when the user agent removes a document from a window or frame.
This attribute may be used with BODY and FRAMESET elements.
onclick = script [p.50] [CT] [p.43]
The onclick event occurs when the pointing device button is clicked over an element. This
attribute may be used with most elements.
ondblclick = script [p.50] [CT] [p.43]
The ondblclick event occurs when the pointing device button is double clicked over an element.
This attribute may be used with most elements.
onmousedown = script [p.50] [CT] [p.43]
The onmousedown event occurs when the pointing device button is pressed over an element. This
attribute may be used with most elements.

240
18.2.3 Intrinsic events

onmouseup = script [p.50] [CT] [p.43]


The onmouseup event occurs when the pointing device button is released over an element. This
attribute may be used with most elements.
onmouseover = script [p.50] [CT] [p.43]
The onmouseover event occurs when the pointing device is moved onto an element. This attribute
may be used with most elements.
onmousemove = script [p.50] [CT] [p.43]
The onmousemove event occurs when the pointing device is moved while it is over an element.
This attribute may be used with most elements.
onmouseout = script [p.50] [CT] [p.43]
The onmouseout event occurs when the pointing device is moved away from an element. This
attribute may be used with most elements.
onfocus = script [p.50] [CT] [p.43]
The onfocus event occurs when an element receives focus either by the pointing device or by
tabbing navigation. This attribute may be used with the following elements: LABEL, INPUT,
SELECT, TEXTAREA, and BUTTON.
onblur = script [p.50] [CT] [p.43]
The onblur event occurs when an element loses focus either by the pointing device or by tabbing
navigation. It may be used with the same elements as onfocus.
onkeypress = script [p.50] [CT] [p.43]
The onkeypress event occurs when a key is pressed and released over an element. This attribute
may be used with most elements.
onkeydown = script [p.50] [CT] [p.43]
The onkeydown event occurs when a key is pressed down over an element. This attribute may be
used with most elements.
onkeyup = script [p.50] [CT] [p.43]
The onkeyup event occurs when a key is released over an element. This attribute may be used with
most elements.
onsubmit = script [p.50] [CT] [p.43]
The onsubmit event occurs when a form is submitted. It only applies to the FORM element.
onreset = script [p.50] [CT] [p.43]
The onreset event occurs when a form is reset. It only applies to the FORM element.
onselect = script [p.50] [CT] [p.43]
The onselect event occurs when a user selects some text in a text field. This attribute may be used
with the INPUT and TEXTAREA elements.
onchange = script [p.50] [CT] [p.43]
The onchange event occurs when a control loses the input focus and its value has been modified
since gaining focus. This attribute applies to the following elements: INPUT, SELECT, and
TEXTAREA.

It is possible to associate an action with a certain number of events that occur when a user interacts with a
user agent. Each of the "intrinsic events" listed above takes a value that is a script. The script is executed
whenever the event occurs for that element. The syntax of script data [p.50] depends on the scripting
language.

241
18.2.3 Intrinsic events

Control elements such as INPUT, SELECT, BUTTON, TEXTAREA, and LABEL all respond to certain
intrinsic events. When these elements do not appear within a form, they may be used to augment the
graphical user interface of the document.

For instance, authors may want to include press buttons in their documents that do not submit a form but
still communicate with a server when they are activated.

The following examples show some possible control and user interface behavior based on intrinsic events.

In the following example, userName is a required text field. When a user attempts to leave the field, the
onblur event calls a JavaScript function to confirm that userName has an acceptable value.
<INPUT NAME="userName" onblur="validUserName([Link])">

Here is another JavaScript example:


<INPUT NAME="num"
onchange="if (!checkNum([Link], 1, 10))
{[Link]();[Link]();} else {thanks()}"
VALUE="0">

Here is a VBScript example of an event handler for a text field:


<INPUT name="edit1" size="50">
<SCRIPT type="text/vbscript">
Sub edit1_changed()
If [Link] = "abc" Then
[Link] = True
Else
[Link] = False
End If
End Sub
</SCRIPT>

Here is the same example using Tcl:


<INPUT name="edit1" size="50">
<SCRIPT type="text/tcl">
proc edit1_changed {} {
if {[edit value] == abc} {
button1 enable 1
} else {
button1 enable 0
}
}
edit1 onChange edit1_changed
</SCRIPT>

Here is a JavaScript example for event binding within a script. First, here’s a simple click handler:

242
18.2.4 Dynamic modification of documents

<BUTTON type="button" name="mybutton" value="10">


<SCRIPT type="text/javascript">
function my_onclick() {
. . .
}
[Link] = my_onclick
</SCRIPT>
</BUTTON>

Here’s a more interesting window handler:

<SCRIPT type="text/javascript">
function my_onload() {
. . .
}

var win = [Link]("some/other/URI")


if (win) [Link] = my_onload
</SCRIPT>

In Tcl this looks like:


<SCRIPT type="text/tcl">
proc my_onload {} {
. . .
}
set win [window open "some/other/URI"]
if {$win != ""} {
$win onload my_onload
}
</SCRIPT>

Note that "[Link]" or equivalent statements in intrinsic event handlers create and write to a new
document rather than modifying the current one.

18.2.4 Dynamic modification of documents


Scripts that are executed when a document is loaded may be able to modify the document’s contents
dynamically. The ability to do so depends on the scripting language itself (e.g., the "[Link]"
statement in the HTML object model supported by some vendors).

The dynamic modification of a document may be modeled as follows:

1. All SCRIPT elements are evaluated in order as the document is loaded.


2. All script constructs within a given SCRIPT element that generate SGML CDATA are evaluated.
Their combined generated text is inserted in the document in place of the SCRIPT element.
3. The generated CDATA is re-evaluated.

243
18.3 Designing documents for user agents that don’t support scripting

HTML documents are constrained to conform to the HTML DTD both before and after processing any
SCRIPT elements.

The following example illustrates how scripts may modify a document dynamically. The following script:
<TITLE>Test Document</TITLE>
<SCRIPT type="text/javascript">
[Link]("<p><b>Hello World!<\/b>")
</SCRIPT>

Has the same effect as this HTML markup:


<TITLE>Test Document</TITLE>
<P><B>Hello World!</B>

18.3 Designing documents for user agents that don’t support


scripting
The following sections discuss how authors may create documents that work for user agents that don’t
support scripting.

18.3.1 The NOSCRIPT element


<!ELEMENT NOSCRIPT - - (%block;)+
-- alternate content container for non script-based rendering -->
<!ATTLIST NOSCRIPT
%attrs; -- %coreattrs, %i18n, %events --
>

Start tag: required, End tag: required

The NOSCRIPT element allows authors to provide alternate content when a script is not executed. The
content of a NOSCRIPT element should only rendered by a script-aware user agent in the following cases:

The user agent is configured not to evaluate scripts.


The user agent doesn’t support a scripting language invoked by a SCRIPT element earlier in the
document.

User agents that do not support client-side scripts must render this element’s contents.

In the following example, a user agent that executes the SCRIPT will include some dynamically created
data in the document. If the user agent doesn’t support scripts, the user may still retrieve the data through
a link.
<SCRIPT type="text/tcl">
...some Tcl script to insert data...
</SCRIPT>
<NOSCRIPT>
<P>Access the <A href="[Link]
</NOSCRIPT>

244
18.3.2 Hiding script data from user agents

18.3.2 Hiding script data from user agents


User agents that don’t recognize the SCRIPT element will likely render that element’s contents as text.
Some scripting engines, including those for languages JavaScript, VBScript, and Tcl allow the script
statements to be enclosed in an SGML comment. User agents that don’t recognize the SCRIPT element
will thus ignore the comment while smart scripting engines will understand that the script in comments
should be executed.

Another solution to the problem is to keep scripts in external documents and refer to them with the src
attribute.

Commenting scripts in JavaScript


The JavaScript engine allows the string "<!--" to occur at the start of a SCRIPT element, and ignores
further characters until the end of the line. JavaScript interprets "//" as starting a comment extending to the
end of the current line. This is needed to hide the string "-->" from the JavaScript parser.
<SCRIPT type="text/javascript">
<!-- to hide script contents from old browsers
function square(i) {
[Link]("The call passed ", i ," to the function.","<BR>")
return i * i
}
[Link]("The function returned ",square(5),".")
// end hiding contents from old browsers -->
</SCRIPT>

Commenting scripts in VBScript


In VBScript, a single quote character causes the rest of the current line to be treated as a comment. It can
therefore be used to hide the string "-->" from VBScript, for instance:
<SCRIPT type="text/vbscript">
<!--
Sub foo()
...
End Sub
’ -->
</SCRIPT>

Commenting scripts in TCL


In Tcl, the "#" character comments out the rest of the line:
<SCRIPT type="text/tcl">
<!-- to hide script contents from old browsers
proc square {i} {
document write "The call passed $i to the function.<BR>"
return [expr $i * $i]
}
document write "The function returned [square 5]."
# end hiding contents from old browsers -->
</SCRIPT>

245
18.3.2 Hiding script data from user agents

Note. Some browsers close comments on the first ">" character, so to hide script content from such
browsers, you can transpose operands for relational and shift operators (e.g., use "y < x" rather than "x >
y") or use scripting language-dependent escapes for ">".

246
19 SGML reference information for HTML

19 SGML reference information for HTML


Contents

1. Document Validation . . . . . . . . . . . . . . . . . 247


.
2. Sample SGML catalog . . . . . . . . . . . . . . . . 248
.

The following sections contain the formal SGML definition of HTML 4.0. It includes the SGML
declaration [p.249] , the Document Type Definition [p.251] (DTD), and the Character entity references
[p.289] , as well as a sample SGML catalog [p.248] .

These files are also available in ASCII format as listed below:

Default DTD:
[Link]
Transitional DTD:
[Link]
Frameset DTD:
[Link]
SGML declaration:
[Link]
Entity definition files:
[Link]
[Link]
[Link]
A sample catalog:
[Link]

19.1 Document Validation


Many authors rely on a limited set of browsers to check on the documents they produce, assuming that if
the browsers can render their documents they are valid. Unfortunately, this is a very ineffective means of
verifying a document’s validity precisely because browsers are designed to cope with invalid documents
by rendering them as well as they can to avoid frustrating users.

For better validation, you should check your document against an SGML parser such as nsgmls (see [SP]
[p.330] ), to verify that HTML documents conform to the HTML 4.0 DTD. If the document type
declaration [p.54] of your document includes a URI and your SGML parser supports this type of system
identifier, it will get the DTD directly. Otherwise you can use the following sample SGML catalog. It
assumes that the DTD has been saved as the file "[Link]" and that the entities are in the files
"[Link]", "[Link]" and "[Link]". In any case, make sure your SGML parser
is capable of handling Unicode. See your validation tool documentation for further details.

Beware that such validation, although useful and highly recommended, does not guarantee that a
document fully conforms to the HTML 4.0 specification. This is because an SGML parser relies solely on
the given SGML DTD which does not express all aspects of a valid HTML 4.0 document. Specifically, an

247
19.2 Sample SGML catalog

SGML parser ensures that the syntax, the structure, the list of elements, and their attributes are valid. But
for instance, it cannot catch errors such as setting the width attribute of an IMG element to an invalid
value (i.e., "foo" or "12.5"). Although the specification restricts the value for this attribute to an "integer
representing a length in pixels," the DTD only defines it to be CDATA [p.44] , which actually allows any
value. Only a specialized program could capture the complete specification of HTML 4.0.

Nevertheless, this type of validation is still highly recommended since it permits the detection of a large
set of errors that make documents invalid.

19.2 Sample SGML catalog


This catalog includes the override directive to ensure that processing software such as nsgmls uses public
identifiers in preference to system identifiers. This means that users do not have to be connected to the
Web when retrieving URI-based system identifiers.
OVERRIDE YES

PUBLIC "-//W3C//DTD HTML 4.0//EN" [Link]


PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN" [Link]
PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN" [Link]
PUBLIC "-//W3C//ENTITIES Latin1//EN//HTML" [Link]
PUBLIC "-//W3C//ENTITIES Special//EN//HTML" [Link]
PUBLIC "-//W3C//ENTITIES Symbols//EN//HTML" [Link]

248
20 SGML Declaration of HTML 4.0

20 SGML Declaration of HTML 4.0


Note. The total number of codepoints allowed in the document character set of this SGML declaration
includes the first 17 planes of [ISO10646] [p.327] (17 times 65536). This limitation has been made
because this number is limited to a length of 8 digits in the current version of the SGML standard. It does
not imply any statement about the feasibility of a long-term restriction of characters in UCS to the first 17
planes. Chances are very high that the limitation to 8 digits in SGML will be removed before, and that this
specification will be updated before, the first assignment of a character beyond the first 17 planes.

Note. Strictly speaking, ISO Registration Number 177 refers to the original state of [ISO10646] [p.327] in
1993, while in this specification, we always refer to the most up-to-date form of ISO 10646. Changes since
1993 have been the addition of characters and a one-time operation reallocating a large number of
codepoints for Korean Hangul (Amendment 5).

20.1 SGML Declaration


<!SGML "ISO 8879:1986"
--
SGML Declaration for HyperText Markup Language version 4.0

With support for the first 17 planes of ISO 10646 and


increased limits for tag and literal lengths etc.
--

CHARSET
BASESET "ISO Registration Number 177//CHARSET
ISO/IEC 10646-1:1993 UCS-4 with
implementation level 3//ESC 2/5 2/15 4/6"
DESCSET 0 9 UNUSED
9 2 9
11 2 UNUSED
13 1 13
14 18 UNUSED
32 95 32
127 1 UNUSED
128 32 UNUSED
160 55136 160
55296 2048 UNUSED -- SURROGATES --
57344 1056768 57344

CAPACITY SGMLREF
TOTALCAP 150000
GRPCAP 150000
ENTCAP 150000

SCOPE DOCUMENT
SYNTAX
SHUNCHAR CONTROLS 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16
17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 127
BASESET "ISO 646IRV:1991//CHARSET
International Reference Version
(IRV)//ESC 2/8 4/2"
DESCSET 0 128 0

249
20.1 SGML Declaration

FUNCTION
RE 13
RS 10
SPACE 32
TAB SEPCHAR 9

NAMING LCNMSTRT
""
UCNMSTRT
""
LCNMCHAR
".-_:"
UCNMCHAR
".-_:"
NAMECASE
GENERAL YES
ENTITY NO
DELIM GENERAL SGMLREF
SHORTREF SGMLREF
NAMES SGMLREF
QUANTITY SGMLREF
ATTCNT 60 -- increased --
ATTSPLEN 65536 -- These are the largest values --
LITLEN 65536 -- permitted in the declaration --
NAMELEN 65536 -- Avoid fixed limits in actual --
PILEN 65536 -- implementations of HTML UA’s --
TAGLVL 100
TAGLEN 65536
GRPGTCNT 150
GRPCNT 64

FEATURES
MINIMIZE
DATATAG NO
OMITTAG YES
RANK NO
SHORTTAG YES
LINK
SIMPLE NO
IMPLICIT NO
EXPLICIT NO
OTHER
CONCUR NO
SUBDOC NO
FORMAL YES
APPINFO NONE
>

250
21 Document Type Definition

21 Document Type Definition


<!--
This is HTML 4.0 Strict DTD, which excludes the presentation
attributes and elements that W3C expects to phase out as
support for style sheets matures. Authors should use the Strict
DTD when possible, but may use the Transitional DTD when support
for presentation attribute and elements is required.

HTML 4.0 includes mechanisms for style sheets, scripting,


embedding objects, improved support for right to left and mixed
direction text, and enhancements to forms for improved
accessibility for people with disabilities.

Draft: $Date: 1998/04/02 00:17:00 $

Authors:
Dave Raggett <dsr@[Link]>
Arnaud Le Hors <lehors@[Link]>
Ian Jacobs <ij@[Link]>

Further information about HTML 4.0 is available at:

[Link]
-->
<!--
Typical usage:

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0//EN"


"[Link]
<html>
<head>
...
</head>
<body>
...
</body>
</html>

The URI used as a system identifier with the public identifier allows
the user agent to download the DTD and entity sets as needed.

The FPI for the Transitional HTML 4.0 DTD is:

"-//W3C//DTD HTML 4.0 Transitional//EN"

and its URI is:

[Link]

If you are writing a document that includes frames, use


the following FPI:

"-//W3C//DTD HTML 4.0 Frameset//EN"

with the URI:

251
21 Document Type Definition

[Link]

The following URIs are supported in relation to HTML 4.0

"[Link] (Strict DTD)


"[Link] (Loose DTD)
"[Link] (Frameset DTD)
"[Link] (Latin-1 entities)
"[Link] (Symbol entities)
"[Link] (Special entities)

These URIs point to the latest version of each file. To reference


this specific revision use the following URIs:

"[Link]
"[Link]
"[Link]
"[Link]
"[Link]
"[Link]

-->

<!--================== Imported Names ====================================-->

<!ENTITY % ContentType "CDATA"


-- media type, as per [RFC2045]
-->

<!ENTITY % ContentTypes "CDATA"


-- comma-separated list of media types, as per [RFC2045]
-->

<!ENTITY % Charset "CDATA"


-- a character encoding, as per [RFC2045]
-->

<!ENTITY % Charsets "CDATA"


-- a space separated list of character encodings, as per [RFC2045]
-->

<!ENTITY % LanguageCode "NAME"


-- a language code, as per [RFC1766]
-->

<!ENTITY % Character "CDATA"


-- a single character from [ISO10646]
-->

<!ENTITY % LinkTypes "CDATA"


-- space-separated list of link types
-->

<!ENTITY % MediaDesc "CDATA"


-- single or comma-separated list of media descriptors
-->

252
21 Document Type Definition

<!ENTITY % URI "CDATA"


-- a Uniform Resource Identifier,
see [URI]
-->

<!ENTITY % Datetime "CDATA" -- date and time information. ISO date format -->

<!ENTITY % Script "CDATA" -- script expression -->

<!ENTITY % StyleSheet "CDATA" -- style sheet data -->

<!ENTITY % Text "CDATA">

<!-- Parameter Entities -->

<!ENTITY % [Link] "SCRIPT|STYLE|META|LINK|OBJECT" -- repeatable head elements -->

<!ENTITY % heading "H1|H2|H3|H4|H5|H6">

<!ENTITY % list "UL | OL">

<!ENTITY % preformatted "PRE">

<!--================ Character mnemonic entities =========================-->

<!ENTITY % HTMLlat1 PUBLIC


"-//W3C//ENTITIES Latin1//EN//HTML"
"[Link]
%HTMLlat1;

<!ENTITY % HTMLsymbol PUBLIC


"-//W3C//ENTITIES Symbols//EN//HTML"
"[Link]
%HTMLsymbol;

<!ENTITY % HTMLspecial PUBLIC


"-//W3C//ENTITIES Special//EN//HTML"
"[Link]
%HTMLspecial;
<!--=================== Generic Attributes ===============================-->

<!ENTITY % coreattrs
"id ID #IMPLIED -- document-wide unique id --
class CDATA #IMPLIED -- space separated list of classes --
style %StyleSheet; #IMPLIED -- associated style info --
title %Text; #IMPLIED -- advisory title/amplification --"
>

<!ENTITY % i18n
"lang %LanguageCode; #IMPLIED -- language code --
dir (ltr|rtl) #IMPLIED -- direction for weak/neutral text --"

253
21 Document Type Definition

>

<!ENTITY % events
"onclick %Script; #IMPLIED -- a pointer button was clicked --
ondblclick %Script; #IMPLIED -- a pointer button was double clicked--
onmousedown %Script; #IMPLIED -- a pointer button was pressed down --
onmouseup %Script; #IMPLIED -- a pointer button was released --
onmouseover %Script; #IMPLIED -- a pointer was moved onto --
onmousemove %Script; #IMPLIED -- a pointer was moved within --
onmouseout %Script; #IMPLIED -- a pointer was moved away --
onkeypress %Script; #IMPLIED -- a key was pressed and released --
onkeydown %Script; #IMPLIED -- a key was pressed down --
onkeyup %Script; #IMPLIED -- a key was released --"
>

<!-- Reserved Feature Switch -->


<!ENTITY % [Link] "IGNORE">

<!-- The following attributes are reserved for possible future use -->
<![ %[Link]; [
<!ENTITY % reserved
"datasrc %URI; #IMPLIED -- a single or tabular Data Source --
datafld CDATA #IMPLIED -- the property or column name --
dataformatas (plaintext|html) plaintext -- text or html --"
>
]]>

<!ENTITY % reserved "">

<!ENTITY % attrs "%coreattrs; %i18n; %events;">

<!--=================== Text Markup ======================================-->

<!ENTITY % fontstyle
"TT | I | B | BIG | SMALL">

<!ENTITY % phrase "EM | STRONG | DFN | CODE |


SAMP | KBD | VAR | CITE | ABBR | ACRONYM" >

<!ENTITY % special
"A | IMG | OBJECT | BR | SCRIPT | MAP | Q | SUB | SUP | SPAN | BDO">

<!ENTITY % formctrl "INPUT | SELECT | TEXTAREA | LABEL | BUTTON">

<!-- %inline; covers inline or "text-level" elements -->


<!ENTITY % inline "#PCDATA | %fontstyle; | %phrase; | %special; | %formctrl;">

<!ELEMENT (%fontstyle;|%phrase;) - - (%inline;)*>


<!ATTLIST (%fontstyle;|%phrase;)
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT (SUB|SUP) - - (%inline;)* -- subscript, superscript -->


<!ATTLIST (SUB|SUP)
%attrs; -- %coreattrs, %i18n, %events --
>

254
21 Document Type Definition

<!ELEMENT SPAN - - (%inline;)* -- generic language/style container -->


<!ATTLIST SPAN
%attrs; -- %coreattrs, %i18n, %events --
%reserved; -- reserved for possible future use --
>

<!ELEMENT BDO - - (%inline;)* -- I18N BiDi over-ride -->


<!ATTLIST BDO
%coreattrs; -- id, class, style, title --
lang %LanguageCode; #IMPLIED -- language code --
dir (ltr|rtl) #REQUIRED -- directionality --
>

<!ELEMENT BR - O EMPTY -- forced line break -->


<!ATTLIST BR
%coreattrs; -- id, class, style, title --
>

<!--================== HTML content models ===============================-->

<!--
HTML has two basic content models:

%inline; character level elements and text strings


%block; block-like elements e.g. paragraphs and lists
-->

<!ENTITY % block
"P | %heading; | %list; | %preformatted; | DL | DIV | NOSCRIPT |
BLOCKQUOTE | FORM | HR | TABLE | FIELDSET | ADDRESS">

<!ENTITY % flow "%block; | %inline;">

<!--=================== Document Body ====================================-->

<!ELEMENT BODY O O (%block;|SCRIPT)+ +(INS|DEL) -- document body -->


<!ATTLIST BODY
%attrs; -- %coreattrs, %i18n, %events --
onload %Script; #IMPLIED -- the document has been loaded --
onunload %Script; #IMPLIED -- the document has been removed --
>

<!ELEMENT ADDRESS - - (%inline;)* -- information on author -->


<!ATTLIST ADDRESS
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT DIV - - (%flow;)* -- generic language/style container -->


<!ATTLIST DIV
%attrs; -- %coreattrs, %i18n, %events --
%reserved; -- reserved for possible future use --
>

<!--================== The Anchor Element ================================-->

255
21 Document Type Definition

<!ENTITY % Shape "(rect|circle|poly|default)">


<!ENTITY % Coords "CDATA" -- comma separated list of lengths -->

<!ELEMENT A - - (%inline;)* -(A) -- anchor -->


<!ATTLIST A
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #IMPLIED -- advisory content type --
name CDATA #IMPLIED -- named link end --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
accesskey %Character; #IMPLIED -- accessibility key character --
shape %Shape; rect -- for use with client-side image maps --
coords %Coords; #IMPLIED -- for use with client-side image maps --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!--================== Client-side image maps ============================-->

<!-- These can be placed in the same document or grouped in a


separate document although this isn’t yet widely supported -->

<!ELEMENT MAP - - ((%block;)+ | AREA+) -- client-side image map -->


<!ATTLIST MAP
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #REQUIRED -- for reference by usemap --
>

<!ELEMENT AREA - O EMPTY -- client-side image map area -->


<!ATTLIST AREA
%attrs; -- %coreattrs, %i18n, %events --
shape %Shape; rect -- controls interpretation of coords --
coords %Coords; #IMPLIED -- comma separated list of lengths --
href %URI; #IMPLIED -- URI for linked resource --
nohref (nohref) #IMPLIED -- this region has no action --
alt %Text; #REQUIRED -- short description --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!--================== The LINK Element ==================================-->

<!--
Relationship values can be used in principle:

a) for document specific toolbars/menus when used


with the LINK element in document head e.g.
start, contents, previous, next, index, end, help
b) to link to a separate style sheet (rel=stylesheet)
c) to make a link to a script (rel=script)

256
21 Document Type Definition

d) by stylesheets to control how collections of


html nodes are rendered into printed documents
e) to make a link to a printable version of this document
e.g. a postscript or pdf version (rel=alternate media=print)
-->

<!ELEMENT LINK - O EMPTY -- a media-independent link -->


<!ATTLIST LINK
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
type %ContentType; #IMPLIED -- advisory content type --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
media %MediaDesc; #IMPLIED -- for rendering on these media --
>

<!--=================== Images ===========================================-->

<!-- Length defined in strict DTD for cellpadding/cellspacing -->


<!ENTITY % Length "CDATA" -- nn for pixels or nn% for percentage length -->
<!ENTITY % MultiLength "CDATA" -- pixel, percentage, or relative -->

<!ENTITY % MultiLengths "CDATA" -- comma-separated list of MultiLength -->

<!ENTITY % Pixels "CDATA" -- integer representing length in pixels -->

<!-- To avoid problems with text-only UAs as well as


to make image content understandable and navigable
to users of non-visual UAs, you need to provide
a description with ALT, and avoid server-side image maps -->
<!ELEMENT IMG - O EMPTY -- Embedded image -->
<!ATTLIST IMG
%attrs; -- %coreattrs, %i18n, %events --
src %URI; #REQUIRED -- URI of image to embed --
alt %Text; #REQUIRED -- short description --
longdesc %URI; #IMPLIED -- link to long description
(complements alt) --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
ismap (ismap) #IMPLIED -- use server-side image map --
>

<!-- USEMAP points to a MAP element which may be in this document


or an external document, although the latter is not widely supported -->

<!--==================== OBJECT ======================================-->


<!--
OBJECT is used to embed objects as part of HTML pages
PARAM elements should precede other content. SGML mixed content
model technicality precludes specifying this formally ...
-->

<!ELEMENT OBJECT - - (PARAM | %flow;)*

257
21 Document Type Definition

-- generic embedded object -->


<!ATTLIST OBJECT
%attrs; -- %coreattrs, %i18n, %events --
declare (declare) #IMPLIED -- declare but don’t instantiate flag --
classid %URI; #IMPLIED -- identifies an implementation --
codebase %URI; #IMPLIED -- base URI for classid, data, archive--
data %URI; #IMPLIED -- reference to object’s data --
type %ContentType; #IMPLIED -- content type for data --
codetype %ContentType; #IMPLIED -- content type for code --
archive %URI; #IMPLIED -- space separated archive list --
standby %Text; #IMPLIED -- message to show while loading --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
name CDATA #IMPLIED -- submit as part of form --
tabindex NUMBER #IMPLIED -- position in tabbing order --
%reserved; -- reserved for possible future use --
>

<!ELEMENT PARAM - O EMPTY -- named property value -->


<!ATTLIST PARAM
id ID #IMPLIED -- document-wide unique id --
name CDATA #REQUIRED -- property name --
value CDATA #IMPLIED -- property value --
valuetype (DATA|REF|OBJECT) DATA -- How to interpret value --
type %ContentType; #IMPLIED -- content type for value
when valuetype=ref --
>

<!--=================== Horizontal Rule ==================================-->

<!ELEMENT HR - O EMPTY -- horizontal rule -->


<!ATTLIST HR
%coreattrs; -- id, class, style, title --
%events;
>

<!--=================== Paragraphs =======================================-->

<!ELEMENT P - O (%inline;)* -- paragraph -->


<!ATTLIST P
%attrs; -- %coreattrs, %i18n, %events --
>

<!--=================== Headings =========================================-->

<!--
There are six levels of headings from H1 (the most important)
to H6 (the least important).
-->

<!ELEMENT (%heading;) - - (%inline;)* -- heading -->


<!ATTLIST (%heading;)
%attrs; -- %coreattrs, %i18n, %events --
>

258
21 Document Type Definition

<!--=================== Preformatted Text ================================-->

<!-- excludes markup for images and changes in font size -->
<!ENTITY % [Link] "IMG|OBJECT|BIG|SMALL|SUB|SUP">

<!ELEMENT PRE - - (%inline;)* -(%[Link];) -- preformatted text -->


<!ATTLIST PRE
%attrs; -- %coreattrs, %i18n, %events --
>

<!--===================== Inline Quotes ==================================-->

<!ELEMENT Q - - (%inline;)* -- short inline quotation -->


<!ATTLIST Q
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>

<!--=================== Block-like Quotes ================================-->

<!ELEMENT BLOCKQUOTE - - (%block;|SCRIPT)+ -- long quotation -->


<!ATTLIST BLOCKQUOTE
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>

<!--=================== Inserted/Deleted Text ============================-->

<!-- INS/DEL are handled by inclusion on BODY -->


<!ELEMENT (INS|DEL) - - (%flow;)* -- inserted text, deleted text -->
<!ATTLIST (INS|DEL)
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- info on reason for change --
datetime %Datetime; #IMPLIED -- date and time of change --
>

<!--=================== Lists ============================================-->

<!-- definition lists - DT for term, DD for its definition -->

<!ELEMENT DL - - (DT|DD)+ -- definition list -->


<!ATTLIST DL
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT DT - O (%inline;)* -- definition term -->


<!ELEMENT DD - O (%flow;)* -- definition description -->
<!ATTLIST (DT|DD)
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT OL - - (LI)+ -- ordered list -->


<!ATTLIST OL
%attrs; -- %coreattrs, %i18n, %events --
>

259
21 Document Type Definition

<!-- Unordered Lists (UL) bullet styles -->


<!ELEMENT UL - - (LI)+ -- unordered list -->
<!ATTLIST UL
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT LI - O (%flow;)* -- list item -->


<!ATTLIST LI
%attrs; -- %coreattrs, %i18n, %events --
>

<!--================ Forms ===============================================-->


<!ELEMENT FORM - - (%block;|SCRIPT)+ -(FORM) -- interactive form -->
<!ATTLIST FORM
%attrs; -- %coreattrs, %i18n, %events --
action %URI; #REQUIRED -- server-side form handler --
method (GET|POST) GET -- HTTP method used to submit the form--
enctype %ContentType; "application/x-www-form-urlencoded"
onsubmit %Script; #IMPLIED -- the form was submitted --
onreset %Script; #IMPLIED -- the form was reset --
accept-charset %Charsets; #IMPLIED -- list of supported charsets --
>

<!-- Each label must not contain more than ONE field -->
<!ELEMENT LABEL - - (%inline;)* -(LABEL) -- form field label text -->
<!ATTLIST LABEL
%attrs; -- %coreattrs, %i18n, %events --
for IDREF #IMPLIED -- matches field ID value --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!ENTITY % InputType
"(TEXT | PASSWORD | CHECKBOX |
RADIO | SUBMIT | RESET |
FILE | HIDDEN | IMAGE | BUTTON)"
>

<!-- attribute name required for all but submit & reset -->
<!ELEMENT INPUT - O EMPTY -- form control -->
<!ATTLIST INPUT
%attrs; -- %coreattrs, %i18n, %events --
type %InputType; TEXT -- what kind of widget is needed --
name CDATA #IMPLIED -- submit as part of form --
value CDATA #IMPLIED -- required for radio and checkboxes --
checked (checked) #IMPLIED -- for radio buttons and check boxes --
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED -- for text and passwd --
size CDATA #IMPLIED -- specific to each type of field --
maxlength NUMBER #IMPLIED -- max chars for text fields --
src %URI; #IMPLIED -- for fields with images --
alt CDATA #IMPLIED -- short description --
usemap %URI; #IMPLIED -- use client-side image map --

260
21 Document Type Definition

tabindex NUMBER #IMPLIED -- position in tabbing order --


accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
accept %ContentTypes; #IMPLIED -- list of MIME types for file upload --
%reserved; -- reserved for possible future use --
>

<!ELEMENT SELECT - - (OPTGROUP|OPTION)+ -- option selector -->


<!ATTLIST SELECT
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED -- field name --
size NUMBER #IMPLIED -- rows visible --
multiple (multiple) #IMPLIED -- default is single selection --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onchange %Script; #IMPLIED -- the element value was changed --
%reserved; -- reserved for possible future use --
>

<!ELEMENT OPTGROUP - - (OPTION)+ -- option group -->


<!ATTLIST OPTGROUP
%attrs; -- %coreattrs, %i18n, %events --
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #REQUIRED -- for use in hierarchical menus --
>

<!ELEMENT OPTION - O (#PCDATA) -- selectable choice -->


<!ATTLIST OPTION
%attrs; -- %coreattrs, %i18n, %events --
selected (selected) #IMPLIED
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #IMPLIED -- for use in hierarchical menus --
value CDATA #IMPLIED -- defaults to element content --
>

<!ELEMENT TEXTAREA - - (#PCDATA) -- multi-line text field -->


<!ATTLIST TEXTAREA
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED
rows NUMBER #REQUIRED
cols NUMBER #REQUIRED
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
%reserved; -- reserved for possible future use --
>

261
21 Document Type Definition

<!--
#PCDATA is to solve the mixed content problem,
per specification only whitespace is allowed there!
-->
<!ELEMENT FIELDSET - - (#PCDATA,LEGEND,(%flow;)*) -- form control group -->
<!ATTLIST FIELDSET
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT LEGEND - - (%inline;)* -- fieldset legend -->


<!ENTITY % LAlign "(top|bottom|left|right)">

<!ATTLIST LEGEND
%attrs; -- %coreattrs, %i18n, %events --
accesskey %Character; #IMPLIED -- accessibility key character --
>

<!ELEMENT BUTTON - -
(%flow;)* -(A|%formctrl;|FORM|FIELDSET)
-- push button -->
<!ATTLIST BUTTON
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED
value CDATA #IMPLIED -- sent to server when submitted --
type (button|submit|reset) submit -- for use as form button --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
%reserved; -- reserved for possible future use --
>

<!--======================= Tables =======================================-->

<!-- IETF HTML table standard, see [RFC1942] -->

<!--
The BORDER attribute sets the thickness of the frame around the
table. The default units are screen pixels.

The FRAME attribute specifies which parts of the frame around


the table should be rendered. The values are not the same as
CALS to avoid a name clash with the VALIGN attribute.

The value "border" is included for backwards compatibility with


<TABLE BORDER> which yields frame=border and border=implied
For <TABLE BORDER=1> you get border=1 and frame=implied. In this
case, it is appropriate to treat this as frame=border for backwards
compatibility with deployed browsers.
-->
<!ENTITY % TFrame "(void|above|below|hsides|lhs|rhs|vsides|box|border)">

<!--
The RULES attribute defines which rules to draw between cells:

If RULES is absent then assume:

262
21 Document Type Definition

"none" if BORDER is absent or BORDER=0 otherwise "all"


-->

<!ENTITY % TRules "(none | groups | rows | cols | all)">

<!-- horizontal placement of table relative to document -->


<!ENTITY % TAlign "(left|center|right)">

<!-- horizontal alignment attributes for cell contents -->


<!ENTITY % cellhalign
"align (left|center|right|justify|char) #IMPLIED
char %Character; #IMPLIED -- alignment char, e.g. char=’:’ --
charoff %Length; #IMPLIED -- offset for alignment char --"
>

<!-- vertical alignment attributes for cell contents -->


<!ENTITY % cellvalign
"valign (top|middle|bottom|baseline) #IMPLIED"
>

<!ELEMENT TABLE - -
(CAPTION?, (COL*|COLGROUP*), THEAD?, TFOOT?, TBODY+)>
<!ELEMENT CAPTION - - (%inline;)* -- table caption -->
<!ELEMENT THEAD - O (TR)+ -- table header -->
<!ELEMENT TFOOT - O (TR)+ -- table footer -->
<!ELEMENT TBODY O O (TR)+ -- table body -->
<!ELEMENT COLGROUP - O (col)* -- table column group -->
<!ELEMENT COL - O EMPTY -- table column -->
<!ELEMENT TR - O (TH|TD)+ -- table row -->
<!ELEMENT (TH|TD) - O (%flow;)* -- table header cell, table data cell-->

<!ATTLIST TABLE -- table element --


%attrs; -- %coreattrs, %i18n, %events --
summary %Text; #IMPLIED -- purpose/structure for speech output--
width %Length; #IMPLIED -- table width --
border %Pixels; #IMPLIED -- controls frame width around table --
frame %TFrame; #IMPLIED -- which parts of frame to render --
rules %TRules; #IMPLIED -- rulings between rows and cols --
cellspacing %Length; #IMPLIED -- spacing between cells --
cellpadding %Length; #IMPLIED -- spacing within cells --
%reserved; -- reserved for possible future use --
datapagesize CDATA #IMPLIED -- reserved for possible future use --
>

<!ENTITY % CAlign "(top|bottom|left|right)">

<!ATTLIST CAPTION
%attrs; -- %coreattrs, %i18n, %events --
>

<!--
COLGROUP groups a set of COL elements. It allows you to group
several semantically related columns together.
-->
<!ATTLIST COLGROUP
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- default number of columns in group --

263
21 Document Type Definition

width %MultiLength; #IMPLIED -- default width for enclosed COLs --


%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!--
COL elements define the alignment properties for cells in
one or more columns.

The WIDTH attribute specifies the width of the columns, e.g.

width=64 width in screen pixels


width=0.5* relative width of 0.5

The SPAN attribute causes the attributes of one


COL element to apply to more than one column.
-->
<!ATTLIST COL -- column groups and properties --
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- COL attributes affect N columns --
width %MultiLength; #IMPLIED -- column width specification --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!--
Use THEAD to duplicate headers when breaking table
across page boundaries, or for static headers when
TBODY sections are rendered in scrolling panel.

Use TFOOT to duplicate footers when breaking table


across page boundaries, or for static footers when
TBODY sections are rendered in scrolling panel.

Use multiple TBODY sections when rules are needed


between groups of table rows.
-->
<!ATTLIST (THEAD|TBODY|TFOOT) -- table section --
%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!ATTLIST TR -- table row --


%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!-- Scope is simpler than axes attribute for common tables -->
<!ENTITY % Scope "(row|col|rowgroup|colgroup)">

<!-- TH is for headers, TD for data, but for cells acting as both use TD -->
<!ATTLIST (TH|TD) -- header or data cell --
%attrs; -- %coreattrs, %i18n, %events --

264
21 Document Type Definition

abbr %Text; #IMPLIED -- abbreviation for header cell --


axis CDATA #IMPLIED -- names groups of related headers--
headers IDREFS #IMPLIED -- list of id’s for header cells --
scope %Scope; #IMPLIED -- scope covered by header cells --
rowspan NUMBER 1 -- number of rows spanned by cell --
colspan NUMBER 1 -- number of cols spanned by cell --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!--================ Document Head =======================================-->


<!-- %[Link]; defined earlier on as "SCRIPT|STYLE|META|LINK|OBJECT" -->
<!ENTITY % [Link] "TITLE & BASE?">

<!ELEMENT HEAD O O (%[Link];) +(%[Link];) -- document head -->


<!ATTLIST HEAD
%i18n; -- lang, dir --
profile %URI; #IMPLIED -- named dictionary of meta info --
>

<!-- The TITLE element is not considered part of the flow of text.
It should be displayed, for example as the page header or
window title. Exactly one title is required per document.
-->
<!ELEMENT TITLE - - (#PCDATA) -(%[Link];) -- document title -->
<!ATTLIST TITLE %i18n>

<!ELEMENT BASE - O EMPTY -- document base URI -->


<!ATTLIST BASE
href %URI; #REQUIRED -- URI that acts as base URI --
>

<!ELEMENT META - O EMPTY -- generic metainformation -->


<!ATTLIST META
%i18n; -- lang, dir, for use with content --
http-equiv NAME #IMPLIED -- HTTP response header name --
name NAME #IMPLIED -- metainformation name --
content CDATA #REQUIRED -- associated information --
scheme CDATA #IMPLIED -- select form of content --
>

<!ELEMENT STYLE - - %StyleSheet -- style info -->


<!ATTLIST STYLE
%i18n; -- lang, dir, for use with title --
type %ContentType; #REQUIRED -- content type of style language --
media %MediaDesc; #IMPLIED -- designed for use with these media --
title %Text; #IMPLIED -- advisory title --
>

<!ELEMENT SCRIPT - - %Script; -- script statements -->


<!ATTLIST SCRIPT
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #REQUIRED -- content type of script language --
src %URI; #IMPLIED -- URI for an external script --
defer (defer) #IMPLIED -- UA may defer execution of script --

265
21 Document Type Definition

event CDATA #IMPLIED -- reserved for possible future use --


for %URI; #IMPLIED -- reserved for possible future use --
>

<!ELEMENT NOSCRIPT - - (%block;)+


-- alternate content container for non script-based rendering -->
<!ATTLIST NOSCRIPT
%attrs; -- %coreattrs, %i18n, %events --
>

<!--================ Document Structure ==================================-->


<!ENTITY % [Link] "HEAD, BODY">

<!ELEMENT HTML O O (%[Link];) -- document root element -->


<!ATTLIST HTML
%i18n; -- lang, dir --
>

266
22 Transitional Document Type Definition

22 Transitional Document Type Definition


<!--
This is the HTML 4.0 Transitional DTD, which includes
presentation attributes and elements that W3C expects to phase out
as support for style sheets matures. Authors should use the Strict
DTD when possible, but may use the Transitional DTD when support
for presentation attribute and elements is required.

HTML 4.0 includes mechanisms for style sheets, scripting,


embedding objects, improved support for right to left and mixed
direction text, and enhancements to forms for improved
accessibility for people with disabilities.

Draft: $Date: 1998/04/02 00:17:00 $

Authors:
Dave Raggett <dsr@[Link]>
Arnaud Le Hors <lehors@[Link]>
Ian Jacobs <ij@[Link]>

Further information about HTML 4.0 is available at:

[Link]
-->
<!ENTITY % [Link] "-//W3C//DTD HTML 4.0 Transitional//EN"
-- Typical usage:

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN"


"[Link]
<html>
<head>
...
</head>
<body>
...
</body>
</html>

The URI used as a system identifier with the public identifier allows
the user agent to download the DTD and entity sets as needed.

The FPI for the Strict HTML 4.0 DTD is:

"-//W3C//DTD HTML 4.0//EN"

and its URI is:

[Link]

Authors should use the Strict DTD unless they need the
presentation control for user agents that don’t (adequately)
support style sheets.

If you are writing a document that includes frames, use


the following FPI:

267
22 Transitional Document Type Definition

"-//W3C//DTD HTML 4.0 Frameset//EN"

with the URI:

[Link]

The following URIs are supported in relation to HTML 4.0

"[Link] (Strict DTD)


"[Link] (Loose DTD)
"[Link] (Frameset DTD)
"[Link] (Latin-1 entities)
"[Link] (Symbol entities)
"[Link] (Special entities)

These URIs point to the latest version of each file. To reference


this specific revision use the following URIs:

"[Link]
"[Link]
"[Link]
"[Link]
"[Link]
"[Link]

-->

<!--================== Imported Names ====================================-->

<!ENTITY % ContentType "CDATA"


-- media type, as per [RFC2045]
-->

<!ENTITY % ContentTypes "CDATA"


-- comma-separated list of media types, as per [RFC2045]
-->

<!ENTITY % Charset "CDATA"


-- a character encoding, as per [RFC2045]
-->

<!ENTITY % Charsets "CDATA"


-- a space separated list of character encodings, as per [RFC2045]
-->

<!ENTITY % LanguageCode "NAME"


-- a language code, as per [RFC1766]
-->

<!ENTITY % Character "CDATA"


-- a single character from [ISO10646]
-->

<!ENTITY % LinkTypes "CDATA"


-- space-separated list of link types
-->

268
22 Transitional Document Type Definition

<!ENTITY % MediaDesc "CDATA"


-- single or comma-separated list of media descriptors
-->

<!ENTITY % URI "CDATA"


-- a Uniform Resource Identifier,
see [URI]
-->

<!ENTITY % Datetime "CDATA" -- date and time information. ISO date format -->

<!ENTITY % Script "CDATA" -- script expression -->

<!ENTITY % StyleSheet "CDATA" -- style sheet data -->

<!ENTITY % FrameTarget "CDATA" -- render in this frame -->

<!ENTITY % Text "CDATA">

<!-- Parameter Entities -->

<!ENTITY % [Link] "SCRIPT|STYLE|META|LINK|OBJECT" -- repeatable head elements -->

<!ENTITY % heading "H1|H2|H3|H4|H5|H6">

<!ENTITY % list "UL | OL | DIR | MENU">

<!ENTITY % preformatted "PRE">

<!ENTITY % Color "CDATA" -- a color using sRGB: #RRGGBB as Hex values -->

<!-- There are also 16 widely known color names with their sRGB values:

Black = #000000 Green = #008000


Silver = #C0C0C0 Lime = #00FF00
Gray = #808080 Olive = #808000
White = #FFFFFF Yellow = #FFFF00
Maroon = #800000 Navy = #000080
Red = #FF0000 Blue = #0000FF
Purple = #800080 Teal = #008080
Fuchsia= #FF00FF Aqua = #00FFFF
-->

<!ENTITY % bodycolors "


bgcolor %Color; #IMPLIED -- document background color --
text %Color; #IMPLIED -- document text color --
link %Color; #IMPLIED -- color of links --
vlink %Color; #IMPLIED -- color of visited links --
alink %Color; #IMPLIED -- color of selected links --
">

<!--================ Character mnemonic entities =========================-->

269
22 Transitional Document Type Definition

<!ENTITY % HTMLlat1 PUBLIC


"-//W3C//ENTITIES Latin1//EN//HTML"
"[Link]
%HTMLlat1;

<!ENTITY % HTMLsymbol PUBLIC


"-//W3C//ENTITIES Symbols//EN//HTML"
"[Link]
%HTMLsymbol;

<!ENTITY % HTMLspecial PUBLIC


"-//W3C//ENTITIES Special//EN//HTML"
"[Link]
%HTMLspecial;
<!--=================== Generic Attributes ===============================-->

<!ENTITY % coreattrs
"id ID #IMPLIED -- document-wide unique id --
class CDATA #IMPLIED -- space separated list of classes --
style %StyleSheet; #IMPLIED -- associated style info --
title %Text; #IMPLIED -- advisory title/amplification --"
>

<!ENTITY % i18n
"lang %LanguageCode; #IMPLIED -- language code --
dir (ltr|rtl) #IMPLIED -- direction for weak/neutral text --"
>

<!ENTITY % events
"onclick %Script; #IMPLIED -- a pointer button was clicked --
ondblclick %Script; #IMPLIED -- a pointer button was double clicked--
onmousedown %Script; #IMPLIED -- a pointer button was pressed down --
onmouseup %Script; #IMPLIED -- a pointer button was released --
onmouseover %Script; #IMPLIED -- a pointer was moved onto --
onmousemove %Script; #IMPLIED -- a pointer was moved within --
onmouseout %Script; #IMPLIED -- a pointer was moved away --
onkeypress %Script; #IMPLIED -- a key was pressed and released --
onkeydown %Script; #IMPLIED -- a key was pressed down --
onkeyup %Script; #IMPLIED -- a key was released --"
>

<!-- Reserved Feature Switch -->


<!ENTITY % [Link] "IGNORE">

<!-- The following attributes are reserved for possible future use -->
<![ %[Link]; [
<!ENTITY % reserved
"datasrc %URI; #IMPLIED -- a single or tabular Data Source --
datafld CDATA #IMPLIED -- the property or column name --
dataformatas (plaintext|html) plaintext -- text or html --"
>
]]>

<!ENTITY % reserved "">

<!ENTITY % attrs "%coreattrs; %i18n; %events;">

270
22 Transitional Document Type Definition

<!ENTITY % align "align (left|center|right|justify) #IMPLIED"


-- default is left for ltr paragraphs, right for rtl --
>

<!--=================== Text Markup ======================================-->

<!ENTITY % fontstyle
"TT | I | B | U | S | STRIKE | BIG | SMALL">

<!ENTITY % phrase "EM | STRONG | DFN | CODE |


SAMP | KBD | VAR | CITE | ABBR | ACRONYM" >

<!ENTITY % special
"A | IMG | APPLET | OBJECT | FONT | BASEFONT | BR | SCRIPT |
MAP | Q | SUB | SUP | SPAN | BDO | IFRAME">

<!ENTITY % formctrl "INPUT | SELECT | TEXTAREA | LABEL | BUTTON">

<!-- %inline; covers inline or "text-level" elements -->


<!ENTITY % inline "#PCDATA | %fontstyle; | %phrase; | %special; | %formctrl;">

<!ELEMENT (%fontstyle;|%phrase;) - - (%inline;)*>


<!ATTLIST (%fontstyle;|%phrase;)
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT (SUB|SUP) - - (%inline;)* -- subscript, superscript -->


<!ATTLIST (SUB|SUP)
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT SPAN - - (%inline;)* -- generic language/style container -->


<!ATTLIST SPAN
%attrs; -- %coreattrs, %i18n, %events --
%reserved; -- reserved for possible future use --
>

<!ELEMENT BDO - - (%inline;)* -- I18N BiDi over-ride -->


<!ATTLIST BDO
%coreattrs; -- id, class, style, title --
lang %LanguageCode; #IMPLIED -- language code --
dir (ltr|rtl) #REQUIRED -- directionality --
>

<!ELEMENT BASEFONT - O EMPTY -- base font size -->


<!ATTLIST BASEFONT
id ID #IMPLIED -- document-wide unique id --
size CDATA #REQUIRED -- base font size for FONT elements --
color %Color; #IMPLIED -- text color --
face CDATA #IMPLIED -- comma separated list of font names --
>

<!ELEMENT FONT - - (%inline;)* -- local change to font -->


<!ATTLIST FONT
%coreattrs; -- id, class, style, title --
%i18n; -- lang, dir --
size CDATA #IMPLIED -- [+|-]nn e.g. size="+1", size="4" --

271
22 Transitional Document Type Definition

color %Color; #IMPLIED -- text color --


face CDATA #IMPLIED -- comma separated list of font names --
>

<!ELEMENT BR - O EMPTY -- forced line break -->


<!ATTLIST BR
%coreattrs; -- id, class, style, title --
clear (left|all|right|none) none -- control of text flow --
>

<!--================== HTML content models ===============================-->

<!--
HTML has two basic content models:

%inline; character level elements and text strings


%block; block-like elements e.g. paragraphs and lists
-->

<!ENTITY % block
"P | %heading; | %list; | %preformatted; | DL | DIV | CENTER |
NOSCRIPT | NOFRAMES | BLOCKQUOTE | FORM | ISINDEX | HR |
TABLE | FIELDSET | ADDRESS">

<!ENTITY % flow "%block; | %inline;">

<!--=================== Document Body ====================================-->

<!ELEMENT BODY O O (%flow;)* +(INS|DEL) -- document body -->


<!ATTLIST BODY
%attrs; -- %coreattrs, %i18n, %events --
onload %Script; #IMPLIED -- the document has been loaded --
onunload %Script; #IMPLIED -- the document has been removed --
background %URI; #IMPLIED -- texture tile for document
background --
%bodycolors; -- bgcolor, text, link, vlink, alink --
>

<!ELEMENT ADDRESS - - ((%inline;)|P)* -- information on author -->


<!ATTLIST ADDRESS
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT DIV - - (%flow;)* -- generic language/style container -->


<!ATTLIST DIV
%attrs; -- %coreattrs, %i18n, %events --
%align; -- align, text alignment --
%reserved; -- reserved for possible future use --
>

<!ELEMENT CENTER - - (%flow;)* -- shorthand for DIV align=center -->


<!ATTLIST CENTER
%attrs; -- %coreattrs, %i18n, %events --
>

<!--================== The Anchor Element ================================-->

272
22 Transitional Document Type Definition

<!ENTITY % Shape "(rect|circle|poly|default)">


<!ENTITY % Coords "CDATA" -- comma separated list of lengths -->

<!ELEMENT A - - (%inline;)* -(A) -- anchor -->


<!ATTLIST A
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #IMPLIED -- advisory content type --
name CDATA #IMPLIED -- named link end --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
target %FrameTarget; #IMPLIED -- render in this frame --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
accesskey %Character; #IMPLIED -- accessibility key character --
shape %Shape; rect -- for use with client-side image maps --
coords %Coords; #IMPLIED -- for use with client-side image maps --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!--================== Client-side image maps ============================-->

<!-- These can be placed in the same document or grouped in a


separate document although this isn’t yet widely supported -->

<!ELEMENT MAP - - ((%block;)+ | AREA+) -- client-side image map -->


<!ATTLIST MAP
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #REQUIRED -- for reference by usemap --
>

<!ELEMENT AREA - O EMPTY -- client-side image map area -->


<!ATTLIST AREA
%attrs; -- %coreattrs, %i18n, %events --
shape %Shape; rect -- controls interpretation of coords --
coords %Coords; #IMPLIED -- comma separated list of lengths --
href %URI; #IMPLIED -- URI for linked resource --
target %FrameTarget; #IMPLIED -- render in this frame --
nohref (nohref) #IMPLIED -- this region has no action --
alt %Text; #REQUIRED -- short description --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!--================== The LINK Element ==================================-->

<!--
Relationship values can be used in principle:

a) for document specific toolbars/menus when used


with the LINK element in document head e.g.
start, contents, previous, next, index, end, help
b) to link to a separate style sheet (rel=stylesheet)

273
22 Transitional Document Type Definition

c) to make a link to a script (rel=script)


d) by stylesheets to control how collections of
html nodes are rendered into printed documents
e) to make a link to a printable version of this document
e.g. a postscript or pdf version (rel=alternate media=print)
-->

<!ELEMENT LINK - O EMPTY -- a media-independent link -->


<!ATTLIST LINK
%attrs; -- %coreattrs, %i18n, %events --
charset %Charset; #IMPLIED -- char encoding of linked resource --
href %URI; #IMPLIED -- URI for linked resource --
hreflang %LanguageCode; #IMPLIED -- language code --
type %ContentType; #IMPLIED -- advisory content type --
rel %LinkTypes; #IMPLIED -- forward link types --
rev %LinkTypes; #IMPLIED -- reverse link types --
media %MediaDesc; #IMPLIED -- for rendering on these media --
target %FrameTarget; #IMPLIED -- render in this frame --
>

<!--=================== Images ===========================================-->

<!-- Length defined in strict DTD for cellpadding/cellspacing -->


<!ENTITY % Length "CDATA" -- nn for pixels or nn% for percentage length -->
<!ENTITY % MultiLength "CDATA" -- pixel, percentage, or relative -->

<!ENTITY % MultiLengths "CDATA" -- comma-separated list of MultiLength -->

<!ENTITY % Pixels "CDATA" -- integer representing length in pixels -->

<!ENTITY % IAlign "(top|middle|bottom|left|right)" -- center? -->

<!-- To avoid problems with text-only UAs as well as


to make image content understandable and navigable
to users of non-visual UAs, you need to provide
a description with ALT, and avoid server-side image maps -->
<!ELEMENT IMG - O EMPTY -- Embedded image -->
<!ATTLIST IMG
%attrs; -- %coreattrs, %i18n, %events --
src %URI; #REQUIRED -- URI of image to embed --
alt %Text; #REQUIRED -- short description --
longdesc %URI; #IMPLIED -- link to long description
(complements alt) --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
ismap (ismap) #IMPLIED -- use server-side image map --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --
border %Length; #IMPLIED -- link border width --
hspace %Pixels; #IMPLIED -- horizontal gutter --
vspace %Pixels; #IMPLIED -- vertical gutter --
>

<!-- USEMAP points to a MAP element which may be in this document


or an external document, although the latter is not widely supported -->

<!--==================== OBJECT ======================================-->

274
22 Transitional Document Type Definition

<!--
OBJECT is used to embed objects as part of HTML pages
PARAM elements should precede other content. SGML mixed content
model technicality precludes specifying this formally ...
-->

<!ELEMENT OBJECT - - (PARAM | %flow;)*


-- generic embedded object -->
<!ATTLIST OBJECT
%attrs; -- %coreattrs, %i18n, %events --
declare (declare) #IMPLIED -- declare but don’t instantiate flag --
classid %URI; #IMPLIED -- identifies an implementation --
codebase %URI; #IMPLIED -- base URI for classid, data, archive--
data %URI; #IMPLIED -- reference to object’s data --
type %ContentType; #IMPLIED -- content type for data --
codetype %ContentType; #IMPLIED -- content type for code --
archive %URI; #IMPLIED -- space separated archive list --
standby %Text; #IMPLIED -- message to show while loading --
height %Length; #IMPLIED -- override height --
width %Length; #IMPLIED -- override width --
usemap %URI; #IMPLIED -- use client-side image map --
name CDATA #IMPLIED -- submit as part of form --
tabindex NUMBER #IMPLIED -- position in tabbing order --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --
border %Length; #IMPLIED -- link border width --
hspace %Pixels; #IMPLIED -- horizontal gutter --
vspace %Pixels; #IMPLIED -- vertical gutter --
%reserved; -- reserved for possible future use --
>

<!ELEMENT PARAM - O EMPTY -- named property value -->


<!ATTLIST PARAM
id ID #IMPLIED -- document-wide unique id --
name CDATA #REQUIRED -- property name --
value CDATA #IMPLIED -- property value --
valuetype (DATA|REF|OBJECT) DATA -- How to interpret value --
type %ContentType; #IMPLIED -- content type for value
when valuetype=ref --
>

<!--=================== Java APPLET ==================================-->


<!--
One of code or object attributes must be present.
Place PARAM elements before other content.
-->
<!ELEMENT APPLET - - (PARAM | %flow;)* -- Java applet -->
<!ATTLIST APPLET
%coreattrs; -- id, class, style, title --
codebase %URI; #IMPLIED -- optional base URI for applet --
archive CDATA #IMPLIED -- comma separated archive list --
code CDATA #IMPLIED -- applet class file --
object CDATA #IMPLIED -- serialized applet file --
alt %Text; #IMPLIED -- short description --
name CDATA #IMPLIED -- allows applets to find each other --
width %Length; #REQUIRED -- initial width --
height %Length; #REQUIRED -- initial height --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --

275
22 Transitional Document Type Definition

hspace %Pixels; #IMPLIED -- horizontal gutter --


vspace %Pixels; #IMPLIED -- vertical gutter --
>

<!--=================== Horizontal Rule ==================================-->

<!ELEMENT HR - O EMPTY -- horizontal rule -->


<!ATTLIST HR
%coreattrs; -- id, class, style, title --
%events;
align (left|center|right) #IMPLIED
noshade (noshade) #IMPLIED
size %Pixels; #IMPLIED
width %Length; #IMPLIED
>

<!--=================== Paragraphs =======================================-->

<!ELEMENT P - O (%inline;)* -- paragraph -->


<!ATTLIST P
%attrs; -- %coreattrs, %i18n, %events --
%align; -- align, text alignment --
>

<!--=================== Headings =========================================-->

<!--
There are six levels of headings from H1 (the most important)
to H6 (the least important).
-->

<!ELEMENT (%heading;) - - (%inline;)* -- heading -->


<!ATTLIST (%heading;)
%attrs; -- %coreattrs, %i18n, %events --
%align; -- align, text alignment --
>

<!--=================== Preformatted Text ================================-->

<!-- excludes markup for images and changes in font size -->
<!ENTITY % [Link] "IMG|OBJECT|APPLET|BIG|SMALL|SUB|SUP|FONT|BASEFONT">

<!ELEMENT PRE - - (%inline;)* -(%[Link];) -- preformatted text -->


<!ATTLIST PRE
%attrs; -- %coreattrs, %i18n, %events --
width NUMBER #IMPLIED
>

<!--===================== Inline Quotes ==================================-->

<!ELEMENT Q - - (%inline;)* -- short inline quotation -->


<!ATTLIST Q
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>

<!--=================== Block-like Quotes ================================-->

276
22 Transitional Document Type Definition

<!ELEMENT BLOCKQUOTE - - (%flow;)* -- long quotation -->


<!ATTLIST BLOCKQUOTE
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- URI for source document or msg --
>

<!--=================== Inserted/Deleted Text ============================-->

<!-- INS/DEL are handled by inclusion on BODY -->


<!ELEMENT (INS|DEL) - - (%flow;)* -- inserted text, deleted text -->
<!ATTLIST (INS|DEL)
%attrs; -- %coreattrs, %i18n, %events --
cite %URI; #IMPLIED -- info on reason for change --
datetime %Datetime; #IMPLIED -- date and time of change --
>

<!--=================== Lists ============================================-->

<!-- definition lists - DT for term, DD for its definition -->

<!ELEMENT DL - - (DT|DD)+ -- definition list -->


<!ATTLIST DL
%attrs; -- %coreattrs, %i18n, %events --
compact (compact) #IMPLIED -- reduced interitem spacing --
>

<!ELEMENT DT - O (%inline;)* -- definition term -->


<!ELEMENT DD - O (%flow;)* -- definition description -->
<!ATTLIST (DT|DD)
%attrs; -- %coreattrs, %i18n, %events --
>

<!-- Ordered lists (OL) Numbering style

1 arablic numbers 1, 2, 3, ...


a lower alpha a, b, c, ...
A upper alpha A, B, C, ...
i lower roman i, ii, iii, ...
I upper roman I, II, III, ...

The style is applied to the sequence number which by default


is reset to 1 for the first list item in an ordered list.

This can’t be expressed directly in SGML due to case folding.


-->

<!ENTITY % OLStyle "CDATA" -- constrained to: "(1|a|A|i|I)" -->

<!ELEMENT OL - - (LI)+ -- ordered list -->


<!ATTLIST OL
%attrs; -- %coreattrs, %i18n, %events --
type %OLStyle; #IMPLIED -- numbering style --
compact (compact) #IMPLIED -- reduced interitem spacing --
start NUMBER #IMPLIED -- starting sequence number --
>

277
22 Transitional Document Type Definition

<!-- Unordered Lists (UL) bullet styles -->


<!ENTITY % ULStyle "(disc|square|circle)">

<!ELEMENT UL - - (LI)+ -- unordered list -->


<!ATTLIST UL
%attrs; -- %coreattrs, %i18n, %events --
type %ULStyle; #IMPLIED -- bullet style --
compact (compact) #IMPLIED -- reduced interitem spacing --
>

<!ELEMENT (DIR|MENU) - - (LI)+ -(%block;) -- directory list, menu list -->


<!ATTLIST DIR
%attrs; -- %coreattrs, %i18n, %events --
compact (compact) #IMPLIED
>
<!ATTLIST MENU
%attrs; -- %coreattrs, %i18n, %events --
compact (compact) #IMPLIED
>

<!ENTITY % LIStyle "CDATA" -- constrained to: "(%ULStyle;|%OLStyle;)" -->

<!ELEMENT LI - O (%flow;)* -- list item -->


<!ATTLIST LI
%attrs; -- %coreattrs, %i18n, %events --
type %LIStyle; #IMPLIED -- list item style --
value NUMBER #IMPLIED -- reset sequence number --
>

<!--================ Forms ===============================================-->


<!ELEMENT FORM - - (%flow;)* -(FORM) -- interactive form -->
<!ATTLIST FORM
%attrs; -- %coreattrs, %i18n, %events --
action %URI; #REQUIRED -- server-side form handler --
method (GET|POST) GET -- HTTP method used to submit the form--
enctype %ContentType; "application/x-www-form-urlencoded"
onsubmit %Script; #IMPLIED -- the form was submitted --
onreset %Script; #IMPLIED -- the form was reset --
target %FrameTarget; #IMPLIED -- render in this frame --
accept-charset %Charsets; #IMPLIED -- list of supported charsets --
>

<!-- Each label must not contain more than ONE field -->
<!ELEMENT LABEL - - (%inline;)* -(LABEL) -- form field label text -->
<!ATTLIST LABEL
%attrs; -- %coreattrs, %i18n, %events --
for IDREF #IMPLIED -- matches field ID value --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
>

<!ENTITY % InputType
"(TEXT | PASSWORD | CHECKBOX |
RADIO | SUBMIT | RESET |
FILE | HIDDEN | IMAGE | BUTTON)"

278
22 Transitional Document Type Definition

>

<!-- attribute name required for all but submit & reset -->
<!ELEMENT INPUT - O EMPTY -- form control -->
<!ATTLIST INPUT
%attrs; -- %coreattrs, %i18n, %events --
type %InputType; TEXT -- what kind of widget is needed --
name CDATA #IMPLIED -- submit as part of form --
value CDATA #IMPLIED -- required for radio and checkboxes --
checked (checked) #IMPLIED -- for radio buttons and check boxes --
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED -- for text and passwd --
size CDATA #IMPLIED -- specific to each type of field --
maxlength NUMBER #IMPLIED -- max chars for text fields --
src %URI; #IMPLIED -- for fields with images --
alt CDATA #IMPLIED -- short description --
usemap %URI; #IMPLIED -- use client-side image map --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
accept %ContentTypes; #IMPLIED -- list of MIME types for file upload --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --
%reserved; -- reserved for possible future use --
>

<!ELEMENT SELECT - - (OPTGROUP|OPTION)+ -- option selector -->


<!ATTLIST SELECT
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED -- field name --
size NUMBER #IMPLIED -- rows visible --
multiple (multiple) #IMPLIED -- default is single selection --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onchange %Script; #IMPLIED -- the element value was changed --
%reserved; -- reserved for possible future use --
>

<!ELEMENT OPTGROUP - - (OPTION)+ -- option group -->


<!ATTLIST OPTGROUP
%attrs; -- %coreattrs, %i18n, %events --
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #REQUIRED -- for use in hierarchical menus --
>

<!ELEMENT OPTION - O (#PCDATA) -- selectable choice -->


<!ATTLIST OPTION
%attrs; -- %coreattrs, %i18n, %events --
selected (selected) #IMPLIED
disabled (disabled) #IMPLIED -- unavailable in this context --
label %Text; #IMPLIED -- for use in hierarchical menus --
value CDATA #IMPLIED -- defaults to element content --
>

279
22 Transitional Document Type Definition

<!ELEMENT TEXTAREA - - (#PCDATA) -- multi-line text field -->


<!ATTLIST TEXTAREA
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED
rows NUMBER #REQUIRED
cols NUMBER #REQUIRED
disabled (disabled) #IMPLIED -- unavailable in this context --
readonly (readonly) #IMPLIED
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
onselect %Script; #IMPLIED -- some text was selected --
onchange %Script; #IMPLIED -- the element value was changed --
%reserved; -- reserved for possible future use --
>

<!--
#PCDATA is to solve the mixed content problem,
per specification only whitespace is allowed there!
-->
<!ELEMENT FIELDSET - - (#PCDATA,LEGEND,(%flow;)*) -- form control group -->
<!ATTLIST FIELDSET
%attrs; -- %coreattrs, %i18n, %events --
>

<!ELEMENT LEGEND - - (%inline;)* -- fieldset legend -->


<!ENTITY % LAlign "(top|bottom|left|right)">

<!ATTLIST LEGEND
%attrs; -- %coreattrs, %i18n, %events --
accesskey %Character; #IMPLIED -- accessibility key character --
align %LAlign; #IMPLIED -- relative to fieldset --
>

<!ELEMENT BUTTON - -
(%flow;)* -(A|%formctrl;|FORM|ISINDEX|FIELDSET|IFRAME)
-- push button -->
<!ATTLIST BUTTON
%attrs; -- %coreattrs, %i18n, %events --
name CDATA #IMPLIED
value CDATA #IMPLIED -- sent to server when submitted --
type (button|submit|reset) submit -- for use as form button --
disabled (disabled) #IMPLIED -- unavailable in this context --
tabindex NUMBER #IMPLIED -- position in tabbing order --
accesskey %Character; #IMPLIED -- accessibility key character --
onfocus %Script; #IMPLIED -- the element got the focus --
onblur %Script; #IMPLIED -- the element lost the focus --
%reserved; -- reserved for possible future use --
>

<!--======================= Tables =======================================-->

<!-- IETF HTML table standard, see [RFC1942] -->

<!--

280
22 Transitional Document Type Definition

The BORDER attribute sets the thickness of the frame around the
table. The default units are screen pixels.

The FRAME attribute specifies which parts of the frame around


the table should be rendered. The values are not the same as
CALS to avoid a name clash with the VALIGN attribute.

The value "border" is included for backwards compatibility with


<TABLE BORDER> which yields frame=border and border=implied
For <TABLE BORDER=1> you get border=1 and frame=implied. In this
case, it is appropriate to treat this as frame=border for backwards
compatibility with deployed browsers.
-->
<!ENTITY % TFrame "(void|above|below|hsides|lhs|rhs|vsides|box|border)">

<!--
The RULES attribute defines which rules to draw between cells:

If RULES is absent then assume:


"none" if BORDER is absent or BORDER=0 otherwise "all"
-->

<!ENTITY % TRules "(none | groups | rows | cols | all)">

<!-- horizontal placement of table relative to document -->


<!ENTITY % TAlign "(left|center|right)">

<!-- horizontal alignment attributes for cell contents -->


<!ENTITY % cellhalign
"align (left|center|right|justify|char) #IMPLIED
char %Character; #IMPLIED -- alignment char, e.g. char=’:’ --
charoff %Length; #IMPLIED -- offset for alignment char --"
>

<!-- vertical alignment attributes for cell contents -->


<!ENTITY % cellvalign
"valign (top|middle|bottom|baseline) #IMPLIED"
>

<!ELEMENT TABLE - -
(CAPTION?, (COL*|COLGROUP*), THEAD?, TFOOT?, TBODY+)>
<!ELEMENT CAPTION - - (%inline;)* -- table caption -->
<!ELEMENT THEAD - O (TR)+ -- table header -->
<!ELEMENT TFOOT - O (TR)+ -- table footer -->
<!ELEMENT TBODY O O (TR)+ -- table body -->
<!ELEMENT COLGROUP - O (col)* -- table column group -->
<!ELEMENT COL - O EMPTY -- table column -->
<!ELEMENT TR - O (TH|TD)+ -- table row -->
<!ELEMENT (TH|TD) - O (%flow;)* -- table header cell, table data cell-->

<!ATTLIST TABLE -- table element --


%attrs; -- %coreattrs, %i18n, %events --
summary %Text; #IMPLIED -- purpose/structure for speech output--
width %Length; #IMPLIED -- table width --
border %Pixels; #IMPLIED -- controls frame width around table --
frame %TFrame; #IMPLIED -- which parts of frame to render --
rules %TRules; #IMPLIED -- rulings between rows and cols --

281
22 Transitional Document Type Definition

cellspacing %Length; #IMPLIED -- spacing between cells --


cellpadding %Length; #IMPLIED -- spacing within cells --
align %TAlign; #IMPLIED -- table position relative to window --
bgcolor %Color; #IMPLIED -- background color for cells --
%reserved; -- reserved for possible future use --
datapagesize CDATA #IMPLIED -- reserved for possible future use --
>

<!ENTITY % CAlign "(top|bottom|left|right)">

<!ATTLIST CAPTION
%attrs; -- %coreattrs, %i18n, %events --
align %CAlign; #IMPLIED -- relative to table --
>

<!--
COLGROUP groups a set of COL elements. It allows you to group
several semantically related columns together.
-->
<!ATTLIST COLGROUP
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- default number of columns in group --
width %MultiLength; #IMPLIED -- default width for enclosed COLs --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!--
COL elements define the alignment properties for cells in
one or more columns.

The WIDTH attribute specifies the width of the columns, e.g.

width=64 width in screen pixels


width=0.5* relative width of 0.5

The SPAN attribute causes the attributes of one


COL element to apply to more than one column.
-->
<!ATTLIST COL -- column groups and properties --
%attrs; -- %coreattrs, %i18n, %events --
span NUMBER 1 -- COL attributes affect N columns --
width %MultiLength; #IMPLIED -- column width specification --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!--
Use THEAD to duplicate headers when breaking table
across page boundaries, or for static headers when
TBODY sections are rendered in scrolling panel.

Use TFOOT to duplicate footers when breaking table


across page boundaries, or for static footers when
TBODY sections are rendered in scrolling panel.

Use multiple TBODY sections when rules are needed

282
22 Transitional Document Type Definition

between groups of table rows.


-->
<!ATTLIST (THEAD|TBODY|TFOOT) -- table section --
%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
>

<!ATTLIST TR -- table row --


%attrs; -- %coreattrs, %i18n, %events --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
bgcolor %Color; #IMPLIED -- background color for row --
>

<!-- Scope is simpler than axes attribute for common tables -->
<!ENTITY % Scope "(row|col|rowgroup|colgroup)">

<!-- TH is for headers, TD for data, but for cells acting as both use TD -->
<!ATTLIST (TH|TD) -- header or data cell --
%attrs; -- %coreattrs, %i18n, %events --
abbr %Text; #IMPLIED -- abbreviation for header cell --
axis CDATA #IMPLIED -- names groups of related headers--
headers IDREFS #IMPLIED -- list of id’s for header cells --
scope %Scope; #IMPLIED -- scope covered by header cells --
rowspan NUMBER 1 -- number of rows spanned by cell --
colspan NUMBER 1 -- number of cols spanned by cell --
%cellhalign; -- horizontal alignment in cells --
%cellvalign; -- vertical alignment in cells --
nowrap (nowrap) #IMPLIED -- suppress word wrap --
bgcolor %Color; #IMPLIED -- cell background color --
width %Pixels; #IMPLIED -- width for cell --
height %Pixels; #IMPLIED -- height for cell --
>

<!--================== Document Frames ===================================-->

<!--
The content model for HTML documents depends on whether the HEAD is
followed by a FRAMESET or BODY element. The widespread omission of
the BODY start tag makes it impractical to define the content model
without the use of a marked section.
-->

<!-- Feature Switch for frameset documents -->


<!ENTITY % [Link] "IGNORE">

<![ %[Link]; [
<!ELEMENT FRAMESET - - ((FRAMESET|FRAME)+ & NOFRAMES?) -- window subdivision-->
<!ATTLIST FRAMESET
%coreattrs; -- id, class, style, title --
rows %MultiLengths; #IMPLIED -- list of lengths,
default: 100% (1 row) --
cols %MultiLengths; #IMPLIED -- list of lengths,
default: 100% (1 col) --

283
22 Transitional Document Type Definition

onload %Script; #IMPLIED -- all the frames have been loaded --


onunload %Script; #IMPLIED -- all the frames have been removed --
>
]]>

<![ %[Link]; [
<!-- reserved frame names start with "_" otherwise starts with letter -->
<!ELEMENT FRAME - O EMPTY -- subwindow -->
<!ATTLIST FRAME
%coreattrs; -- id, class, style, title --
longdesc %URI; #IMPLIED -- link to long description
(complements title) --
name CDATA #IMPLIED -- name of frame for targetting --
src %URI; #IMPLIED -- source of frame content --
frameborder (1|0) 1 -- request frame borders? --
marginwidth %Pixels; #IMPLIED -- margin widths in pixels --
marginheight %Pixels; #IMPLIED -- margin height in pixels --
noresize (noresize) #IMPLIED -- allow users to resize frames? --
scrolling (yes|no|auto) auto -- scrollbar or none --
>
]]>

<!ELEMENT IFRAME - - (%flow;)* -- inline subwindow -->


<!ATTLIST IFRAME
%coreattrs; -- id, class, style, title --
longdesc %URI; #IMPLIED -- link to long description
(complements title) --
name CDATA #IMPLIED -- name of frame for targetting --
src %URI; #IMPLIED -- source of frame content --
frameborder (1|0) 1 -- request frame borders? --
marginwidth %Pixels; #IMPLIED -- margin widths in pixels --
marginheight %Pixels; #IMPLIED -- margin height in pixels --
scrolling (yes|no|auto) auto -- scrollbar or none --
align %IAlign; #IMPLIED -- vertical or horizontal alignment --
height %Length; #IMPLIED -- frame height --
width %Length; #IMPLIED -- frame width --
>

<![ %[Link]; [
<!ENTITY % [Link] "(BODY) -(NOFRAMES)">
]]>

<!ENTITY % [Link] "(%flow;)*">

<!ELEMENT NOFRAMES - - %[Link];


-- alternate content container for non frame-based rendering -->
<!ATTLIST NOFRAMES
%attrs; -- %coreattrs, %i18n, %events --
>

<!--================ Document Head =======================================-->


<!-- %[Link]; defined earlier on as "SCRIPT|STYLE|META|LINK|OBJECT" -->
<!ENTITY % [Link] "TITLE & ISINDEX? & BASE?">

<!ELEMENT HEAD O O (%[Link];) +(%[Link];) -- document head -->


<!ATTLIST HEAD
%i18n; -- lang, dir --

284
22 Transitional Document Type Definition

profile %URI; #IMPLIED -- named dictionary of meta info --


>

<!-- The TITLE element is not considered part of the flow of text.
It should be displayed, for example as the page header or
window title. Exactly one title is required per document.
-->
<!ELEMENT TITLE - - (#PCDATA) -(%[Link];) -- document title -->
<!ATTLIST TITLE %i18n>

<!ELEMENT ISINDEX - O EMPTY -- single line prompt -->


<!ATTLIST ISINDEX
%coreattrs; -- id, class, style, title --
%i18n; -- lang, dir --
prompt %Text; #IMPLIED -- prompt message -->

<!ELEMENT BASE - O EMPTY -- document base URI -->


<!ATTLIST BASE
href %URI; #IMPLIED -- URI that acts as base URI --
target %FrameTarget; #IMPLIED -- render in this frame --
>

<!ELEMENT META - O EMPTY -- generic metainformation -->


<!ATTLIST META
%i18n; -- lang, dir, for use with content --
http-equiv NAME #IMPLIED -- HTTP response header name --
name NAME #IMPLIED -- metainformation name --
content CDATA #REQUIRED -- associated information --
scheme CDATA #IMPLIED -- select form of content --
>

<!ELEMENT STYLE - - %StyleSheet -- style info -->


<!ATTLIST STYLE
%i18n; -- lang, dir, for use with title --
type %ContentType; #REQUIRED -- content type of style language --
media %MediaDesc; #IMPLIED -- designed for use with these media --
title %Text; #IMPLIED -- advisory title --
>

<!ELEMENT SCRIPT - - %Script; -- script statements -->


<!ATTLIST SCRIPT
charset %Charset; #IMPLIED -- char encoding of linked resource --
type %ContentType; #REQUIRED -- content type of script language --
language CDATA #IMPLIED -- predefined script language name --
src %URI; #IMPLIED -- URI for an external script --
defer (defer) #IMPLIED -- UA may defer execution of script --
event CDATA #IMPLIED -- reserved for possible future use --
for %URI; #IMPLIED -- reserved for possible future use --
>

<!ELEMENT NOSCRIPT - - (%flow;)*


-- alternate content container for non script-based rendering -->
<!ATTLIST NOSCRIPT
%attrs; -- %coreattrs, %i18n, %events --
>

<!--================ Document Structure ==================================-->

285
22 Transitional Document Type Definition

<!ENTITY % version "version CDATA #FIXED ’%[Link];’">

<![ %[Link]; [
<!ENTITY % [Link] "HEAD, FRAMESET">
]]>

<!ENTITY % [Link] "HEAD, BODY">

<!ELEMENT HTML O O (%[Link];) -- document root element -->


<!ATTLIST HTML
%i18n; -- lang, dir --
%version;
>

286
23 Frameset Document Type Definition

23 Frameset Document Type Definition


<!--
This is the HTML 4.0 Frameset DTD, which should be
used for documents with frames. This DTD is identical
to the HTML 4.0 Transitional DTD except for the
content model of the "HTML" element: in frameset
documents, the "FRAMESET" element replaces the "BODY"
element.

Draft: $Date: 1997/12/11 15:31:11 $

Authors:
Dave Raggett <dsr@[Link]>
Arnaud Le Hors <lehors@[Link]>
Ian Jacobs <ij@[Link]>

Further information about HTML 4.0 is available at:

[Link]
-->
<!ENTITY % [Link] "-//W3C//DTD HTML 4.0 Frameset//EN"
-- Typical usage:

<!DOCTYPE HTML PUBLIC "-//W3C//DTD HTML 4.0 Frameset//EN"


"[Link]
<html>
<head>
...
</head>
<frameset>
...
</frameset>
</html>
-->

<!ENTITY % [Link] "INCLUDE">


<!ENTITY % [Link] PUBLIC "-//W3C//DTD HTML 4.0 Transitional//EN">
%[Link];

287
23 Frameset Document Type Definition

288
24 Character entity references in HTML 4.0

24 Character entity references in HTML 4.0


Contents

1. Introduction to character entity references . . . . . . . . . . . . 289


.
2. Character entity references for ISO 8859-1 characters . . . . . . . . . . 289
.
1. The list of characters . . . . . . . . . . . . . . . . 290
.
3. Character entity references for symbols, mathematical symbols, and Greek letters . . . 293
.
1. The list of characters . . . . . . . . . . . . . . . . 294
.
4. Character entity references for markup-significant and internationalization characters . . . 298
.
1. The list of characters . . . . . . . . . . . . . . . . 298
.

24.1 Introduction to character entity references


A character entity reference [p.40] is an SGML construct that references a character of the document
character set. [p.37]

This version of HTML supports several sets of character entity references:

ISO 8859-1 (Latin-1) characters [p.289] In accordance with section 14 of [RFC1866] [p.330] , the set
of Latin-1 entities has been extended by this specification to cover the whole right part of
ISO-8859-1 (all code positions with the high-order bit set), including the already commonly used
&nbsp;, &copy; and &reg;. The names of the entities are taken from the appendices of SGML
(defined in [ISO8879] [p.327] ).
symbols, mathematical symbols, and Greek letters [p.293] . These characters may be represented by
glyphs in the Adobe font "Symbol".
markup-significant and internationalization characters [p.298] (e.g., for bidirectional text).

The following sections present the complete lists of character entity references. Although, by convention,
[ISO10646] [p.327] the comments following each entry are usually written with uppercase letters, we
have converted them to lowercase in this specification for reasons of readability.

24.2 Character entity references for ISO 8859-1 characters


The character entity references in this section produce characters whose numeric equivalents should
already be supported by conforming HTML 2.0 user agents. Thus, the character entity reference &divide;
is a more convenient form than &#247; for obtaining the division sign (÷).

To support these named entities, user agents need only recognize the entity names and convert them to
characters that lie within the repertoire of [ISO88591] [p.327] .

Character 65533 (FFFD hexadecimal) is the last valid character in UCS-2. 65534 (FFFE hexadecimal) is
unassigned and reserved as the byte-swapped version of ZERO WIDTH NON-BREAKING SPACE for
byte-order detection purposes. 65535 (FFFF hexadecimal) is unassigned.

289
24.2.1 The list of characters

24.2.1 The list of characters


<!-- Portions © International Organization for Standardization 1986
Permission to copy in any form is granted for use with
conforming SGML systems and applications as defined in
ISO 8879, provided this notice is included in all copies.
-->
<!-- Character entity set. Typical invocation:
<!ENTITY % HTMLlat1 PUBLIC
"-//W3C//ENTITIES Latin 1//EN//HTML">
%HTMLlat1;
-->

<!ENTITY nbsp CDATA "&#160;" -- no-break space = non-breaking space,


U+00A0 ISOnum -->
<!ENTITY iexcl CDATA "&#161;" -- inverted exclamation mark, U+00A1 ISOnum -->
<!ENTITY cent CDATA "&#162;" -- cent sign, U+00A2 ISOnum -->
<!ENTITY pound CDATA "&#163;" -- pound sign, U+00A3 ISOnum -->
<!ENTITY curren CDATA "&#164;" -- currency sign, U+00A4 ISOnum -->
<!ENTITY yen CDATA "&#165;" -- yen sign = yuan sign, U+00A5 ISOnum -->
<!ENTITY brvbar CDATA "&#166;" -- broken bar = broken vertical bar,
U+00A6 ISOnum -->
<!ENTITY sect CDATA "&#167;" -- section sign, U+00A7 ISOnum -->
<!ENTITY uml CDATA "&#168;" -- diaeresis = spacing diaeresis,
U+00A8 ISOdia -->
<!ENTITY copy CDATA "&#169;" -- copyright sign, U+00A9 ISOnum -->
<!ENTITY ordf CDATA "&#170;" -- feminine ordinal indicator, U+00AA ISOnum -->
<!ENTITY laquo CDATA "&#171;" -- left-pointing double angle quotation mark
= left pointing guillemet, U+00AB ISOnum -->
<!ENTITY not CDATA "&#172;" -- not sign, U+00AC ISOnum -->
<!ENTITY shy CDATA "&#173;" -- soft hyphen = discretionary hyphen,
U+00AD ISOnum -->
<!ENTITY reg CDATA "&#174;" -- registered sign = registered trade mark sign,
U+00AE ISOnum -->
<!ENTITY macr CDATA "&#175;" -- macron = spacing macron = overline
= APL overbar, U+00AF ISOdia -->
<!ENTITY deg CDATA "&#176;" -- degree sign, U+00B0 ISOnum -->
<!ENTITY plusmn CDATA "&#177;" -- plus-minus sign = plus-or-minus sign,
U+00B1 ISOnum -->
<!ENTITY sup2 CDATA "&#178;" -- superscript two = superscript digit two
= squared, U+00B2 ISOnum -->
<!ENTITY sup3 CDATA "&#179;" -- superscript three = superscript digit three
= cubed, U+00B3 ISOnum -->
<!ENTITY acute CDATA "&#180;" -- acute accent = spacing acute,
U+00B4 ISOdia -->
<!ENTITY micro CDATA "&#181;" -- micro sign, U+00B5 ISOnum -->
<!ENTITY para CDATA "&#182;" -- pilcrow sign = paragraph sign,
U+00B6 ISOnum -->
<!ENTITY middot CDATA "&#183;" -- middle dot = Georgian comma
= Greek middle dot, U+00B7 ISOnum -->
<!ENTITY cedil CDATA "&#184;" -- cedilla = spacing cedilla, U+00B8 ISOdia -->
<!ENTITY sup1 CDATA "&#185;" -- superscript one = superscript digit one,
U+00B9 ISOnum -->
<!ENTITY ordm CDATA "&#186;" -- masculine ordinal indicator,
U+00BA ISOnum -->
<!ENTITY raquo CDATA "&#187;" -- right-pointing double angle quotation mark

290
24.2.1 The list of characters

= right pointing guillemet, U+00BB ISOnum -->


<!ENTITY frac14 CDATA "&#188;" -- vulgar fraction one quarter
= fraction one quarter, U+00BC ISOnum -->
<!ENTITY frac12 CDATA "&#189;" -- vulgar fraction one half
= fraction one half, U+00BD ISOnum -->
<!ENTITY frac34 CDATA "&#190;" -- vulgar fraction three quarters
= fraction three quarters, U+00BE ISOnum -->
<!ENTITY iquest CDATA "&#191;" -- inverted question mark
= turned question mark, U+00BF ISOnum -->
<!ENTITY Agrave CDATA "&#192;" -- latin capital letter A with grave
= latin capital letter A grave,
U+00C0 ISOlat1 -->
<!ENTITY Aacute CDATA "&#193;" -- latin capital letter A with acute,
U+00C1 ISOlat1 -->
<!ENTITY Acirc CDATA "&#194;" -- latin capital letter A with circumflex,
U+00C2 ISOlat1 -->
<!ENTITY Atilde CDATA "&#195;" -- latin capital letter A with tilde,
U+00C3 ISOlat1 -->
<!ENTITY Auml CDATA "&#196;" -- latin capital letter A with diaeresis,
U+00C4 ISOlat1 -->
<!ENTITY Aring CDATA "&#197;" -- latin capital letter A with ring above
= latin capital letter A ring,
U+00C5 ISOlat1 -->
<!ENTITY AElig CDATA "&#198;" -- latin capital letter AE
= latin capital ligature AE,
U+00C6 ISOlat1 -->
<!ENTITY Ccedil CDATA "&#199;" -- latin capital letter C with cedilla,
U+00C7 ISOlat1 -->
<!ENTITY Egrave CDATA "&#200;" -- latin capital letter E with grave,
U+00C8 ISOlat1 -->
<!ENTITY Eacute CDATA "&#201;" -- latin capital letter E with acute,
U+00C9 ISOlat1 -->
<!ENTITY Ecirc CDATA "&#202;" -- latin capital letter E with circumflex,
U+00CA ISOlat1 -->
<!ENTITY Euml CDATA "&#203;" -- latin capital letter E with diaeresis,
U+00CB ISOlat1 -->
<!ENTITY Igrave CDATA "&#204;" -- latin capital letter I with grave,
U+00CC ISOlat1 -->
<!ENTITY Iacute CDATA "&#205;" -- latin capital letter I with acute,
U+00CD ISOlat1 -->
<!ENTITY Icirc CDATA "&#206;" -- latin capital letter I with circumflex,
U+00CE ISOlat1 -->
<!ENTITY Iuml CDATA "&#207;" -- latin capital letter I with diaeresis,
U+00CF ISOlat1 -->
<!ENTITY ETH CDATA "&#208;" -- latin capital letter ETH, U+00D0 ISOlat1 -->
<!ENTITY Ntilde CDATA "&#209;" -- latin capital letter N with tilde,
U+00D1 ISOlat1 -->
<!ENTITY Ograve CDATA "&#210;" -- latin capital letter O with grave,
U+00D2 ISOlat1 -->
<!ENTITY Oacute CDATA "&#211;" -- latin capital letter O with acute,
U+00D3 ISOlat1 -->
<!ENTITY Ocirc CDATA "&#212;" -- latin capital letter O with circumflex,
U+00D4 ISOlat1 -->
<!ENTITY Otilde CDATA "&#213;" -- latin capital letter O with tilde,
U+00D5 ISOlat1 -->
<!ENTITY Ouml CDATA "&#214;" -- latin capital letter O with diaeresis,
U+00D6 ISOlat1 -->

291
24.2.1 The list of characters

<!ENTITY times CDATA "&#215;" -- multiplication sign, U+00D7 ISOnum -->


<!ENTITY Oslash CDATA "&#216;" -- latin capital letter O with stroke
= latin capital letter O slash,
U+00D8 ISOlat1 -->
<!ENTITY Ugrave CDATA "&#217;" -- latin capital letter U with grave,
U+00D9 ISOlat1 -->
<!ENTITY Uacute CDATA "&#218;" -- latin capital letter U with acute,
U+00DA ISOlat1 -->
<!ENTITY Ucirc CDATA "&#219;" -- latin capital letter U with circumflex,
U+00DB ISOlat1 -->
<!ENTITY Uuml CDATA "&#220;" -- latin capital letter U with diaeresis,
U+00DC ISOlat1 -->
<!ENTITY Yacute CDATA "&#221;" -- latin capital letter Y with acute,
U+00DD ISOlat1 -->
<!ENTITY THORN CDATA "&#222;" -- latin capital letter THORN,
U+00DE ISOlat1 -->
<!ENTITY szlig CDATA "&#223;" -- latin small letter sharp s = ess-zed,
U+00DF ISOlat1 -->
<!ENTITY agrave CDATA "&#224;" -- latin small letter a with grave
= latin small letter a grave,
U+00E0 ISOlat1 -->
<!ENTITY aacute CDATA "&#225;" -- latin small letter a with acute,
U+00E1 ISOlat1 -->
<!ENTITY acirc CDATA "&#226;" -- latin small letter a with circumflex,
U+00E2 ISOlat1 -->
<!ENTITY atilde CDATA "&#227;" -- latin small letter a with tilde,
U+00E3 ISOlat1 -->
<!ENTITY auml CDATA "&#228;" -- latin small letter a with diaeresis,
U+00E4 ISOlat1 -->
<!ENTITY aring CDATA "&#229;" -- latin small letter a with ring above
= latin small letter a ring,
U+00E5 ISOlat1 -->
<!ENTITY aelig CDATA "&#230;" -- latin small letter ae
= latin small ligature ae, U+00E6 ISOlat1 -->
<!ENTITY ccedil CDATA "&#231;" -- latin small letter c with cedilla,
U+00E7 ISOlat1 -->
<!ENTITY egrave CDATA "&#232;" -- latin small letter e with grave,
U+00E8 ISOlat1 -->
<!ENTITY eacute CDATA "&#233;" -- latin small letter e with acute,
U+00E9 ISOlat1 -->
<!ENTITY ecirc CDATA "&#234;" -- latin small letter e with circumflex,
U+00EA ISOlat1 -->
<!ENTITY euml CDATA "&#235;" -- latin small letter e with diaeresis,
U+00EB ISOlat1 -->
<!ENTITY igrave CDATA "&#236;" -- latin small letter i with grave,
U+00EC ISOlat1 -->
<!ENTITY iacute CDATA "&#237;" -- latin small letter i with acute,
U+00ED ISOlat1 -->
<!ENTITY icirc CDATA "&#238;" -- latin small letter i with circumflex,
U+00EE ISOlat1 -->
<!ENTITY iuml CDATA "&#239;" -- latin small letter i with diaeresis,
U+00EF ISOlat1 -->
<!ENTITY eth CDATA "&#240;" -- latin small letter eth, U+00F0 ISOlat1 -->
<!ENTITY ntilde CDATA "&#241;" -- latin small letter n with tilde,
U+00F1 ISOlat1 -->
<!ENTITY ograve CDATA "&#242;" -- latin small letter o with grave,
U+00F2 ISOlat1 -->

292
24.3 Character entity references for symbols, mathematical symbols, and Greek letters

<!ENTITY oacute CDATA "&#243;" -- latin small letter o with acute,


U+00F3 ISOlat1 -->
<!ENTITY ocirc CDATA "&#244;" -- latin small letter o with circumflex,
U+00F4 ISOlat1 -->
<!ENTITY otilde CDATA "&#245;" -- latin small letter o with tilde,
U+00F5 ISOlat1 -->
<!ENTITY ouml CDATA "&#246;" -- latin small letter o with diaeresis,
U+00F6 ISOlat1 -->
<!ENTITY divide CDATA "&#247;" -- division sign, U+00F7 ISOnum -->
<!ENTITY oslash CDATA "&#248;" -- latin small letter o with stroke,
= latin small letter o slash,
U+00F8 ISOlat1 -->
<!ENTITY ugrave CDATA "&#249;" -- latin small letter u with grave,
U+00F9 ISOlat1 -->
<!ENTITY uacute CDATA "&#250;" -- latin small letter u with acute,
U+00FA ISOlat1 -->
<!ENTITY ucirc CDATA "&#251;" -- latin small letter u with circumflex,
U+00FB ISOlat1 -->
<!ENTITY uuml CDATA "&#252;" -- latin small letter u with diaeresis,
U+00FC ISOlat1 -->
<!ENTITY yacute CDATA "&#253;" -- latin small letter y with acute,
U+00FD ISOlat1 -->
<!ENTITY thorn CDATA "&#254;" -- latin small letter thorn with,
U+00FE ISOlat1 -->
<!ENTITY yuml CDATA "&#255;" -- latin small letter y with diaeresis,
U+00FF ISOlat1 -->

24.3 Character entity references for symbols, mathematical


symbols, and Greek letters
The character entity references in this section produce characters that may be represented by glyphs in the
widely available Adobe Symbol font, including Greek characters, various bracketing symbols, and a
selection of mathematical operators such as gradient, product, and summation symbols.

To support these entities, user agents may support full [ISO10646] [p.327] or use other means. Display of
glyphs for these characters may be obtained by being able to display the relevant [ISO10646] [p.327]
characters or by other means, such as internally mapping the listed entities, numeric character references,
and characters to the appropriate position in some font that contains the requisite glyphs.

When to use Greek entities. This entity set contains all the letters used in modern Greek. However, it does
not include Greek punctuation, precomposed accented characters nor the non-spacing accents (tonos,
dialytika) required to compose them. There are no archaic letters, Coptic-unique letters, or precomposed
letters for Polytonic Greek. The entities defined here are not intended for the representation of modern
Greek text and would not be an efficient representation; rather, they are intended for occasional Greek
letters used in technical and mathematical works.

293
24.3.1 The list of characters

24.3.1 The list of characters


<!-- Mathematical, Greek and Symbolic characters for HTML -->

<!-- Character entity set. Typical invocation:


<!ENTITY % HTMLsymbol PUBLIC
"-//W3C//ENTITIES Symbols//EN//HTML">
%HTMLsymbol; -->

<!-- Portions © International Organization for Standardization 1986:


Permission to copy in any form is granted for use with
conforming SGML systems and applications as defined in
ISO 8879, provided this notice is included in all copies.
-->

<!-- Relevant ISO entity set is given unless names are newly introduced.
New names (i.e., not in ISO 8879 list) do not clash with any
existing ISO 8879 entity names. ISO 10646 character numbers
are given for each character, in hex. CDATA values are decimal
conversions of the ISO 10646 values and refer to the document
character set. Names are Unicode 2.0 names.

-->

<!-- Latin Extended-B -->


<!ENTITY fnof CDATA "&#402;" -- latin small f with hook = function
= florin, U+0192 ISOtech -->

<!-- Greek -->


<!ENTITY Alpha CDATA "&#913;" -- greek capital letter alpha, U+0391 -->
<!ENTITY Beta CDATA "&#914;" -- greek capital letter beta, U+0392 -->
<!ENTITY Gamma CDATA "&#915;" -- greek capital letter gamma,
U+0393 ISOgrk3 -->
<!ENTITY Delta CDATA "&#916;" -- greek capital letter delta,
U+0394 ISOgrk3 -->
<!ENTITY Epsilon CDATA "&#917;" -- greek capital letter epsilon, U+0395 -->
<!ENTITY Zeta CDATA "&#918;" -- greek capital letter zeta, U+0396 -->
<!ENTITY Eta CDATA "&#919;" -- greek capital letter eta, U+0397 -->
<!ENTITY Theta CDATA "&#920;" -- greek capital letter theta,
U+0398 ISOgrk3 -->
<!ENTITY Iota CDATA "&#921;" -- greek capital letter iota, U+0399 -->
<!ENTITY Kappa CDATA "&#922;" -- greek capital letter kappa, U+039A -->
<!ENTITY Lambda CDATA "&#923;" -- greek capital letter lambda,
U+039B ISOgrk3 -->
<!ENTITY Mu CDATA "&#924;" -- greek capital letter mu, U+039C -->
<!ENTITY Nu CDATA "&#925;" -- greek capital letter nu, U+039D -->
<!ENTITY Xi CDATA "&#926;" -- greek capital letter xi, U+039E ISOgrk3 -->
<!ENTITY Omicron CDATA "&#927;" -- greek capital letter omicron, U+039F -->
<!ENTITY Pi CDATA "&#928;" -- greek capital letter pi, U+03A0 ISOgrk3 -->
<!ENTITY Rho CDATA "&#929;" -- greek capital letter rho, U+03A1 -->
<!-- there is no Sigmaf, and no U+03A2 character either -->
<!ENTITY Sigma CDATA "&#931;" -- greek capital letter sigma,
U+03A3 ISOgrk3 -->
<!ENTITY Tau CDATA "&#932;" -- greek capital letter tau, U+03A4 -->
<!ENTITY Upsilon CDATA "&#933;" -- greek capital letter upsilon,
U+03A5 ISOgrk3 -->

294
24.3.1 The list of characters

<!ENTITY Phi CDATA "&#934;" -- greek capital letter phi,


U+03A6 ISOgrk3 -->
<!ENTITY Chi CDATA "&#935;" -- greek capital letter chi, U+03A7 -->
<!ENTITY Psi CDATA "&#936;" -- greek capital letter psi,
U+03A8 ISOgrk3 -->
<!ENTITY Omega CDATA "&#937;" -- greek capital letter omega,
U+03A9 ISOgrk3 -->

<!ENTITY alpha CDATA "&#945;" -- greek small letter alpha,


U+03B1 ISOgrk3 -->
<!ENTITY beta CDATA "&#946;" -- greek small letter beta, U+03B2 ISOgrk3 -->
<!ENTITY gamma CDATA "&#947;" -- greek small letter gamma,
U+03B3 ISOgrk3 -->
<!ENTITY delta CDATA "&#948;" -- greek small letter delta,
U+03B4 ISOgrk3 -->
<!ENTITY epsilon CDATA "&#949;" -- greek small letter epsilon,
U+03B5 ISOgrk3 -->
<!ENTITY zeta CDATA "&#950;" -- greek small letter zeta, U+03B6 ISOgrk3 -->
<!ENTITY eta CDATA "&#951;" -- greek small letter eta, U+03B7 ISOgrk3 -->
<!ENTITY theta CDATA "&#952;" -- greek small letter theta,
U+03B8 ISOgrk3 -->
<!ENTITY iota CDATA "&#953;" -- greek small letter iota, U+03B9 ISOgrk3 -->
<!ENTITY kappa CDATA "&#954;" -- greek small letter kappa,
U+03BA ISOgrk3 -->
<!ENTITY lambda CDATA "&#955;" -- greek small letter lambda,
U+03BB ISOgrk3 -->
<!ENTITY mu CDATA "&#956;" -- greek small letter mu, U+03BC ISOgrk3 -->
<!ENTITY nu CDATA "&#957;" -- greek small letter nu, U+03BD ISOgrk3 -->
<!ENTITY xi CDATA "&#958;" -- greek small letter xi, U+03BE ISOgrk3 -->
<!ENTITY omicron CDATA "&#959;" -- greek small letter omicron, U+03BF NEW -->
<!ENTITY pi CDATA "&#960;" -- greek small letter pi, U+03C0 ISOgrk3 -->
<!ENTITY rho CDATA "&#961;" -- greek small letter rho, U+03C1 ISOgrk3 -->
<!ENTITY sigmaf CDATA "&#962;" -- greek small letter final sigma,
U+03C2 ISOgrk3 -->
<!ENTITY sigma CDATA "&#963;" -- greek small letter sigma,
U+03C3 ISOgrk3 -->
<!ENTITY tau CDATA "&#964;" -- greek small letter tau, U+03C4 ISOgrk3 -->
<!ENTITY upsilon CDATA "&#965;" -- greek small letter upsilon,
U+03C5 ISOgrk3 -->
<!ENTITY phi CDATA "&#966;" -- greek small letter phi, U+03C6 ISOgrk3 -->
<!ENTITY chi CDATA "&#967;" -- greek small letter chi, U+03C7 ISOgrk3 -->
<!ENTITY psi CDATA "&#968;" -- greek small letter psi, U+03C8 ISOgrk3 -->
<!ENTITY omega CDATA "&#969;" -- greek small letter omega,
U+03C9 ISOgrk3 -->
<!ENTITY thetasym CDATA "&#977;" -- greek small letter theta symbol,
U+03D1 NEW -->
<!ENTITY upsih CDATA "&#978;" -- greek upsilon with hook symbol,
U+03D2 NEW -->
<!ENTITY piv CDATA "&#982;" -- greek pi symbol, U+03D6 ISOgrk3 -->

<!-- General Punctuation -->


<!ENTITY bull CDATA "&#8226;" -- bullet = black small circle,
U+2022 ISOpub -->
<!-- bullet is NOT the same as bullet operator, U+2219 -->
<!ENTITY hellip CDATA "&#8230;" -- horizontal ellipsis = three dot leader,
U+2026 ISOpub -->
<!ENTITY prime CDATA "&#8242;" -- prime = minutes = feet, U+2032 ISOtech -->

295
24.3.1 The list of characters

<!ENTITY Prime CDATA "&#8243;" -- double prime = seconds = inches,


U+2033 ISOtech -->
<!ENTITY oline CDATA "&#8254;" -- overline = spacing overscore,
U+203E NEW -->
<!ENTITY frasl CDATA "&#8260;" -- fraction slash, U+2044 NEW -->

<!-- Letterlike Symbols -->


<!ENTITY weierp CDATA "&#8472;" -- script capital P = power set
= Weierstrass p, U+2118 ISOamso -->
<!ENTITY image CDATA "&#8465;" -- blackletter capital I = imaginary part,
U+2111 ISOamso -->
<!ENTITY real CDATA "&#8476;" -- blackletter capital R = real part symbol,
U+211C ISOamso -->
<!ENTITY trade CDATA "&#8482;" -- trade mark sign, U+2122 ISOnum -->
<!ENTITY alefsym CDATA "&#8501;" -- alef symbol = first transfinite cardinal,
U+2135 NEW -->
<!-- alef symbol is NOT the same as hebrew letter alef,
U+05D0 although the same glyph could be used to depict both characters -->

<!-- Arrows -->


<!ENTITY larr CDATA "&#8592;" --
leftwards arrow, U+2190 ISOnum -->
<!ENTITY uarr CDATA "&#8593;" --
upwards arrow, U+2191 ISOnum-->
<!ENTITY rarr CDATA "&#8594;" --
rightwards arrow, U+2192 ISOnum -->
<!ENTITY darr CDATA "&#8595;" --
downwards arrow, U+2193 ISOnum -->
<!ENTITY harr CDATA "&#8596;" --
left right arrow, U+2194 ISOamsa -->
<!ENTITY crarr CDATA "&#8629;" --
downwards arrow with corner leftwards
= carriage return, U+21B5 NEW -->
<!ENTITY lArr CDATA "&#8656;" -- leftwards double arrow, U+21D0 ISOtech -->
<!-- Unicode does not say that lArr is the same as the ’is implied by’ arrow
but also does not have any other character for that function. So ? lArr can
be used for ’is implied by’ as ISOtech suggests -->
<!ENTITY uArr CDATA "&#8657;" -- upwards double arrow, U+21D1 ISOamsa -->
<!ENTITY rArr CDATA "&#8658;" -- rightwards double arrow,
U+21D2 ISOtech -->
<!-- Unicode does not say this is the ’implies’ character but does not have
another character with this function so ?
rArr can be used for ’implies’ as ISOtech suggests -->
<!ENTITY dArr CDATA "&#8659;" -- downwards double arrow, U+21D3 ISOamsa -->
<!ENTITY hArr CDATA "&#8660;" -- left right double arrow,
U+21D4 ISOamsa -->

<!-- Mathematical Operators -->


<!ENTITY forall CDATA "&#8704;" --
for all, U+2200 ISOtech -->
<!ENTITY part CDATA "&#8706;" --
partial differential, U+2202 ISOtech -->
<!ENTITY exist CDATA "&#8707;" --
there exists, U+2203 ISOtech -->
<!ENTITY empty CDATA "&#8709;" --
empty set = null set = diameter,
U+2205 ISOamso -->
<!ENTITY nabla CDATA "&#8711;" -- nabla = backward difference,
U+2207 ISOtech -->
<!ENTITY isin CDATA "&#8712;" -- element of, U+2208 ISOtech -->
<!ENTITY notin CDATA "&#8713;" -- not an element of, U+2209 ISOtech -->
<!ENTITY ni CDATA "&#8715;" -- contains as member, U+220B ISOtech -->
<!-- should there be a more memorable name than ’ni’? -->
<!ENTITY prod CDATA "&#8719;" -- n-ary product = product sign,
U+220F ISOamsb -->
<!-- prod is NOT the same character as U+03A0 ’greek capital letter pi’ though
the same glyph might be used for both -->

296
24.3.1 The list of characters

<!ENTITY sum CDATA "&#8721;" -- n-ary sumation, U+2211 ISOamsb -->


<!-- sum is NOT the same character as U+03A3 ’greek capital letter sigma’
though the same glyph might be used for both -->
<!ENTITY minus CDATA "&#8722;" -- minus sign, U+2212 ISOtech -->
<!ENTITY lowast CDATA "&#8727;" -- asterisk operator, U+2217 ISOtech -->
<!ENTITY radic CDATA "&#8730;" -- square root = radical sign,
U+221A ISOtech -->
<!ENTITY prop CDATA "&#8733;" -- proportional to, U+221D ISOtech -->
<!ENTITY infin CDATA "&#8734;" -- infinity, U+221E ISOtech -->
<!ENTITY ang CDATA "&#8736;" -- angle, U+2220 ISOamso -->
<!ENTITY and CDATA "&#8743;" -- logical and = wedge, U+2227 ISOtech -->
<!ENTITY or CDATA "&#8744;" -- logical or = vee, U+2228 ISOtech -->
<!ENTITY cap CDATA "&#8745;" -- intersection = cap, U+2229 ISOtech -->
<!ENTITY cup CDATA "&#8746;" -- union = cup, U+222A ISOtech -->
<!ENTITY int CDATA "&#8747;" -- integral, U+222B ISOtech -->
<!ENTITY there4 CDATA "&#8756;" -- therefore, U+2234 ISOtech -->
<!ENTITY sim CDATA "&#8764;" -- tilde operator = varies with = similar to,
U+223C ISOtech -->
<!-- tilde operator is NOT the same character as the tilde, U+007E,
although the same glyph might be used to represent both -->
<!ENTITY cong CDATA "&#8773;" -- approximately equal to, U+2245 ISOtech -->
<!ENTITY asymp CDATA "&#8776;" -- almost equal to = asymptotic to,
U+2248 ISOamsr -->
<!ENTITY ne CDATA "&#8800;" -- not equal to, U+2260 ISOtech -->
<!ENTITY equiv CDATA "&#8801;" -- identical to, U+2261 ISOtech -->
<!ENTITY le CDATA "&#8804;" -- less-than or equal to, U+2264 ISOtech -->
<!ENTITY ge CDATA "&#8805;" -- greater-than or equal to,
U+2265 ISOtech -->
<!ENTITY sub CDATA "&#8834;" -- subset of, U+2282 ISOtech -->
<!ENTITY sup CDATA "&#8835;" -- superset of, U+2283 ISOtech -->
<!-- note that nsup, ’not a superset of, U+2283’ is not covered by the Symbol
font encoding and is not included. Should it be, for symmetry?
It is in ISOamsn -->
<!ENTITY nsub CDATA "&#8836;" -- not a subset of, U+2284 ISOamsn -->
<!ENTITY sube CDATA "&#8838;" -- subset of or equal to, U+2286 ISOtech -->
<!ENTITY supe CDATA "&#8839;" -- superset of or equal to,
U+2287 ISOtech -->
<!ENTITY oplus CDATA "&#8853;" -- circled plus = direct sum,
U+2295 ISOamsb -->
<!ENTITY otimes CDATA "&#8855;" -- circled times = vector product,
U+2297 ISOamsb -->
<!ENTITY perp CDATA "&#8869;" -- up tack = orthogonal to = perpendicular,
U+22A5 ISOtech -->
<!ENTITY sdot CDATA "&#8901;" -- dot operator, U+22C5 ISOamsb -->
<!-- dot operator is NOT the same character as U+00B7 middle dot -->

<!-- Miscellaneous Technical -->


<!ENTITY lceil CDATA "&#8968;" -- left ceiling = apl upstile,
U+2308 ISOamsc -->
<!ENTITY rceil CDATA "&#8969;" -- right ceiling, U+2309 ISOamsc -->
<!ENTITY lfloor CDATA "&#8970;" -- left floor = apl downstile,
U+230A ISOamsc -->
<!ENTITY rfloor CDATA "&#8971;" -- right floor, U+230B ISOamsc -->
<!ENTITY lang CDATA "&#9001;" -- left-pointing angle bracket = bra,
U+2329 ISOtech -->
<!-- lang is NOT the same character as U+003C ’less than’
or U+2039 ’single left-pointing angle quotation mark’ -->

297
24.4 Character entity references for markup-significant and internationalization characters

<!ENTITY rang CDATA "&#9002;" -- right-pointing angle bracket = ket,


U+232A ISOtech -->
<!-- rang is NOT the same character as U+003E ’greater than’
or U+203A ’single right-pointing angle quotation mark’ -->

<!-- Geometric Shapes -->


<!ENTITY loz CDATA "&#9674;" -- lozenge, U+25CA ISOpub -->

<!-- Miscellaneous Symbols -->


<!ENTITY spades CDATA "&#9824;" -- black spade suit, U+2660 ISOpub -->
<!-- black here seems to mean filled as opposed to hollow -->
<!ENTITY clubs CDATA "&#9827;" -- black club suit = shamrock,
U+2663 ISOpub -->
<!ENTITY hearts CDATA "&#9829;" -- black heart suit = valentine,
U+2665 ISOpub -->
<!ENTITY diams CDATA "&#9830;" -- black diamond suit, U+2666 ISOpub -->

24.4 Character entity references for markup-significant and


internationalization characters
The character entity references in this section are for escaping markup-significant characters (these are the
same as those in HTML 2.0 and 3.2), for denoting spaces and dashes. Other characters in this section
apply to internationalization issues such as the disambiguation of bidirectional text (see the section on
bidirectional text [p.73] for details).

Entities have also been added for the remaining characters occurring in CP-1252 which do not occur in the
HTMLlat1 or HTMLsymbol entity sets. These all occur in the 128 to 159 range within the cp-1252
charset. These entities permit the characters to be denoted in a platform-independent manner.

To support these entities, user agents may support full [ISO10646] [p.327] or use other means. Display of
glyphs for these characters may be obtained by being able to display the relevant [ISO10646] [p.327]
characters or by other means, such as internally mapping the listed entities, numeric character references,
and characters to the appropriate position in some font that contains the requisite glyphs.

24.4.1 The list of characters


<!-- Special characters for HTML -->

<!-- Character entity set. Typical invocation:


<!ENTITY % HTMLspecial PUBLIC
"-//W3C//ENTITIES Special//EN//HTML">
%HTMLspecial; -->

<!-- Portions © International Organization for Standardization 1986:


Permission to copy in any form is granted for use with
conforming SGML systems and applications as defined in
ISO 8879, provided this notice is included in all copies.
-->

<!-- Relevant ISO entity set is given unless names are newly introduced.
New names (i.e., not in ISO 8879 list) do not clash with any
existing ISO 8879 entity names. ISO 10646 character numbers

298
24.4.1 The list of characters

are given for each character, in hex. CDATA values are decimal
conversions of the ISO 10646 values and refer to the document
character set. Names are Unicode 2.0 names.

-->

<!-- C0 Controls and Basic Latin -->


<!ENTITY quot CDATA "&#34;" -- quotation mark = APL quote,
U+0022 ISOnum -->
<!ENTITY amp CDATA "&#38;" -- ampersand, U+0026 ISOnum -->
<!ENTITY lt CDATA "&#60;" -- less-than sign, U+003C ISOnum -->
<!ENTITY gt CDATA "&#62;" -- greater-than sign, U+003E ISOnum -->

<!-- Latin Extended-A -->


<!ENTITY OElig CDATA "&#338;" -- latin capital ligature OE,
U+0152 ISOlat2 -->
<!ENTITY oelig CDATA "&#339;" -- latin small ligature oe, U+0153 ISOlat2 -->
<!-- ligature is a misnomer, this is a separate character in some languages -->
<!ENTITY Scaron CDATA "&#352;" -- latin capital letter S with caron,
U+0160 ISOlat2 -->
<!ENTITY scaron CDATA "&#353;" -- latin small letter s with caron,
U+0161 ISOlat2 -->
<!ENTITY Yuml CDATA "&#376;" -- latin capital letter Y with diaeresis,
U+0178 ISOlat2 -->

<!-- Spacing Modifier Letters -->


<!ENTITY circ CDATA "&#710;" -- modifier letter circumflex accent,
U+02C6 ISOpub -->
<!ENTITY tilde CDATA "&#732;" -- small tilde, U+02DC ISOdia -->

<!-- General Punctuation -->


<!ENTITY ensp CDATA "&#8194;" -- en space, U+2002 ISOpub -->
<!ENTITY emsp CDATA "&#8195;" -- em space, U+2003 ISOpub -->
<!ENTITY thinsp CDATA "&#8201;" -- thin space, U+2009 ISOpub -->
<!ENTITY zwnj CDATA "&#8204;" -- zero width non-joiner,
U+200C NEW RFC 2070 -->
<!ENTITY zwj CDATA "&#8205;" -- zero width joiner, U+200D NEW RFC 2070 -->
<!ENTITY lrm CDATA "&#8206;" -- left-to-right mark, U+200E NEW RFC 2070 -->
<!ENTITY rlm CDATA "&#8207;" -- right-to-left mark, U+200F NEW RFC 2070 -->
<!ENTITY ndash CDATA "&#8211;" -- en dash, U+2013 ISOpub -->
<!ENTITY mdash CDATA "&#8212;" -- em dash, U+2014 ISOpub -->
<!ENTITY lsquo CDATA "&#8216;" -- left single quotation mark,
U+2018 ISOnum -->
<!ENTITY rsquo CDATA "&#8217;" -- right single quotation mark,
U+2019 ISOnum -->
<!ENTITY sbquo CDATA "&#8218;" -- single low-9 quotation mark, U+201A NEW -->
<!ENTITY ldquo CDATA "&#8220;" -- left double quotation mark,
U+201C ISOnum -->
<!ENTITY rdquo CDATA "&#8221;" -- right double quotation mark,
U+201D ISOnum -->
<!ENTITY bdquo CDATA "&#8222;" -- double low-9 quotation mark, U+201E NEW -->
<!ENTITY dagger CDATA "&#8224;" -- dagger, U+2020 ISOpub -->
<!ENTITY Dagger CDATA "&#8225;" -- double dagger, U+2021 ISOpub -->
<!ENTITY permil CDATA "&#8240;" -- per mille sign, U+2030 ISOtech -->
<!ENTITY lsaquo CDATA "&#8249;" -- single left-pointing angle quotation mark,
U+2039 ISO proposed -->
<!-- lsaquo is proposed but not yet ISO standardized -->

299
24.4.1 The list of characters

<!ENTITY rsaquo CDATA "&#8250;" -- single right-pointing angle quotation mark,


U+203A ISO proposed -->
<!-- rsaquo is proposed but not yet ISO standardized -->
<!ENTITY euro CDATA "&#8364;" -- euro sign, U+20AC NEW -->

300
Appendix A: Changes

Appendix A: Changes
Contents

1. Changes between HTML 3.2 and HTML 4.0 . . . . . . . . . . . 301


.
1. Changes to elements . . . . . . . . . . . . . . . . 301
.
New elements . . . . . . . . . . . . . . . . 301
.
Deprecated elements . . . . . . . . . . . . . . . 301
.
Obsolete elements . . . . . . . . . . . . . . . 302
.
2. Changes to attributes . . . . . . . . . . . . . . . . 302
.
3. Changes for accessibility . . . . . . . . . . . . . . . 302
.
4. Changes for meta data . . . . . . . . . . . . . . . 302
.
5. Changes for text . . . . . . . . . . . . . . . . . 302
.
6. Changes for links . . . . . . . . . . . . . . . . 302
.
7. Changes for tables . . . . . . . . . . . . . . . . 302
.
8. Changes for images, objects, and image maps . . . . . . . . . . 303
.
9. Changes for forms . . . . . . . . . . . . . . . . 303
.
10. Changes for style sheets . . . . . . . . . . . . . . . 304
.
11. Changes for frames . . . . . . . . . . . . . . . . 304
.
12. Changes for scripting . . . . . . . . . . . . . . . . 304
.
13. Changes for internationalization . . . . . . . . . . . . . 304
.
2. Changes from the 18 December 1997 specification . . . . . . . . . . 304
.
1. Errors that were corrected . . . . . . . . . . . . . . . 305
.
2. Minor typographical errors that were corrected . . . . . . . . . . 307
.

A.1 Changes between HTML 3.2 and HTML 4.0


A.1.1 Changes to elements
New elements
The new elements in HTML 4.0 are: ABBR, ACRONYM, BDO, BUTTON, COL, COLGROUP, DEL,
FIELDSET, FRAME, FRAMESET, IFRAME, INS, LABEL, LEGEND, NOFRAMES, NOSCRIPT, OBJECT,
OPTGROUP, PARAM, S (deprecated), SPAN, TBODY, TFOOT, THEAD, and Q.

Deprecated elements
The following elements are deprecated [p.34] : APPLET, BASEFONT, CENTER, DIR, FONT, ISINDEX,
MENU, STRIKE, and U.

301
A.1.2 Changes to attributes

Obsolete elements
The following elements are obsolete: LISTING, PLAINTEXT, and XMP. For all of them, authors should
use the PRE element instead.

A.1.2 Changes to attributes


Almost all attributes that specify the presentation of an HTML document (e.g., colors, alignment,
fonts, graphics, etc.) have been deprecated [p.34] in favor of style sheets. The list of attributes [p.337]
in the appendix indicates which attributes have been deprecated [p.34] .
The id and class attribute allow authors to assign name and class information [p.65] to elements
for style sheets, as anchors, for scripting, for object declarations, general purpose document
processing, etc.

A.1.3 Changes for accessibility


HTML 4.0 features many changes to promote accessibility [p.20] , including:

The title attribute may now be set on virtually every element.


Authors may provide long descriptions of tables (see the summary attribute), images and frames
(see the longdesc attribute).

A.1.4 Changes for meta data


Authors may now specify profiles [p.61] that provide explanations about meta data specified with the
META or LINK elements.

A.1.5 Changes for text


New features for internationalization [p.304] allow authors to specify text direction and language.
The INS and DEL elements allow authors to mark up changes in their documents.
The ABBR and ACRONYM elements allow authors to mark up abbreviations and acronyms in their
documents.

A.1.6 Changes for links


The id attribute makes any element the destination anchor of a link.

A.1.7 Changes for tables


The HTML 4.0 table model has grown out of early work on HTML+ and the initial draft of HTML3.0
[p.329] . The earlier model has been extended in response to requests from information providers as
follows:

302
A.1.8 Changes for images, objects, and image maps

Authors may specify tables that may be incrementally displayed as the user agent receives data.
Authors may specify tables that are more accessible to users with non-visual user agents.
Authors may specify tables with fixed headers and footers. User agents may take advantage of these
when scrolling large tables or rendering tables to paged media.

The HTML 4.0 table model also satisfies requests for optional column-based defaults for alignment
properties, more flexibility in specifying table frames and rules, and the ability to align on designated
characters. It is expected, however, that style sheets [p.171] will take over the task of rendering tables in
the near future.

In addition, a major goal has been to provide backwards compatibility with the widely deployed Netscape
implementation of tables. Another goal has been to simplify importing tables conforming to the SGML
CALS model. The latest draft makes the align attribute compatible with the latest versions of the most
popular browsers. Some clarifications have been made to the role of the dir attribute and recommended
behavior when absolute and relative column widths are mixed.

A new element, COLGROUP, has been introduced to allow sets of columns to be grouped with different
width and alignment properties specified by one or more COL elements. The semantics of COLGROUP
have been clarified over previous drafts, and rules="basic" replaced by rules="groups".

The style attribute is included as a means for extending the properties associated with edges and
interiors of groups of cells. For instance, the line style: dotted, double, thin/thick etc; the color/pattern fill
for the interior; cell margins and font information. This will be the subject for a companion specification
on style sheets.

The frame and rules attributes have been modified to avoid SGML name clashes with each other, and
to avoid clashes with the align and valign attributes. These changes were additionally motivated by
the desire to avoid future problems if this specification is extended to allow frame and rules attributes
with other table elements.

A.1.8 Changes for images, objects, and image maps


The OBJECT element allows generic inclusion of objects.
The IFRAME and OBJECT elements allow authors to create embedded documents.
The alt attribute is required on the IMG and AREA elements.
The mechanism for creating image maps [p.162] now allows authors to create more accessible image
maps. The content model of the MAP element has changed for this reason.

A.1.9 Changes for forms


This specification introduces several new attributes and elements that affect forms:

The accesskey attribute allows authors to specify direct keyboard access to form controls.
The disabled attribute allows authors to make a form control initially insensitive.
The readonly attribute, allows authors to prohibit changes to a form control.
The LABEL element associates a label with a particular form control.
The FIELDSET element groups related fields together and, in association with the LEGEND element,

303
A.2 Changes from the 18 December 1997 specification

can be used to name the group. Both of these new elements allow better rendering and better
interactivity. Speech-based browsers can better describe the form and graphic browsers can make
labels sensitive.
A new set of attributes, in combination with scripts [p.237] , allow form providers to verify
user-entered data.
The BUTTON element and INPUT with type set to "button" can be used in combination with scripts
[p.237] to create richer forms.
The OPTGROUP element allows authors to group menu options together in a SELECT, which is
particularly important for form accessibility.
Additional changes for internationalization [p.304] .

A.1.10 Changes for style sheets


HTML 4.0 supports a larger set of media descriptors [p.49] so that authors may write device-sensitive
style sheets.

A.1.11 Changes for frames


HTML 4.0 supports frame documents and inline frames.

A.1.12 Changes for scripting


Many elements now feature event attributes [p.240] that may be coupled with scripts; the script is
executed when the event occurs (e.g., when a document is loaded, when the mouse is clicked, etc.).

A.1.13 Changes for internationalization


HTML 4.0 integrates the recommendations of [RFC2070] [p.330] for the internationalization of HTML.

However, this specification and [RFC2070] [p.330] differ as follows:

The accept-charset attribute has been specified for the FORM element rather than the
TEXTAREA and INPUT elements.
The HTML 4.0 specification makes additional clarifications with respect to the bidirectional
algorithm [p.73] .
The use of CDATA [p.44] to define the SCRIPT and STYLE elements does not preserve the ability
to transcode documents, as described in section 2.1 of [RFC2070] [p.330] .

A.2 Changes from the 18 December 1997 specification


This section describes how this version of the HTML 4.0 specification differs from the previous version
released on 18 December 1997.

304
A.2.1 Errors that were corrected

A.2.1 Errors that were corrected


Section 2.1.1 [p.17]
"[Link] was said to designate the current HTML specification.
The current HTML specification is actually at [Link]
Section 7.5.2 [p.65]
The hypertext link on name was incorrect. It now links to [Link]#type-name [p.44] .
Section 7.5.4 [p.67]
href was listed as an attribute of the DIV and SPAN elements. It is not.
Section 7.5.6 [p.70]
A P element was used in the example. It is invalid in ADDRESS.
Section 8.1 [p.71]
In the first example, which reads "Her super-powers were the result...", there was an extra double
quote mark before the word "Her".
Section 9.3.4 [p.88]
The attribute width [p.88] was not noted as deprecated [p.34] .
Section 11.2.4, "Calculating the width of columns" [p.112]
The sentence "We have set the value of the align attribute in the third column group to ’center’" read
"second" instead of "third".
Section 11.2.6, "Cells that span several rows or columns" [p.117]
The second paragraph read "In this table definition, we specify that the cell in row four, column two
should span a total of three columns, including the current row." It now ends "...including the current
column."
Section 13.2 [p.150]
The sentence beginning "User agents must render alternate text when they cannot support ..." read
"next", instead of "text".
Section 13.6.2 [p.167]
The last sentence of the second paragraph applied to both the IMG and INPUT elements. However,
the ismap attribute is not defined for INPUT. The sentence now only applies to IMG.
Section 14.2.3 [p.174]
The title attribute for the STYLE element was not listed as an attribute defined elsewhere.
Section 14.3.2 [p.178]
The second example set title="Compact". It now sets title="compact".
Section 15.1.2 [p.183]
The sentence ending "the align attribute." read "the align element."
Section [Link] [p.186]
The CSS style rule "[Link] { clear: left }" was incorrect, since it refers to the class "mybr" and not
the id value. The correct syntax is: "BR#mybr { clear: left }".
Section 16 [p.193]
All the examples containing a Document Type Declaration used something like
"THE_LATEST_VERSION_/[Link]" or "THE_LATEST_VERSION_" as the system identifier
for the Frameset DTD. They now use "[Link] instead.
Section 16.3 [p.200] and Section 16.3.1 [p.201]
The second example of 16.3 and the example of 16.3.1 used the wrong DTD; they now use the
Transitional DTD.

305
A.2.1 Errors that were corrected

Section 17.5 [p.215]


In "attributes defined elsewhere" for the BUTTON element, id, class, lang, dir, title,
style, and tabindex were missing. Also, usemap has been removed.
Section 17.6/17.6.1 [p.217]
The "attributes defined elsewhere" for OPTION and OPTGROUP mistakenly listed onfocus,
onblur, and onchange. The "attributes defined elsewhere" section was missing for the SELECT
element (please see the DTD for the full list of attributes).
Section 17.9.1 [p.224]
The tabindex attribute was said to be defined for the LABEL element. It is not.
Section 17.12.2 [p.231]
The sentence "The following elements support the readonly attribute: INPUT and TEXTAREA."
read "The following elements support the readonly attribute: INPUT, TEXT, PASSWORD, and
TEXTAREA."
Section 18.2.2, "Local declaration of a scripting language" [p.239]
The first paragraph read: "It is also possible to specify the scripting language in each SCRIPT
element via the type attribute. In the absence of a default scripting language specification, this
attribute must be set on each SCRIPT element." Since the type attribute is required for the
SCRIPT element, this paragraph now reads: "The type attribute must be specified for each
SCRIPT element instance in a document. The value of the type attribute for a SCRIPT element
overrides the default scripting language for that element."
Section 24.2.1 [p.290] and file [Link]
The comment for the character reference "not" read "= discretionary hyphen". This has been
removed.
The FPI in comment read "-//W3C//ENTITIES Full Latin 1//EN//HTML", instead this is now
"-//W3C//ENTITIES Latin1//EN//HTML".
Section 24.3.1 [p.294] and file [Link]
The FPI in comment read "-//W3C//ENTITIES Symbolic//EN//HTML", instead this is now
"-//W3C//ENTITIES Symbols//EN//HTML".
Section A.1.1, "New elements" [p.301] (previously A.1.1) and Section A.1.1, "Deprecated elements"
[p.301] (previously A.1.2)
The S element which is deprecated [p.34] was listed as part of the changes between HTML 3.2 and
HTML 4.0. This element was not actually defined in HTML 3.2 [p.329] . It is now in the new
elements list.
Section A.1.3 (previously A.3) [p.301]
The longdesc attribute was said to be specified for tables. It is not. Instead, the summary attribute
allows authors to give longer descriptions of tables.
Section B.4 [p.315]
The sentence "You may help search engines by using the LINK element with rel="start" along with
the title attribute, ..." read "You may help search engines by using the LINK element with
rel="begin" along with a TITLE, ..." The same stands for the companion example.
Section B.5.1 [p.317]
The sentence "This can be altered by setting the width attribute of the TABLE element." read "This
can be altered by setting the width-TABLE attribute of the TABLE element."
Section B.5.2 [p.319]
The sentence "Rules for handling objects too large for a column apply when the explicit or implied
alignment results in a situation where the data exceeds the assigned width of the column." read "too

306
A.2.2 Minor typographical errors that were corrected

large for column". The meaning of the sentence was unclear since it referred to "rules" governing an
error condition; user agent behavior in error conditions lies outside the scope of the specification.
Index of attributes [p.337]
The href attribute for the BASE element was marked as deprecated [p.34] . It is not. However, it is
not defined in the Strict DTD either.

The language attribute for the SCRIPT element was not marked as deprecated [p.34] . It is now,
and it is no longer defined in the Strict DTD.

A.2.2 Minor typographical errors that were corrected


Section 2.1.3 [p.18]
"Relative URIs are resolved ..." was "Relative URIsare resolved ...".
Section 2.2.1 [p.19]
The second word "of" was missing in "Despite never receiving consensus in standards discussions,
these drafts led to the adoption of a range of new features."
Section 3.3.3 [p.28]
The sentence "Element types that are designed to have no content are called empty elements."
contained one too many "elements". The word "a" was missing in the sentence "A few HTML
element types use an additional SGML feature to exclude elements from a content model".

Also, in list item two, a period was missing between "optional" and "Two".
Section 3.3.4 [p.30]
In the section on "Boolean attributes", the sentence that begins "In HTML, boolean attributes may
appear in minimized ..." included a bogus word "be".
Section 6.3 [p.44]
The sentence beginning "For introductory information about attributes, ..." read "For introductory
about attributes, ...".
Section 6.6 [p.46]
In the first sentence of the section on Pixels, "is an integer" read "is integer".
Section 7.4.1 [p.55]
The first word "The" was missing at the beginning of the section title.
Section 7.4.4 [p.57]
The last word "a" was missing in the sentence "The meaning of a property and the set of legal values
for that property should be defined in a reference lexicon called profile."
Section 7.5.2 [p.65]
"Variable déclarée deux fois" read "Variable déclaré deux fois".
Section 9.2.2 [p.84]
The language of the quotations was "en" instead of "en-us", while in British English, the single
quotation marks would delimit the outer quotation.
Section 9.3.2 [p.87]
In the first line, the sixth character of "&#x000A" was the letter ’O’ instead of a zero.
Section 10.3.1 [p.97]
"(they are case-sensitive)" read "(the are case-sensitive)".
Section 12.1.1 [p.135]
In the sentence beginning "Note that the href attribute in each source ..." the space was missing
between "href" and "attribute".

307
A.2.2 Minor typographical errors that were corrected

Section 12.1.2 [p.137]


The sentence "Links that express other types of relationships have one or more link types specified in
their source anchors." read "Links that express other types of relationships have one or more link type
specified in their source anchor."
Section 12.1.5 [p.138]
The second paragraph reads "the hreflang attribute provides user agents about the language of a ..." It
should read "the hreflang attribute provides user agents with information about the language of a ..."
Section 13.3.2 [p.156]
In the sentence beginning "Any number of PARAM elements may appear in the content of an
OBJECT or APPLET element, ..." a space was missing between "APPLET" and "element".
Section 14.2.2 [p.174]
There was a bogus word "style" at the beginning of the sentence "The style attribute specifies ..."
Section 17.2 [p.208]
In "Those controls for which name/value pairs are submitted are called successful controls" the word
"for" was missing.
Section 17.10 [p.225]
There was a bogus word "/samp" just before section 17.11.
Section 17.11 [p.227]
The first sentence read, "In an HTML document, an element must receive focus from the user in
order to become active and perform their tasks" (instead of "its" tasks).
Section 18.2.2 [p.239]
Just before section 18.2.3, the sentence that includes "a name attribute takes precedence over an id if
both are set." read "over a id if both are set.".
Section 19.1 [p.247]
The section title read "document Document Validation". It now is "Document Validation".
Section 21 [p.251]
The FPI for the Transitional HTML 4.0 DTD was missing a closing double quote.
Section B.5.1/B.5.2 [p.317]
This sections referred to a non-existent cols attribute. This attribute is not part of HTML 4.0.
Calculating the number of columns in a table is described in section Section [Link] [p.111] , in the
chapter on tables. In sections B.5.1 and B.5.2, occurrences of cols have been replaced by "the
number of columns specified by the COL and COLGROUP elements".
Section B.5.2 [p.319]
In the sentence "The values for the frame attribute have been chosen to avoid clashes with the rules,
align and valign attributes." a space was missing between "the" and "frame" and the last attribute was
"valign-COLGROUP".
Section B.10.1 [p.325]
The last sentence read "Once a file is uploaded, the processing agent should process and store the it
appropriately." "the it" was changed to "it".
Index of Elements [p.333]
"strike-through" in the description of the S element read "sstrike-through".

308
Appendix B: Performance, Implementation, and Design Notes

Appendix B: Performance, Implementation, and Design


Notes
Contents

1. Notes on invalid documents . . . . . . . . . . . . . . . 310


.
2. Special characters in URI attribute values . . . . . . . . . . . . 310
.
1. Non-ASCII characters in URI attribute values . . . . . . . . . . 310
.
2. Ampersands in URI attribute values . . . . . . . . . . . . 311
.
3. SGML implementation notes . . . . . . . . . . . . . . . 311
.
1. Line breaks . . . . . . . . . . . . . . . . . . 311
.
2. Specifying non-HTML data . . . . . . . . . . . . . . 312
.
Element content . . . . . . . . . . . . . . . . 312
.
Attribute values . . . . . . . . . . . . . . . . 313
.
3. SGML features with limited support . . . . . . . . . . . . 313
.
4. Boolean attributes . . . . . . . . . . . . . . . . 313
.
5. Marked Sections . . . . . . . . . . . . . . . . . 313
.
6. Processing Instructions . . . . . . . . . . . . . . . 314
.
7. Shorthand markup . . . . . . . . . . . . . . . . 314
.
4. Notes on helping search engines index your Web site . . . . . . . . . . 315
.
1. Search robots . . . . . . . . . . . . . . . . . 316
.
The [Link] file . . . . . . . . . . . . . . . 316
.
Robots and the META element . . . . . . . . . . . . 317
.
5. Notes on tables . . . . . . . . . . . . . . . . . . 317
.
1. Design rationale . . . . . . . . . . . . . . . . . 317
.
Dynamic reformatting . . . . . . . . . . . . . . 318
.
Incremental display . . . . . . . . . . . . . . . 318
.
Structure and presentation . . . . . . . . . . . . . 318
.
Row and column groups . . . . . . . . . . . . . . 319
.
Accessibility . . . . . . . . . . . . . . . . 319
.
2. Recommended Layout Algorithms . . . . . . . . . . . . . 319
.
Fixed Layout Algorithm . . . . . . . . . . . . . . 320
.
Autolayout Algorithm . . . . . . . . . . . . . . 320
.
6. Notes on forms . . . . . . . . . . . . . . . . . . 322
.
1. Incremental display . . . . . . . . . . . . . . . . 322
.
2. Future projects . . . . . . . . . . . . . . . . . 322
.
7. Notes on scripting . . . . . . . . . . . . . . . . . 323
.
1. Reserved syntax for future script macros . . . . . . . . . . . 323
.
Current Practice for Script Macros . . . . . . . . . . . . 323
.
8. Notes on frames . . . . . . . . . . . . . . . . . . 324
.
9. Notes on accessibility . . . . . . . . . . . . . . . . . 325
.
10. Notes on security . . . . . . . . . . . . . . . . . . 325
.
1. Security issues for forms . . . . . . . . . . . . . . . 325
.

309
B.1 Notes on invalid documents

The following notes are informative, not normative. Despite the appearance of words such as "must" and
"should", all requirements in this section appear elsewhere in the specification.

B.1 Notes on invalid documents


This specification does not define how conforming user agents handle general error conditions, including
how user agents behave when they encounter elements, attributes, attribute values, or entities not specified
in this document.

However, to facilitate experimentation and interoperability between implementations of various versions


of HTML, we recommend the following behavior:

If a user agent encounters an element it does not recognize, it should try to render the element’s
content.
If a user agent encounters an attribute it does not recognize, it should ignore the entire attribute
specification (i.e., the attribute and its value).
If a user agent encounters an attribute value it doesn’t recognize, it should use the default attribute
value.
If it encounters an undeclared entity, the entity should be treated as character data.

We also recommend that user agents provide support for notifying the user of such errors.

Since user agents may vary in how they handle error conditions, authors and users must not rely on
specific error recovery behavior.

The HTML 2.0 specification ([RFC1866] [p.330] ) observes that many HTML 2.0 user agents assume that
a document that does not begin with a document type declaration refers to the HTML 2.0 specification. As
experience shows that this is a poor assumption, the current specification does not recommend this
behavior.

For reasons of interoperability, authors must not "extend" HTML through the available SGML
mechanisms (e.g., extending the DTD, adding a new set of entity definitions, etc.).

B.2 Special characters in URI attribute values


B.2.1 Non-ASCII characters in URI attribute values
Although URIs do not contain non-ASCII values (see [URI] [p.328] , section 2.1) authors sometimes
specify them in attribute values expecting URIs (i.e., defined with %URI; [p.253] in the DTD [p.251] ).
For instance, the following href value is illegal:
<A href="[Link]

We recommend that user agents adopt the following convention for handling non-ASCII characters in
such cases:

310
B.3 SGML implementation notes

1. Represent each character in UTF-8 (see [RFC2044] [p.328] ) as one or more bytes.
2. Escape these bytes with the URI escaping mechanism (i.e., by converting each byte to %HH, where
HH is the hexadecimal notation of the byte value).

This procedure results in a syntactically legal URI (as defined in [RFC1738] [p.328] , section 2.2 or
[RFC2141] [p.328] , section 2) that is independent of the character encoding [p.37] to which the HTML
document carrying the URI may have been transcoded.

Note. Some older user agents trivially process URIs in HTML using the bytes of the character encoding
[p.37] in which the document was received. Some older HTML documents rely on this practice and break
when transcoded. User agents that want to handle these older documents should, on receiving a URI
containing characters outside the legal set, first use the conversion based on UTF-8. Only if the resulting
URI does not resolve should they try constructing a URI based on the bytes of the character encoding
[p.37] in which the document was received.

Note. The same conversion based on UTF-8 should be applied to values of the name attribute for the A
element.

B.2.2 Ampersands in URI attribute values


The URI that is constructed when a form is submitted [p.231] may be used as an anchor-style link (e.g.,
the href attribute for the A element). Unfortunately, the use of the "&" character to separate form fields
interacts with its use in SGML attribute values to delimit character entity references [p.26] . For example,
to use the URI "[Link] as a linking URI, it must be written <A
href="[Link] or <A href="[Link]

We recommend that HTTP server implementors, and in particular, CGI implementors support the use of
";" in place of "&" to save authors the trouble of escaping "&" characters in this manner.

B.3 SGML implementation notes


B.3.1 Line breaks
SGML (see [ISO8879] [p.327] , section 7.6.1) specifies that a line break immediately following a start tag
must be ignored, as must a line break immediately before an end tag. This applies to all HTML elements
without exception.

The following two HTML examples must be rendered identically:


<P>Thomas is watching TV.</P>

<P>
Thomas is watching TV.
</P>

311
B.3.2 Specifying non-HTML data

So must the following two examples:


<A>My favorite Website</A>

<A>
My favorite Website
</A>

B.3.2 Specifying non-HTML data


Script [p.237] and style [p.171] data may appear as element content or attribute values. The following
sections describe the boundary between HTML markup and foreign data.

Note. The DTD [p.251] defines script and style data to be CDATA for both element content and attribute
values. SGML rules do not allow character references [p.40] in CDATA element content but do allow
them in CDATA attribute values. Authors should pay particular attention when cutting and pasting script
and style data between element content and attribute values.

This asymmetry also means that when transcoding from a richer to a poorer character encoding, the
transcoder cannot simply replace unconvertible characters in script or style data with the corresponding
numeric character references; it must parse the HTML document and know about each script and style
language’s syntax in order to process the data correctly.

Element content
When script or style data is the content of an element (SCRIPT and STYLE), the data begins immediately
after the element start tag and ends at the first ETAGO ("</") delimiter followed by a name character
([a-zA-Z]); note that this may not be the element’s end tag. Authors should therefore escape "</" within
the content. Escape mechanisms are specific to each scripting or style sheet language.

ILLEGAL EXAMPLE:
The following script data incorrectly contains a "</" sequence (as part of "</EM>") before the SCRIPT
end tag:
<SCRIPT type="text/javascript">
[Link] ("<EM>This won’t work</EM>")
</SCRIPT>

In JavaScript, this code can be expressed legally by hiding the ETAGO delimiter before an SGML name
start character:
<SCRIPT type="text/javascript">
[Link] ("<EM>This will work<\/EM>")
</SCRIPT>

In Tcl, one may accomplish this as follows:


<SCRIPT type="text/tcl">
document write "<EM>This will work<\/EM>"
</SCRIPT>

312
B.3.3 SGML features with limited support

In VBScript, the problem may be avoided with the Chr() function:


"<EM>This will work<" & Chr(47) & "EM>"

Attribute values
When script or style data is the value of an attribute (either style or the intrinsic event [p.240]
attributes), authors should escape occurrences of the delimiting single or double quotation mark within the
value according to the script or style language convention. Authors should also escape occurrences of "&"
if the "&" is not meant to be the beginning of a character reference [p.40] .

’"’ should be written as "&quot;" or "&#34;"


’&’ should be written as "&amp;" or "&#38;"

Thus, for example, one could write:


<INPUT name="num" value="0"
onchange="if (compare([Link], &quot;help&quot;)) {gethelp()}">

B.3.3 SGML features with limited support


SGML systems conforming to [ISO8879] [p.327] are expected to recognize a number of features that
aren’t widely supported by HTML user agents. We recommend that authors avoid using all of these
features.

B.3.4 Boolean attributes


Authors should be aware than many user agents only recognize the minimized form of boolean attributes
and not the full form.

For instance, authors may want to specify:


<OPTION selected>

instead of
<OPTION selected="selected">

B.3.5 Marked Sections


Marked sections play a role similar to the #ifdef construct recognized by C preprocessors.
<![INCLUDE[
<!-- this will be included -->
]]>

<![IGNORE[
<!-- this will be ignored -->
]]>

313
B.3.6 Processing Instructions

SGML also defines the use of marked sections for CDATA content, within which "<" is not treated as the
start of a tag, e.g.,
<![CDATA[
<an> example of <sgml> markup that is
not <painful> to write with < and such.
]]>

The telltale sign that a user agent doesn’t recognize a marked section is the appearance of "]]>", which is
seen when the user agent mistakenly uses the first ">" character as the end of the tag starting with "<![".

B.3.6 Processing Instructions


Processing instructions are a mechanism to capture platform-specific idioms. A processing instruction
begins with <? and ends with >
<?instruction >

For example:
<?>
<?style tt = font courier>
<?page break>
<?experiment> ... <?/experiment>

Authors should be aware that many user agents render processing instructions as part of the document’s
text.

B.3.7 Shorthand markup


Some SGML SHORTTAG constructs save typing but add no expressive capability to the SGML
application. Although these constructs technically introduce no ambiguity, they reduce the robustness of
documents, especially when the language is enhanced to include new elements. Thus, while SHORTTAG
constructs of SGML related to attributes are widely used and implemented, those related to elements are
not. Documents that use them are conforming SGML documents, but are unlikely to work with many
existing HTML tools.

The SHORTTAG constructs in question are the following:

NET tags:
<name/.../

closed Start Tag:


<name1<name2>

Empty Start Tag:

314
B.4 Notes on helping search engines index your Web site

<>

Empty End Tag:


</>

B.4 Notes on helping search engines index your Web site


This section provides some simple suggestions that will make your documents more accessible to search
engines.

Define the document language


In the global context of the Web it is important to know which human language a page was written
in. This is discussed in the section on language information [p.71] .
Specify language variants of this document
If you have prepared translations of this document into other languages, you should use the LINK
element to reference these. This allows an indexing engine to offer users search results in the user’s
preferred language, regardless of how the query was written. For instance, the following links offer
French and German alternatives to a search engine:
<LINK rel="alternate"
type="text/html"
href="[Link]" hreflang="fr"
lang="fr" title="La vie souterraine">
<LINK rel="alternate"
type="text/html"
href="[Link]" hreflang="de"
lang="de" title="Das Leben im Untergrund">

Provide keywords and descriptions


Some indexing engines look for META elements that define a comma-separated list of
keywords/phrases, or that give a short description. Search engines may present these keywords as the
result of a search. The value of the name attribute sought by a search attribute is not defined by this
specification. Consider these examples,
<META name="keywords" content="vacation,Greece,sunshine">
<META name="description" content="Idyllic European vacations">

Indicate the beginning of a collection


Collections of word processing documents or presentations are frequently translated into collections
of HTML documents. It is helpful for search results to reference the beginning of the collection in
addition to the page hit by the search. You may help search engines by using the LINK element with
rel="start" along with the title attribute, as in:

<LINK rel="begin"
type="text/html"
href="[Link]"
title="General Theory of Relativity">

315
B.4.1 Search robots

Provide robots with indexing instructions


People may be surprised to find that their site has been indexed by an indexing robot and that the
robot should not have been permitted to visit a sensitive part of the site. Many Web robots offer
facilities for Web site administrators and content providers to limit what the robot does. This is
achieved through two mechanisms: a "[Link]" file and the META element in HTML documents,
described below.

B.4.1 Search robots


The [Link] file
When a Robot visits a Web site, say [Link] it firsts checks for
[Link] If it can find this document, it will analyze its contents to see if it is
allowed to retrieve the document. You can customize the [Link] file to apply only to specific robots,
and to disallow access to specific directories or files.

Here is a sample [Link] file that prevents all robots from visiting the entire site
User-agent: * # applies to all robots
Disallow: / # disallow indexing of all pages

The Robot will simply look for a "/[Link]" URI on your site, where a site is defined as a HTTP server
running on a particular host and port number. Here are some sample locations for [Link]:

Site URI URI for [Link]

[Link] [Link]

[Link] [Link]

[Link] [Link]

[Link] [Link]

There can only be a single "/[Link]" on a site. Specifically, you should not put "[Link]" files in user
directories, because a robot will never look at them. If you want your users to be able to create their own
"[Link]", you will need to merge them all into a single "/[Link]". If you don’t want to do this your
users might want to use the Robots META Tag instead.

Some tips: URI’s are case-sensitive, and "/[Link]" string must be all lower-case. Blank lines are not
permitted.

316
B.5 Notes on tables

There must be exactly one "User-agent" field per record. The robot should be liberal in interpreting this
field. A case-insensitive substring match of the name without version information is recommended.

If the value is "*", the record describes the default access policy for any robot that has not matched any of
the other records. It is not allowed to have multiple such records in the "/[Link]" file.

The "Disallow" field specifies a partial URI that is not to be visited. This can be a full path, or a partial
path; any URI that starts with this value will not be retrieved. For example,
Disallow: /help disallows both /[Link] and /help/[Link], whereas
Disallow: /help/ would disallow /help/[Link] but allow /[Link].

An empty value for "Disallow", indicates that all URIs can be retrieved. At least one "Disallow" field
must be present in the [Link] file.

Robots and the META element


The META element allows HTML authors to tell visiting robots whether a document may be indexed, or
used to harvest more links. No server administrator action is required.

In the following example a robot should neither index this document, nor analyze it for links.
<META name="ROBOTS" content="NOINDEX, NOFOLLOW">

The list of terms in the content is ALL, INDEX, NOFOLLOW, NOINDEX. The name and the content
attribute values are case-insensitive.

Note. In early 1997 only a few robots implement this, but this is expected to change as more public
attention is given to controlling indexing robots.

B.5 Notes on tables


B.5.1 Design rationale
The HTML table model has evolved from studies of existing SGML tables models, the treatment of tables
in common word processing packages, and a wide range of tabular layout techniques in magazines, books
and other paper-based documents. The model was chosen to allow simple tables to be expressed simply
with extra complexity available when needed. This makes it practical to create the markup for HTML
tables with everyday text editors and reduces the learning curve for getting started. This feature has been
very important to the success of HTML to date.

Increasingly, people are creating tables by converting from other document formats or by creating them
directly with WYSIWYG editors. It is important that the HTML table model fit well with these authoring
tools. This affects how the cells that span multiple rows or columns are represented, and how alignment
and other presentation properties are associated with groups of cells.

317
B.5.1 Design rationale

Dynamic reformatting
A major consideration for the HTML table model is that the author does not control how a user will size a
table, what fonts he or she will use, etc. This makes it risky to rely on column widths specified in terms of
absolute pixel units. Instead, tables must be able to change sizes dynamically to match the current window
size and fonts. Authors can provide guidance as to the relative widths of columns, but user agents should
ensure that columns are wide enough to render the width of the largest element of the cell’s content. If the
author’s specification must be overridden, relative widths of individual columns should not be changed
drastically.

Incremental display
For large tables or slow network connections, incremental table display is important to user satisfaction.
User agents should be able to begin displaying a table before all of the data has been received. The default
window width for most user agents shows about 80 characters, and the graphics for many HTML pages
are designed with these defaults in mind. By specifying the number of columns, and including provision
for control of table width and the widths of different columns, authors can give hints to user agents that
allow the incremental display of table contents.

For incremental display, the browser needs the number of columns and their widths. The default width of
the table is the current window size (width="100%"). This can be altered by setting the width
attribute of the TABLE element. By default, all columns have the same width, but you can specify column
widths with one or more COL elements before the table data starts.

The remaining issue is the number of columns. Some people have suggested waiting until the first row of
the table has been received, but this could take a long time if the cells have a lot of content. On the whole
it makes more sense, when incremental display is desired, to get authors to explicitly specify the number
of columns in the TABLE element.

Authors still need a way of telling user agents whether to use incremental display or to size the table
automatically to fit the cell contents. In the two pass auto-sizing mode, the number of columns is
determined by the first pass. In the incremental mode, the number of columns must be stated up front
(with COL or COLGROUP elements.

Structure and presentation


HTML distinguishes structural markup such as paragraphs and quotations from rendering idioms such as
margins, fonts, colors, etc. How does this distinction affect tables? From the purist’s point of view, the
alignment of text within table cells and the borders between cells is a rendering issue, not one of structure.
In practice, though, it is useful to group these with the structural information, as these features are highly
portable from one application to the next. The HTML table model leaves most rendering information to
associated style sheets. The model presented in this specification is designed to take advantage of such
style sheets but not to require them.

Current desktop publishing packages provide very rich control over the rendering of tables, and it would
be impractical to reproduce this in HTML, without making HTML into a bulky rich text format like RTF
or MIF. This specification does, however, offer authors the ability to choose from a set of commonly used

318
B.5.2 Recommended Layout Algorithms

classes of border styles. The frame attribute controls the appearance of the border frame around the table
while the rules attribute determines the choice of rulings within the table. A finer level of control will
be supported via rendering annotations. The style attribute can be used for specifying rendering
information for individual elements. Further rendering information can be given with the STYLE element
in the document head or via linked style sheets.

During the development of this specification, a number of avenues were investigated for specifying the
ruling patterns for tables. One issue concerns the kinds of statements that can be made. Including support
for edge subtraction as well as edge addition leads to relatively complex algorithms. For instance, work on
allowing the full set of table elements to include the frame and rules attributes led to an algorithm
involving some 24 steps to determine whether a particular edge of a cell should be ruled or not. Even this
additional complexity doesn’t provide enough rendering control to meet the full range of needs for tables.
The current specification deliberately sticks to a simple intuitive model, sufficient for most purposes.
Further experimental work is needed before a more complex approach is standardized.

Row and column groups


This specification provides a superset of the simpler model presented in earlier work on HTML+. Tables
are considered as being formed from an optional caption together with a sequence of rows, which in turn
consist of a sequence of table cells. The model further differentiates header and data cells, and allows cells
to span multiple rows and columns.

Following the CALS table model (see [CALS] [p.329] ), this specification allows table rows to be grouped
into head and body and foot sections. This simplifies the representation of rendering information and can
be used to repeat table head and foot rows when breaking tables across page boundaries, or to provide
fixed headers above a scrollable body panel. In the markup, the foot section is placed before the body
sections. This is an optimization shared with CALS for dealing with very long tables. It allows the foot to
be rendered without having to wait for the entire table to be processed.

Accessibility
For the visually impaired, HTML offers the hope of setting to rights the damage caused by the adoption of
windows based graphical user interfaces. The HTML table model includes attributes for labeling each cell,
to support high quality text to speech conversion. The same attributes can also be used to support
automated import and export of table data to databases or spreadsheets.

B.5.2 Recommended Layout Algorithms


If COL or COLGROUP elements are present, they specify the number of columns and the table may be
rendered using a fixed layout. Otherwise the autolayout algorithm described below should be used.

If the width attribute is not specified, visual user agents should assume a default value of 100% for
formatting.

It is recommended that user agents increase table widths beyond the value specified by width in cases
when cell contents would otherwise overflow. User agents that override the specified width should do so
within reason. User agents may elect to split words across lines to avoid the need for excessive horizontal

319
B.5.2 Recommended Layout Algorithms

scrolling or when such scrolling is impractical or undesired.

For the purposes of layout, user agents should consider that table captions (specified by the CAPTION
element) behave like cells. Each caption is a cell that spans all of the table’s columns if at the top or
bottom of the table, and rows if at the left or right side of the table.

Fixed Layout Algorithm


For this algorithm, it is assumed that the number of columns is known. The column widths by default
should be set to the same size. Authors may override this by specifying relative or absolute column
widths, using the COLGROUP or COL elements. The default table width is the space between the current
left and right margins, but may be overridden by the width attribute on the TABLE element, or
determined from absolute column widths. To deal with mixtures of absolute and relative column widths,
the first step is to allocate space from the table width to columns with absolute widths. After this, the
space remaining is divided up between the columns with relative widths.

The table syntax alone is insufficient to guarantee the consistency of attribute values. For instance, the
number of COL and COLGROUP elements may be inconsistent with the number of columns implied by the
table cells. A further problem occurs when the columns are too narrow to avoid overflow of cell contents.
The width of the table as specified by the TABLE element or COL elements may result in overflow of cell
contents. It is recommended that user agents attempt to recover gracefully from these situations, e.g., by
hyphenating words [p.88] and resorting to splitting words if hyphenation points are unknown.

In the event that an indivisible element causes cell overflow, the user agent may consider adjusting
column widths and re-rendering the table. In the worst case, clipping may be considered if column width
adjustments and/or scrollable cell content are not feasible. In any case, if cell content is split or clipped
this should be indicated to the user in an appropriate manner.

Autolayout Algorithm
If the number of columns is not specified with COL and COLGROUP elements, then the user agent should
use the following autolayout algorithm. It uses two passes through the table data and scales linearly with
the size of the table.

In the first pass, line wrapping is disabled, and the user agent keeps track of the minimum and maximum
width of each cell. The maximum width is given by the widest line. Since line wrap has been disabled,
paragraphs are treated as long lines unless broken by BR elements. The minimum width is given by the
widest text element (word, image, etc.) taking into account leading indents and list bullets, etc. In other
words, it is necessary to determine the minimum width a cell would require in a window of its own before
the cell begins to overflow. Allowing user agents to split words will minimize the need for horizontal
scrolling or in the worst case, clipping the cell contents.

This process also applies to any nested tables occurring in cell content. The minimum and maximum
widths for cells in nested tables are used to determine the minimum and maximum widths for these tables
and hence for the parent table cell itself. The algorithm is linear with aggregate cell content, and broadly
speaking, independent of the depth of nesting.

320
B.5.2 Recommended Layout Algorithms

To cope with character alignment of cell contents, the algorithm keeps three running min/max totals for
each column: Left of align char, right of align char and unaligned. The minimum width for a column is
then: max(min_left + min_right, min_non-aligned).

The minimum and maximum cell widths are then used to determine the corresponding minimum and
maximum widths for the columns. These in turn, are used to find the minimum and maximum width for
the table. Note that cells can contain nested tables, but this doesn’t complicate the code significantly. The
next step is to assign column widths according to the available space (i.e., the space between the current
left and right margins).

For cells that span multiple columns, a simple approach consists of apportioning the min/max widths
evenly to each of the constituent columns. A slightly more complex approach is to use the min/max widths
of unspanned cells to weight how spanned widths are apportioned. Experiments suggest that a blend of the
two approaches gives good results for a wide range of tables.

The table borders and intercell margins need to be included in assigning column widths. There are three
cases:

1. The minimum table width is equal to or wider than the available space. In this case, assign the
minimum widths and allow the user to scroll horizontally. For conversion to braille, it will be
necessary to replace the cells by references to notes containing their full content. By convention these
appear before the table.
2. The maximum table width fits within the available space. In this case, set the columns to their
maximum widths.
3. The maximum width of the table is greater than the available space, but the minimum table
width is smaller. In this case, find the difference between the available space and the minimum table
width, lets call it W. Lets also call D the difference between maximum and minimum width of the
table.

For each column, let d be the difference between maximum and minimum width of that column.
Now set the column’s width to the minimum width plus d times W over D. This makes columns with
large differences between minimum and maximum widths wider than columns with smaller
differences.

This assignment step is then repeated for nested tables using the minimum and maximum widths derived
for all such tables in the first pass. In this case, the width of the parent table cell plays the role of the
current window size in the above description. This process is repeated recursively for all nested tables.
The topmost table is then rendered using the assigned widths. Nested tables are subsequently rendered as
part of the parent table’s cell contents.

If the table width is specified with the width attribute, the user agent attempts to set column widths to
match. The width attribute is not binding if this results in columns having less than their minimum (i.e.,
indivisible) widths.

If relative widths are specified with the COL element, the algorithm is modified to increase column widths
over the minimum width to meet the relative width constraints. The COL elements should be taken as hints
only, so columns shouldn’t be set to less than their minimum width. Similarly, columns shouldn’t be made
so wide that the table stretches well beyond the extent of the window. If a COL element specifies a relative

321
B.6 Notes on forms

width of zero, the column should always be set to its minimum width.

When using the two pass layout algorithm, the default alignment position in the absence of an explicit or
inherited charoff attribute can be determined by choosing the position that would center lines for which
the widths before and after the alignment character are at the maximum values for any of the lines in the
column for which align="char". For incremental table layout the suggested default is
charoff="50%". If several cells in different rows for the same column use character alignment, then by
default, all such cells should line up, regardless of which character is used for alignment. Rules for
handling objects too large for a column apply when the explicit or implied alignment results in a situation
where the data exceeds the assigned width of the column.

Choice of attribute names. It would have been preferable to choose values for the frame attribute
consistent with the rules attribute and the values used for alignment. For instance: none, top,
bottom, topbot, left, right, leftright, all. Unfortunately, SGML requires
enumerated attribute values to be unique for each element, independent of the attribute name. This causes
immediate problems for "none", "left", "right" and "all". The values for the frame attribute have been
chosen to avoid clashes with the rules, align, and valign attributes. This provides a measure of
future proofing, as it is anticipated that the frame and rules attributes will be added to other table
elements in future revisions to this specification. An alternative would be to make frame a CDATA
attribute. The consensus of the W3C HTML Working Group was that the benefits of being able to use
SGML validation tools to check attributes based on enumerated values outweighs the need for consistent
names.

B.6 Notes on forms


B.6.1 Incremental display
The incremental display of documents being received from the network gives rise to certain problems with
respect to forms. User agents should prevent forms from being submitted until all of the form’s elements
have been received.

The incremental display of documents raises some issues with respect to tabbing navigation. The heuristic
of giving focus to the lowest valued tabindex in the document seems reasonable enough at first glance.
However this implies having to wait until all of the document’s text is received, since until then, the
lowest valued tabindex may still change. If the user hits the tab key before then, it is reasonable for
user agents to move the focus to the lowest currently available tabindex.

If forms are associated with client-side scripts, there is further potential for problems. For instance, a
script handler for a given field may refer to a field that doesn’t yet exist.

B.6.2 Future projects


This specification defines a set of elements and attributes powerful enough to fulfill the general need for
producing forms. However there is still room for many possible improvements. For instance the following
problems could be addressed in the future:

322
B.7 Notes on scripting

The range of form field types is too limited in comparison with modern user interfaces. For instance
there is no provision for tabular data entry, sliders or multiple page layouts.
Servers cannot update the fields in a submitted form and instead have to send a complete HTML
document causing screen flicker.
These also cause problems for speech based browsers, making it difficult for the visually impaired to
interact with HTML forms.

Another possible extension would be to add the usemap attribute to INPUT for use as client-side image
map when "type=image". The AREA element corresponding to the location clicked would contribute the
value to be passed to the server. To avoid the need to modify server scripts, it may be appropriate to
extend AREA to provide x and y values for use with the INPUT element.

B.7 Notes on scripting


B.7.1 Reserved syntax for future script macros
This specification reserves syntax for the future support of script macros in HTML CDATA attributes.
The intention is to allow attributes to be set depending on the properties of objects that appear earlier on
the page. The syntax is:
attribute = "... &{ macro body }; ... "

Current Practice for Script Macros


The macro body is made up of one or more statements in the default scripting language (as per intrinsic
event attributes). The semicolon following the right brace is always needed, as otherwise the right brace
character "}" is treated as being part of the macro body. Its also worth noting that quote marks are always
needed for attributes containing script macros.

The processing of CDATA attributes proceeds as follows:

1. The SGML parser evaluates any SGML entities (e.g., "&gt;").


2. Next the script macros are evaluated by the script engine.
3. Finally the resultant character string is passed to the application for subsequent processing.

Macro processing takes place when the document is loaded (or reloaded) but does not take place again
when the document is resized, repainted, etc.

DEPRECATED EXAMPLE:
Here are some examples using JavaScript. The first one randomizes the document background color:

<BODY bgcolor=’&{randomrbg};’>

Perhaps you want to dim the background for evening viewing:

323
B.8 Notes on frames

<BODY bgcolor=’&{if([Link] > 18)...};’>

The next example uses JavaScript to set the coordinates for a client-side image map:

<MAP NAME=foo>
<AREA shape="rect" coords="&{myrect(imageuri)};" href="&{myuri};" alt="">
</MAP>

This example sets the size of an image based upon document properties:

<IMG src="[Link]" width=’&{[Link]/2};’ height=’50%’ alt="banner">

You can set the URI for a link or image by script:


<SCRIPT type="text/javascript">
function manufacturer(widget) {
...
}
function location(manufacturer) {
...
}
function logo(manufacturer) {
...
}
</SCRIPT>
<A href=’&{location(manufacturer("widget"))};’>widget</A>
<IMG src=’&{logo(manufacturer("widget"))};’ alt="logo">

This last example shows how SGML CDATA attributes can be quoted using single or double quote
marks. If you use single quotes around the attribute string then you can include double quote marks as part
of the attribute string. Another approach is use &quot; for double quote marks:

<IMG src="&{logo(manufacturer(&quot;widget&quot;))};" alt="logo">

B.8 Notes on frames


Since there is no guarantee that a frame target name is unique, it is appropriate to describe the current
practice in finding a frame given a target name:

1. If the target name is a reserved word as described in the normative text, apply it as described.
2. Otherwise, perform a depth-first search of the frame hierarchy in the window that contained the link.
Use the first frame whose name is an exact match.
3. If no such frame was found in (2), apply step 2 to each window, in a front-to-back ordering. Stop as
soon as you encounter a frame with exactly the same name.
4. If no such frame was found in (3), create a new window and assign it the target name.

324
B.9 Notes on accessibility

B.9 Notes on accessibility


Note. The following algorithm for generating alternate text may be superseded by recommendations by
the W3C Web Accessibility Initiative Group. Please consult [WAIGUIDE] [p.331] for more information.

When an author does not set the alt attribute for the IMG or APPLET elements, user agents should
supply the alternate text, calculated in the following order:

1. If the title has been specified, its value should be used as alternate text.
2. Otherwise, if HTTP headers provide title information when the included object is retrieved, this
information should be used as alternate text.
3. Otherwise, if the included object contains text fields (e.g., GIF images contain some text fields),
information extracted from the text fields should be used as alternate text. Since user agents may
have to retrieve an entire object first in order to extract textual information, user agents may adopt
more economical approaches (e.g., content negotiation).
4. Otherwise, in the absence of other information, user agents should use the file name (minus the
extension) as alternate text.

When an author does not set the alt attribute for the INPUT element, user agents should supply the
alternate text, calculated in the following order:

1. If the title has been specified, its value should be used as alternate text.
2. Otherwise, if the name has been specified, its value should be used as alternate text.
3. Otherwise (submit and reset buttons), the value of the type attribute should be used as alternate text.

B.10 Notes on security


Anchors, embedded images, and all other elements that contain URIs [p.44] as parameters may cause the
URI to be dereferenced in response to user input. In this case, the security issues of [RFC1738] [p.328] ,
section 6, should be considered. The widely deployed methods for submitting form requests -- HTTP and
SMTP -- provide little assurance of confidentiality. Information providers who request sensitive
information via forms -- especially with the INPUT element, type="password" -- should be aware and
make their users aware of the lack of confidentiality.

B.10.1 Security issues for forms


A user agent should not send any file that the user has not explicitly asked to be sent. Thus, HTML user
agents are expected to confirm any default file names that might be suggested by the value attribute of
the INPUT element. Hidden controls must not specify files.

This specification does not contain a mechanism for encryption of the data; this should be handled by
whatever other mechanisms are in place for secure transmission of data.

Once a file is uploaded, the processing agent should process and store it appropriately.

325
B.10.1 Security issues for forms

326
References

References
Contents

1. Normative references . . . . . . . . . . . . . . . . . 327


.
2. Informative references . . . . . . . . . . . . . . . . . 329
.

Normative references
[CSS1]
"Cascading Style Sheets, level 1", H. W. Lie and B. Bos, 17 December 1996.
Available at [Link]
[DATETIME]
"Date and Time Formats", W3C Note, M. Wolf and C. Wicksteed, 15 September 1997.
Available at [Link]
[IANA]
"Assigned Numbers", STD 2, RFC 1700, USC/ISI, J. Reynolds and J. Postel, October 1994.
Available at [Link]
[ISO639]
"Codes for the representation of names of languages", ISO 639:1988.
For more information, consult [Link]
See also [Link]
[ISO3166]
"Codes for the representation of names of countries", ISO 3166:1993.
[ISO8601]
"Data elements and interchange formats -- Information interchange -- Representation of dates and
times", ISO 8601:1988.
[ISO8879]
"Information Processing -- Text and Office Systems -- Standard Generalized Markup Language
(SGML)", ISO 8879:1986.
Please consult [Link] for information about the standard.
[ISO10646]
"Information Technology -- Universal Multiple-Octet Coded Character Set (UCS) -- Part 1:
Architecture and Basic Multilingual Plane", ISO/IEC 10646-1:1993. The current specification also
takes into consideration the first five amendments to ISO/IEC 10646-1:1993.
[ISO88591]
"Information Processing -- 8-bit single-byte coded graphic character sets -- Part 1: Latin alphabet No.
1", ISO 8859-1:1987.
[MIMETYPES]
List of registered content types (MIME types). Download a list of registered content types from
[Link]
[RFC1555]
"Hebrew Character Encoding for Internet Messages", H. Nussbacher and Y. Bourvine, December
1993.
Available at [Link]

327
Normative references

[RFC1556]
"Handling of Bi-directional Texts in MIME", H. Nussbacher, December 1993.
Available at [Link]
[RFC1738]
"Uniform Resource Locators", T. Berners-Lee, L. Masinter, and M. McCahill, December 1994.
Available at [Link]
[RFC1766]
"Tags for the Identification of Languages", H. Alvestrand, March 1995.
Available at [Link]
[RFC1808]
"Relative Uniform Resource Locators", R. Fielding, June 1995.
Available at [Link]
[RFC2044]
"UTF-8, a transformation format of Unicode and ISO 10646", F. Yergeau, October 1996.
Available at [Link]
[RFC2045]
"Multipurpose Internet Mail Extensions (MIME) Part One: Format of Internet Message Bodies", N.
Freed and N. Borenstein, November 1996.
Available at [Link] Note that this RFC obsoletes RFC1521, RFC1522,
and RFC1590.
[RFC2046]
"Multipurpose Internet Mail Extensions (MIME) Part Two: Media Types", N. Freed and N.
Borenstein, November 1996.
Available at [Link] Note that this RFC obsoletes RFC1521, RFC1522,
and RFC1590.
[RFC2068]
"HTTP Version 1.1 ", R. Fielding, J. Gettys, J. Mogul, H. Frystyk Nielsen, and T. Berners-Lee,
January 1997.
Available at [Link]
[RFC2119]
"Key words for use in RFCs to Indicate Requirement Levels", S. Bradner, March 1997.
Available at [Link]
[RFC2141]
"URN Syntax", R. Moats, May 1997.
Available at [Link]
[SRGB]
"A Standard Default color Space for the Internet", version 1.10, M. Stokes, M. Anderson, S.
Chandrasekar, and R. Motta, 5 November 1996.
Available at [Link]
[UNICODE]
"The Unicode Standard: Version 2.0", The Unicode Consortium, Addison-Wesley Developers Press,
1996. The specification also takes into consideration the corrigenda at
[Link]
For more information, consult the Unicode Consortium’s home page at [Link]
[URI]
"Uniform Resource Identifiers (URI): Generic Syntax and Semantics", T. Berners-Lee, R. Fielding,

328
Informative references

L. Masinter, 18 November 1997.


Available at [Link] This is a work in
progress that is expected to update [RFC1738] [p.328] and [RFC1808] [p.328] .
[WEBSGML]
"Proposed TC for WebSGML Adaptations for SGML", C. F. Goldfarb, ed., 14 June 1997.
Available at [Link]

Informative references
[BRYAN88]
"SGML: An Author’s Guide to the Standard Generalized Markup Language", M. Bryan,
Addison-Wesley Publishing Co., 1988.
[CALS]
Continuous Acquisition and Life-Cycle Support (CALS). CALS is a Department of Defense strategy
for achieving effective creation, exchange, and use of digital data for weapon systems and
equipment. More information can be found on the CALS home page at
[Link]
[CHARSETS]
Registered charset values. Download a list of registered charset values from
[Link]
[CSS2]
"Cascading Style Sheets, level 2", B. Bos, H. W. Lie, C. Lilley, and I. Jacobs, November 1997.
Available at [Link]
[DCORE]
The Dublin Core: for more information see [Link]
[ETHNO]
"Ethnologue, Languages of the World", 12th Edition, Barbara F. Grimes editor, Summer Institute of
Linguistics, October 1992.
[GOLD90]
"The SGML Handbook", C. F. Goldfarb, Clarendon Press, 1991.
[HTML30]
"HyperText Markup Language Specification Version 3.0", Dave Raggett, September 1995.
Available at [Link]
[HTML32]
"HTML 3.2 Reference Specification", Dave Raggett, 14 January 1997.
Available at [Link]
[HTML3STYLE]
"HTML and Style Sheets", B. Bos, D. Raggett, and H. Lie, 24 March 1997.
Available at [Link]
[LEXHTML]
"A Lexical Analyzer for HTML and Basic SGML", D. Connolly, 15 June 1996. Available at
[Link]
[PICS]
Platform for Internet Content (PICS). For more information see [Link]

329
Informative references

[RDF]
The Resource Description Language: for more information see [Link]
[RFC822]
"Standard for the Format of ARPA Internet Text Messages", Revised by David H. Crocker, August
1982.
Available at [Link]
[RFC850]
"Standard for Interchange of USENET Messages", M. Horton, June 1983.
Available at [Link]
[RFC1468]
"Japanese Character Encoding for Internet Messages", J. Murai, M. Crispin, and E. van der Poel,
June 1993.
Available at [Link]
[RFC1630]
"Universal Resource Identifiers in WWW: A Unifying Syntax for the Expression of Names and
Addresses of Objects on the Network as used in the World-Wide Web", T. Berners-Lee, June 1994.
Available at [Link]
[RFC1866]
"HyperText Markup Language 2.0", T. Berners-Lee and D. Connolly, November 1995.
Available at [Link]
[RFC1867]
"Form-based File Upload in HTML", E. Nebel and L. Masinter, November 1995.
Available at [Link] RFC1867 is expected to be updated by
[Link] currently a work in progress.
[RFC1942]
"HTML Tables", Dave Raggett, May 1996.
Available at [Link]
[RFC2048]
"Multipurpose Internet Mail Extensions (MIME) Part Four: Registration Procedures", N. Freed, J.
Klensin, and J. Postel, November 1996.
Available at [Link] Note that this RFC obsoletes RFC1521, RFC1522,
and RFC1590.
[RFC2070]
"Internationalization of the HyperText Markup Language", F. Yergeau, G. Nicol, G. Adams, and M.
Dürst, January 1997.
Available at [Link]
[SGMLOPEN]
The SGML Consortium. Consult the home page of the SGML Consortium at
[Link]
[SP]
SP is a public domain SGML parser.
Available at [Link] Further information is available at [Link]
[SQ91]
"The SGML Primer", 3rd Edition, SoftQuad Inc., 1991.
[TAKADA]
"Multilingual Information Exchange through the World-Wide Web", Toshihiro Takada, Computer

330
Informative references

Networks and ISDN Systems, Vol. 27, No. 2, pp. 235-241, November 1994.
[WAIGUIDE]
Guidelines for designing accessible HTML documents are available at the Web Accessibility
Initiative (WAI) Web site: [Link]
[VANH90]
"Practical SGML", E. van Herwijnen, Kluwer Academic Publishers Group, Norwell and Dordrecht,
1990.

331
Informative references

332
Index of Elements

Index of Elements
Legend: Optional, Forbidden, Empty, Deprecated, Loose DTD, Frameset DTD

Start End
Name Empty Depr. DTD Description
Tag Tag
A [p.138] anchor
abbreviated form (e.g., WWW, HTTP,
ABBR [p.82]
etc.)
ACRONYM [p.82]
ADDRESS [p.70] information on author
APPLET [p.160] D L Java applet
AREA [p.163] F E client-side image map area
B [p.187] bold text style
BASE [p.146] F E document base URI
BASEFONT
F E D L base font size
[p.188]
BDO [p.76] I18N BiDi over-ride
BIG [p.187] large text style
BLOCKQUOTE
long quotation
[p.84]
BODY [p.62] O O document body
BR [p.87] F E forced line break
BUTTON [p.215] push button
CAPTION [p.105] table caption
CENTER [p.185] D L shorthand for DIV align=center
CITE [p.82] citation
CODE [p.82] computer code fragment
COL [p.110] F E table column
COLGROUP
O table column group
[p.108]

333
Index of Elements

DD [p.96] O definition description


DEL [p.91] deleted text
DFN [p.82] instance definition
DIR [p.99] D L directory list
DIV [p.67] generic language/style container
DL [p.96] definition list
DT [p.96] O definition term
EM [p.82] emphasis
FIELDSET [p.225] form control group
FONT [p.188] D L local change to font
FORM [p.210] interactive form
FRAME [p.197] F E F subwindow
FRAMESET
F window subdivision
[p.194]
H1 [p.68] heading
H2 [p.68] heading
H3 [p.68] heading
H4 [p.68] heading
H5 [p.68] heading
H6 [p.68] heading
HEAD [p.55] O O document head
HR [p.190] F E horizontal rule
HTML [p.55] O O document root element
I [p.187] italic text style
IFRAME [p.204] L inline subwindow
IMG [p.150] F E Embedded image
INPUT [p.211] F E form control
INS [p.91] inserted text

334
Index of Elements

ISINDEX [p.223] F E D L single line prompt


KBD [p.82] text to be entered by the user
LABEL [p.224] form field label text
LEGEND [p.225] fieldset legend
LI [p.95] O list item
LINK [p.143] F E a media-independent link
MAP [p.163] client-side image map
MENU [p.99] D L menu list
META [p.58] F E generic metainformation
NOFRAMES alternate content container for non
F
[p.202] frame-based rendering
alternate content container for non
NOSCRIPT [p.244]
script-based rendering
OBJECT [p.152] generic embedded object
OL [p.94] ordered list
OPTGROUP
option group
[p.217]
OPTION [p.217] O selectable choice
P [p.87] O paragraph
PARAM [p.156] F E named property value
PRE [p.88] preformatted text
Q [p.84] short inline quotation
S [p.187] D L strike-through text style
SAMP [p.82] sample program output, scripts, etc.
SCRIPT [p.238] script statements
SELECT [p.217] option selector
SMALL [p.187] small text style
SPAN [p.67] generic language/style container
STRIKE [p.187] D L strike-through text

335
Index of Elements

STRONG [p.82] strong emphasis


STYLE [p.174] style info
SUB [p.86] subscript
SUP [p.86] superscript
TABLE [p.103]
TBODY [p.106] O O table body
TD [p.114] O table data cell
TEXTAREA
multi-line text field
[p.221]
TFOOT [p.106] O table footer
TH [p.114] O table header cell
THEAD [p.106] O table header
TITLE [p.56] document title
TR [p.114] O table row
TT [p.187] teletype or monospaced text style
U [p.187] D L underlined text style
UL [p.94] unordered list
instance of a variable or program
VAR [p.82]
argument

336
Index of Attributes

Index of Attributes
Legend: Deprecated, Loose DTD, Frameset DTD

Related
Name Type Default Depr. DTD Comment
Elements
abbreviation for
abbr [p.115] TD, TH %Text; [p.253] #IMPLIED
header cell
accept-charset %Charsets; list of supported
FORM #IMPLIED
[p.210] [p.252] charsets
list of MIME
%ContentTypes;
accept [p.210] INPUT #IMPLIED types for file
[p.252]
upload
A, AREA,
BUTTON,
accesskey %Character; accessibility key
INPUT, LABEL, #IMPLIED
[p.229] [p.252] character
LEGEND,
TEXTAREA
server-side form
action [p.210] FORM %URI; [p.253] #REQUIRED
handler
%CAlign;
align [p.105] CAPTION #IMPLIED D L relative to table
[p.282]
APPLET,
vertical or
IFRAME, IMG,
align [p.169] %IAlign; [p.274] #IMPLIED D L horizontal
INPUT,
alignment
OBJECT
relative to
align [p.226] LEGEND %LAlign; [p.280] #IMPLIED D L
fieldset
table position
align [p.103] TABLE %TAlign; [p.281] #IMPLIED D L relative to
window
(left | center |
align [p.190] HR #IMPLIED D L
right)
DIV, H1, H2,
(left | center | align, text
align [p.184] H3, H4, H5, H6, #IMPLIED D L
right | justify) alignment
P

337
Index of Attributes

COL,
COLGROUP, (left | center |
align [p.121] TBODY, TD, right | justify | #IMPLIED
TFOOT, TH, char)
THEAD, TR
color of selected
alink [p.63] BODY %Color; [p.269] #IMPLIED D L
links
alt [p.169] APPLET %Text; [p.269] #IMPLIED D L short description
alt [p.169] AREA, IMG %Text; [p.253] #REQUIRED short description
alt [p.169] INPUT CDATA [p.44] #IMPLIED short description
archive space separated
OBJECT %URI; [p.253] #IMPLIED
[p.153] archive list
archive comma separated
APPLET CDATA [p.44] #IMPLIED D L
[p.160] archive list
names groups of
axis [p.115] TD, TH CDATA [p.44] #IMPLIED
related headers
texture tile for
background
BODY %URI; [p.269] #IMPLIED D L document
[p.63]
background
bgcolor background color
TABLE %Color; [p.269] #IMPLIED D L
[p.183] for cells
bgcolor background color
TR %Color; [p.269] #IMPLIED D L
[p.183] for row
bgcolor cell background
TD, TH %Color; [p.269] #IMPLIED D L
[p.183] color
bgcolor document
BODY %Color; [p.269] #IMPLIED D L
[p.183] background color
border [p.169] IMG, OBJECT %Length; [p.274] #IMPLIED D L link border width
controls frame
border [p.120] TABLE %Pixels; [p.257] #IMPLIED width around
table
cellpadding spacing within
TABLE %Length; [p.257] #IMPLIED
[p.124] cells
cellspacing spacing between
TABLE %Length; [p.257] #IMPLIED
[p.124] cells

338
Index of Attributes

COL,
COLGROUP,
%Character; alignment char,
char [p.122] TBODY, TD, #IMPLIED
[p.252] e.g. char=’:’
TFOOT, TH,
THEAD, TR
COL,
COLGROUP,
charoff offset for
TBODY, TD, %Length; [p.257] #IMPLIED
[p.122] alignment char
TFOOT, TH,
THEAD, TR
charset A, LINK, %Charset; char encoding of
#IMPLIED
[p.139] SCRIPT [p.252] linked resource
checked for radio buttons
INPUT (checked) #IMPLIED
[p.212] and check boxes
BLOCKQUOTE, URI for source
cite [p.84] %URI; [p.253] #IMPLIED
Q document or msg
info on reason for
cite [p.91] DEL, INS %URI; [p.253] #IMPLIED
change
All elements but
BASE,
BASEFONT,
HEAD, HTML, space separated
class [p.65] CDATA [p.44] #IMPLIED
META, list of classes
PARAM,
SCRIPT,
STYLE, TITLE
classid identifies an
OBJECT %URI; [p.253] #IMPLIED
[p.153] implementation
(left | all | right | control of text
clear [p.186] BR none D L
none) flow
code [p.160] APPLET CDATA [p.44] #IMPLIED D L applet class file
base URI for
codebase
OBJECT %URI; [p.253] #IMPLIED classid, data,
[p.153]
archive
codebase optional base
APPLET %URI; [p.269] #IMPLIED D L
[p.160] URI for applet
codetype %ContentType; content type for
OBJECT #IMPLIED
[p.153] [p.252] code
BASEFONT,
color [p.189] %Color; [p.269] #IMPLIED D L text color
FONT

339
Index of Attributes

list of lengths,
%MultiLengths;
cols [p.195] FRAMESET #IMPLIED F default: 100% (1
[p.257]
col)
cols [p.222] TEXTAREA NUMBER [p.44] #REQUIRED
colspan number of cols
TD, TH NUMBER [p.44] 1
[p.115] spanned by cell
compact
DIR, MENU (compact) #IMPLIED D L
[p.95]
compact reduced interitem
DL, OL, UL (compact) #IMPLIED D L
[p.95] spacing
associated
content [p.59] META CDATA [p.44] #REQUIRED
information
comma separated
coords [p.163] AREA %Coords; [p.256] #IMPLIED
list of lengths
for use with
coords [p.163] A %Coords; [p.256] #IMPLIED client-side image
maps
reference to
data [p.153] OBJECT %URI; [p.253] #IMPLIED
object’s data
datetime %Datetime; date and time of
DEL, INS #IMPLIED
[p.91] [p.253] change
declare declare but don’t
OBJECT (declare) #IMPLIED
[p.153] instantiate flag
UA may defer
defer [p.238] SCRIPT (defer) #IMPLIED execution of
script
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
direction for
dir [p.73] FRAME, (ltr | rtl) #IMPLIED
weak/neutral text
FRAMESET,
HR, IFRAME,
PARAM,
SCRIPT
dir [p.77] BDO (ltr | rtl) #REQUIRED directionality

340
Index of Attributes

BUTTON,
INPUT,
disabled OPTGROUP, unavailable in
(disabled) #IMPLIED
[p.230] OPTION, this context
SELECT,
TEXTAREA
enctype %ContentType; "application/x-www-
FORM
[p.210] [p.252] form-urlencoded"
BASEFONT, comma separated
face [p.189] CDATA [p.44] #IMPLIED D L
FONT list of font names
matches field ID
for [p.224] LABEL IDREF [p.44] #IMPLIED
value
%TFrame; which parts of
frame [p.119] TABLE #IMPLIED
[p.262] frame to render
frameborder FRAME, request frame
(1 | 0) 1 F
[p.198] IFRAME borders?
headers list of id’s for
TD, TH IDREFS [p.44] #IMPLIED
[p.115] header cells
height [p.205] IFRAME %Length; [p.274] #IMPLIED L frame height
height [p.168] IMG, OBJECT %Length; [p.257] #IMPLIED override height
height [p.160] APPLET %Length; [p.274] #REQUIRED D L initial height
height [p.116] TD, TH %Pixels; [p.274] #IMPLIED D L height for cell
URI for linked
href [p.139] A, AREA, LINK %URI; [p.253] #IMPLIED
resource
URI that acts as
href [p.146] BASE %URI; [p.253] #IMPLIED
base URI
hreflang %LanguageCode;
A, LINK #IMPLIED language code
[p.139] [p.252]
hspace APPLET, IMG,
%Pixels; [p.274] #IMPLIED D L horizontal gutter
[p.168] OBJECT
http-equiv HTTP response
META NAME [p.44] #IMPLIED
[p.59] header name
All elements but
BASE, HEAD,
document-wide
id [p.65] HTML, META, ID [p.44] #IMPLIED
unique id
SCRIPT,
STYLE, TITLE

341
Index of Attributes

use server-side
ismap [p.167] IMG (ismap) #IMPLIED
image map
for use in
label [p.219] OPTION %Text; [p.253] #IMPLIED hierarchical
menus
for use in
label [p.218] OPTGROUP %Text; [p.253] #REQUIRED hierarchical
menus
All elements but
APPLET, BASE,
BASEFONT,
BR, FRAME, %LanguageCode;
lang [p.71] #IMPLIED language code
FRAMESET, [p.252]
HR, IFRAME,
PARAM,
SCRIPT
language predefined script
SCRIPT CDATA [p.44] #IMPLIED D L
[p.238] language name
link [p.63] BODY %Color; [p.269] #IMPLIED D L color of links
link to long
longdesc description
IMG %URI; [p.253] #IMPLIED
[p.151] (complements
alt)
link to long
longdesc FRAME, description
%URI; [p.253] #IMPLIED F
[p.197] IFRAME (complements
title)
marginheight FRAME, margin height in
%Pixels; [p.257] #IMPLIED F
[p.198] IFRAME pixels
marginwidth FRAME, margin widths in
%Pixels; [p.257] #IMPLIED F
[p.198] IFRAME pixels
maxlength max chars for
INPUT NUMBER [p.44] #IMPLIED
[p.212] text fields
%MediaDesc; designed for use
media [p.175] STYLE #IMPLIED
[p.252] with these media
%MediaDesc; for rendering on
media [p.175] LINK #IMPLIED
[p.252] these media
HTTP method
method
FORM (GET | POST) GET used to submit
[p.210]
the form

342
Index of Attributes

multiple default is single


SELECT (multiple) #IMPLIED
[p.217] selection
BUTTON,
name [p.216] CDATA [p.44] #IMPLIED
TEXTAREA
allows applets to
name [p.160] APPLET CDATA [p.44] #IMPLIED D L
find each other
name [p.217] SELECT CDATA [p.44] #IMPLIED field name
FRAME, name of frame
name [p.197] CDATA [p.44] #IMPLIED F
IFRAME for targetting
name [p.139] A CDATA [p.44] #IMPLIED named link end
INPUT, submit as part of
name [p.212] CDATA [p.44] #IMPLIED
OBJECT form
for reference by
name [p.163] MAP CDATA [p.44] #REQUIRED
usemap
name [p.156] PARAM CDATA [p.44] #REQUIRED property name
metainformation
name [p.59] META NAME [p.44] #IMPLIED
name
this region has no
nohref [p.164] AREA (nohref) #IMPLIED
action
noresize allow users to
FRAME (noresize) #IMPLIED F
[p.198] resize frames?
noshade
HR (noshade) #IMPLIED D L
[p.190]
nowrap suppress word
TD, TH (nowrap) #IMPLIED D L
[p.116] wrap
serialized applet
object [p.160] APPLET CDATA [p.44] #IMPLIED D L
file
A, AREA,
BUTTON,
the element lost
onblur [p.241] INPUT, LABEL, %Script; [p.253] #IMPLIED
the focus
SELECT,
TEXTAREA
INPUT,
onchange the element value
SELECT, %Script; [p.253] #IMPLIED
[p.241] was changed
TEXTAREA

343
Index of Attributes

All elements but


APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onclick a pointer button
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.240] was clicked
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET, a pointer button
ondblclick
HEAD, HTML, %Script; [p.253] #IMPLIED was double
[p.240]
IFRAME, clicked
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
A, AREA,
BUTTON,
onfocus the element got
INPUT, LABEL, %Script; [p.253] #IMPLIED
[p.241] the focus
SELECT,
TEXTAREA
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onkeydown a key was
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] pressed down
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE

344
Index of Attributes

All elements but


APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET, a key was
onkeypress
HEAD, HTML, %Script; [p.253] #IMPLIED pressed and
[p.241]
IFRAME, released
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onkeyup a key was
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] released
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
onload all the frames
FRAMESET %Script; [p.253] #IMPLIED F
[p.240] have been loaded
onload the document has
BODY %Script; [p.253] #IMPLIED
[p.240] been loaded
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET, a pointer button
onmousedown
HEAD, HTML, %Script; [p.253] #IMPLIED was pressed
[p.240]
IFRAME, down
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE

345
Index of Attributes

All elements but


APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onmousemove a pointer was
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] moved within
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onmouseout a pointer was
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] moved away
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
All elements but
APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onmouseover a pointer was
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] moved onto
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE

346
Index of Attributes

All elements but


APPLET, BASE,
BASEFONT,
BDO, BR,
FONT, FRAME,
FRAMESET,
onmouseup a pointer button
HEAD, HTML, %Script; [p.253] #IMPLIED
[p.241] was released
IFRAME,
ISINDEX,
META,
PARAM,
SCRIPT,
STYLE, TITLE
onreset the form was
FORM %Script; [p.253] #IMPLIED
[p.241] reset
onselect INPUT, some text was
%Script; [p.253] #IMPLIED
[p.241] TEXTAREA selected
onsubmit the form was
FORM %Script; [p.253] #IMPLIED
[p.241] submitted
all the frames
onunload
FRAMESET %Script; [p.253] #IMPLIED F have been
[p.240]
removed
onunload the document has
BODY %Script; [p.253] #IMPLIED
[p.240] been removed
named dictionary
profile [p.55] HEAD %URI; [p.253] #IMPLIED
of meta info
prompt
ISINDEX %Text; [p.269] #IMPLIED D L prompt message
[p.223]
readonly
TEXTAREA (readonly) #IMPLIED
[p.231]
readonly for text and
INPUT (readonly) #IMPLIED
[p.231] passwd
%LinkTypes; forward link
rel [p.139] A, LINK #IMPLIED
[p.252] types
%LinkTypes;
rev [p.139] A, LINK #IMPLIED reverse link types
[p.252]
list of lengths,
%MultiLengths;
rows [p.195] FRAMESET #IMPLIED F default: 100% (1
[p.257]
row)
rows [p.222] TEXTAREA NUMBER [p.44] #REQUIRED

347
Index of Attributes

rowspan number of rows


TD, TH NUMBER [p.44] 1
[p.115] spanned by cell
rulings between
rules [p.120] TABLE %TRules; [p.263] #IMPLIED
rows and cols
select form of
scheme [p.59] META CDATA [p.44] #IMPLIED
content
scope covered by
scope [p.115] TD, TH %Scope; [p.264] #IMPLIED
header cells
scrolling FRAME,
(yes | no | auto) auto F scrollbar or none
[p.198] IFRAME
selected
OPTION (selected) #IMPLIED
[p.219]
controls
shape [p.163] AREA %Shape; [p.256] rect interpretation of
coords
for use with
shape [p.163] A %Shape; [p.256] rect client-side image
maps
size [p.190] HR %Pixels; [p.274] #IMPLIED D L
[+|-]nn e.g.
size [p.189] FONT CDATA [p.44] #IMPLIED D L size="+1",
size="4"
specific to each
size [p.212] INPUT CDATA [p.44] #IMPLIED
type of field
base font size for
size [p.189] BASEFONT CDATA [p.44] #REQUIRED D L
FONT elements
size [p.217] SELECT NUMBER [p.44] #IMPLIED rows visible
COL attributes
span [p.110] COL NUMBER [p.44] 1
affect N columns
default number of
span [p.108] COLGROUP NUMBER [p.44] 1
columns in group
URI for an
src [p.238] SCRIPT %URI; [p.253] #IMPLIED
external script
for fields with
src [p.213] INPUT %URI; [p.253] #IMPLIED
images
FRAME, source of frame
src [p.197] %URI; [p.253] #IMPLIED F
IFRAME content

348
Index of Attributes

URI of image to
src [p.151] IMG %URI; [p.253] #REQUIRED
embed
standby message to show
OBJECT %Text; [p.253] #IMPLIED
[p.153] while loading
starting sequence
start [p.95] OL NUMBER [p.44] #IMPLIED D L
number
All elements but
BASE,
BASEFONT,
HEAD, HTML, %StyleSheet; associated style
style [p.174] #IMPLIED
META, [p.253] info
PARAM,
SCRIPT,
STYLE, TITLE
summary purpose/structure
TABLE %Text; [p.253] #IMPLIED
[p.103] for speech output
A, AREA,
BUTTON,
tabindex INPUT, position in
NUMBER [p.44] #IMPLIED
[p.228] OBJECT, tabbing order
SELECT,
TEXTAREA
A, AREA,
%FrameTarget; render in this
target [p.200] BASE, FORM, #IMPLIED L
[p.269] frame
LINK
document text
text [p.63] BODY %Color; [p.269] #IMPLIED D L
color
title [p.57] STYLE %Text; [p.253] #IMPLIED advisory title
All elements but
BASE,
BASEFONT,
HEAD, HTML, advisory
title [p.57] %Text; [p.253] #IMPLIED
META, title/amplification
PARAM,
SCRIPT,
STYLE, TITLE
%ContentType; advisory content
type [p.139] A, LINK #IMPLIED
[p.252] type
%ContentType; content type for
type [p.153] OBJECT #IMPLIED
[p.252] data

349
Index of Attributes

content type for


%ContentType;
type [p.157] PARAM #IMPLIED value when
[p.252]
valuetype=ref
%ContentType; content type of
type [p.238] SCRIPT #REQUIRED
[p.252] script language
%ContentType; content type of
type [p.175] STYLE #REQUIRED
[p.252] style language
%InputType; what kind of
type [p.212] INPUT TEXT
[p.260] widget is needed
%LIStyle;
type [p.95] LI #IMPLIED D L list item style
[p.278]
%OLStyle;
type [p.95] OL #IMPLIED D L numbering style
[p.277]
%ULStyle;
type [p.95] UL #IMPLIED D L bullet style
[p.278]
(button | submit | for use as form
type [p.216] BUTTON submit
reset) button
usemap IMG, INPUT, use client-side
%URI; [p.253] #IMPLIED
[p.164] OBJECT image map
COL,
COLGROUP,
(top | middle | vertical
valign [p.121] TBODY, TD, #IMPLIED
bottom | baseline) alignment in cells
TFOOT, TH,
THEAD, TR
defaults to
value [p.219] OPTION CDATA [p.44] #IMPLIED
element content
value [p.156] PARAM CDATA [p.44] #IMPLIED property value
required for radio
value [p.212] INPUT CDATA [p.44] #IMPLIED
and checkboxes
sent to server
value [p.216] BUTTON CDATA [p.44] #IMPLIED
when submitted
reset sequence
value [p.95] LI NUMBER [p.44] #IMPLIED D L
number
valuetype (DATA | REF | How to interpret
PARAM DATA
[p.156] OBJECT) value
%[Link];
version [p.55] HTML CDATA [p.44] D L Constant
[p.267]

350
Index of Attributes

color of visited
vlink [p.63] BODY %Color; [p.269] #IMPLIED D L
links
vspace APPLET, IMG,
%Pixels; [p.274] #IMPLIED D L vertical gutter
[p.168] OBJECT
width [p.190] HR %Length; [p.274] #IMPLIED D L
width [p.204] IFRAME %Length; [p.274] #IMPLIED L frame width
width [p.168] IMG, OBJECT %Length; [p.257] #IMPLIED override width
width [p.103] TABLE %Length; [p.257] #IMPLIED table width
width [p.160] APPLET %Length; [p.274] #REQUIRED D L initial width
%MultiLength; column width
width [p.110] COL #IMPLIED
[p.257] specification
%MultiLength; default width for
width [p.109] COLGROUP #IMPLIED
[p.257] enclosed COLs
width [p.116] TD, TH %Pixels; [p.274] #IMPLIED D L width for cell
width [p.88] PRE NUMBER [p.44] #IMPLIED D L

351
Index of Attributes

352
Index

Index
abbreviations and acronyms 83
access key 229
accessibility
access keys 229
alternate object content 155
alternate text 169
and alternate frame content 202
and long frame descriptions 203
and style sheets 172
features in HTML 4.0 20
long image description 152
notes on generating alternate text 325
of image maps 163, 165
alignment
floating text 186
floats 185
of block-level elements 183
of images 169
of objects 169
of table contents 121
alternate style sheets 178
alternate text
specifying 169
anchor 135
ASCII characters in name 142
case of name 141
character references in name 143
creation of with A 140
creation with id attribute 142
name space of 142
non-ASCII characters in name 311
set by script 140
syntax of name 141
uniqueness of name 141
with A vs. id 143
applet
ways to include 150
application/x-www-form-urlencoded 234, 210
attribute 25
#FIXED value of 30
#IMPLIED value of 30
#REQUIRED value of 30
boolean 31
case of values 30

353
Index

case-insensitive 26
declaration of in DTD 30
minimized boolean 32
quotation marks around value 25
%attrs; 31
author 33
authoring tool 33, 82
and default style sheet language 174

background color 183


base URI 146
bidirection
Unicode algorithm 74
and character encoding 78
and style sheets 79
override of 77
block-level
and bidirection 75, 67
element 66
%block; 27
BODY
none in frameset 64
boolean attribute 313, 31
minimized 32
border
around a frame 198
around a table 119
around image 168
around object 168

cascading style sheets 179


case
of URIs 45
of anchor name 141
of attribute names 26
of attribute values 26, 30, 43
of character encodings 47
of character entity reference 42
of color names 45
of content types 46
of element names 25
of language codes 47
of length values 46
of link types 48
of media descriptors 50
of numeric character references 41
of script data 51

354
Index

of style data 51
catalog for HTML 248
CDATA 30, 44
script and style data 44
CERN 19
character encoding 38, 35
UTF-1 39
UTF-16 39
and bidirection 78
choice of 38
common examples 38
default 40
for form submission 210
names of 47
of links 138
specification of 39
user agent’s determination of 40
character entity references 41
character reference 40, 26
for directionality 78
character repertoire 37
%Character; 47
characters
abstract 37
access key 229
best effort to render 71
handling undisplayable 42
rendering undisplayable 42
%Charset; 47
checkbox 209
class attribute
roles of 65
client-side image map 162
creation of 164
clipping
table text 106
code position 37
color
background 183
names of 45
%Color; 45
column
number of in a table 111
width of in a table 112
column group 108

355
Index

comments
character references in 41
in DTD 27
in HTML 26
informative only 35
not rendered 35
used to hide script data 245
used to hide style sheet data 181
conformance 33
content model 28
excluded elements in 29
syntax of in DTD 28
content type
application/x-www-form-urlencoded 234
multipart/form-data 234
text/css 47
text/html 35
content types
for encoding form data 234
Content-Language header 82
Content-Script-Type header 239
Content-Style-Type header 173
Content-Type header 39
%ContentType; 46
control 208
access key for 229
control name 208
control value 208
disabled 230
events for 242
giving focus to 227
initial value 208
read only 231
successful 232
tabbing navigation 228
types of 208
coordinates
of form submit click 214
of server-side image map 167

data cell
in table 116
data type
CDATA 44
ID 44
IDREF 44
IDREFS 44

356
Index

NAME 44
NUMBER 44
date
format of 47
of inserted and deleted text 91
%Datetime; 47
default
character encoding 40
scripting language 239
style sheet language 173
target frame 201
deprecated 34
elements 301
direction
inheritance of for nested elements 75
of table information 105
of text 73
disabled controls 230
not successful 232
document
SGML validation 247
dynamic modification with script 243
ways to embed 162
ways to include 204, 150
document character set 37
ISO10646 37
equivalence of ISO10646 and UNICODE 38
document type declaration 54
for frameset DTD 54
for strict DTD 54
for transitional DTD 54
document type definition 24
DTD fragments conform to 34
comments in 27
examples conform to 34
frameset 287
how to read 27
strict 251
transitional 267
Dublin Core 62

element
block-level 66
case-insensitive 25
content model of 28
empty 24, 28
end tag 24

357
Index

inline 66
list of deprecated 301
list of obsolete 302
omitted end tag 24
omitted start tag 24
references from scripts 240
start tag 24
support for deprecated 34
support for obsolete 34
type declaration 24, 28
types 24
unique identifier for 65
empty element 28
end tag 24
declared as optional 28
omitted 24
entity sets
URIs for HTML 4.0 54
error
handling by user agents 310, 34
image map with IMG in BUTTON 217
rendering style rules in STYLE 175
unavailable resource 143
events 240

file select control 209


submission of 232
#FIXED attribute value 30
floating objects 185
floating text 186
focus 227
and access key 229
label gives to control 225
font
style with HTML 187
form
adding labels to 223
content types for encoding 234
control types 208
controls in 208
display notes 322
encoding data of 233
methods and actions 233
navigating through controls 228
processing controls of 233
reset of 208
structuring controls in 226

358
Index

submission method of 231


submission of 231
tabbing order of controls 228
values submitted 232
form data set 233
encoding 233
fragment identifier 18, 136
frame
URI problems with 201
border of 198
initial contents of 198
inline 204
introduction to 193
list of reserved target names 51
long description of 203
target algorithm 324
target of document 200
white space around 198
frameset
DTD, declaration of 54
DTD, definition of 287
alternate content for 202
navigation problems with 201
nested 196
sharing data among 196
specifying layout of 195
frameset document 194
%FrameTarget; 51

GET
and form submission 231

header cell
abbreviation 125
in table 116
scope of 125
headings
properly nested 70
hidden control 209, 233
HTML
as SGML application 34
authoring tips 22
comments in 26
development of 19
specifying data external to 312
version 2.0 19
version 3.0 19

359
Index

version 3.2 19
version HTML+ 19
HTML document 33
HTML Working Group
members of 15
HTTP
Content-Language header 82
Content-Script-Type header 239
Content-Style-Type header 173
Content-Type header 39
Default-Style header 179
GET and POST with forms 231
used to link external style sheets 181
hyphenation 88

ID 44
id attribute
roles of 65
same name space as name attribute 142
IDREF 44
IDREFS 44
image
alignment of 169
border around 168
long description of 152
not directly in frame 203
visual rendering of 168
ways to include 150
white space around 168
width and height of 168
image map 162, 167
accessibility of 165
client-side 162
illegal for IMG in BUTTON 217
overlapping regions of 165
server side 167
server-side 162
with OBJECT 164
#IMPLIED attribute value 30
including an object 154
inline
element 66
%inline; 27
inter-word space 82
Internet Engineering Task Force (IETF) 19

360
Index

intrinsic events 240

label
and focus 225
explicit association with control 224
implicit association with control 225
lang attribute
not for direction 74
when applicable 71
language
codes to specify 72
of linked resource 138
of script 239
of text 71
%LanguageCode; 47
%Length; 46
line break 87
and bidirectional text 88
and floating text 186
forcing 87
prohibiting 88
link
and character encoding 138
and external style sheets 178, 144
and media-dependent style sheets 180
default target for 201
definition of 135
forward and reverse 144
nesting illegal 142
rendering of 140
semantics with target frame 202
title of 138
type of 48
used to define relationship 137
used to retrieve resource 135
link type
case of 48
list of recognized 48
profiles for new 49
list
definition list 96
nesting of 95
numbering of 96
ordered 94
style sheets and 98
unordered 94
visual rendering of 97

361
Index

long image description


relation to alt text 152

markup 23
markup language 23
media
and external style sheets 180
used with style sheets 177
media descriptor
case of 50
list of recognized 49
parsing of 50
%MediaDesc; 49
menu 209
grouping of choices 218
preselected options 218
rendering of choices 220
visual rendering of grouped options 221
message entity 35
meta data 58
LINK vs META 59
profiles for 61
scheme for 62
%MultiLength; 46
multipart/form-data 234, 210

NAME 44
notes about minimized 313
NUMBER 44
numbered headings
numbered 69
numeric character reference 41

object
alignment of 169
border around 168
fallback rendering of 154
generic inclusion 154
in HEAD 196, 154, 154
in form 209
initialization 156
locating implementation and data 154
naming schemes for 158
rules for embedded 154
statically declared 158
visual rendering of 168
white space around 168

362
Index

width and height of 168


object control 209, 232
obsolete 34
elements 302

paragraph
visual rendering of 90
parameter entity
%Character; 47
%Charset; 47
%Color; 45
%ContentType; 46
%Datetime; 47
%FrameTarget; 51
%LanguageCode; 47
%Length; 46
%MediaDesc; 49
%MultiLength; 46
%Pixels; 46
%Script; 50
%Text; 44
%URI; 45
%attrs; 31
%block; 27
%inline; 27
parameter entity definition 27
password input control 213
persistent style sheets 178
pixel 46
%Pixels; 46
Platform for Internet Content Selection (PICS) 61
POST
and form submission 231
for non-ASCII form data 232
preferred style sheets 178
profile 61
push button 209

quoted text 85
rendering of 85

radio button 209


read only controls 231
relative length 46
relative URI 18
resolution of 18

363
Index

#REQUIRED attribute value 30


reset button 209
resetting a form 208
resolution of relative URI 147
Resource Description Language (RDF) 22, 57
row
number of in table 104
row group 107
rule
between block-level elements 190
between table cells 119

scheme 62
scope
of table header cell 125
script
comments to hide 245
data 50
executed on event 237
executed when document loaded 237
implementation notes 323
introduction to 237
references to elements 240
reserved syntax for 323
used to modify document 243
used to set anchor 140
uses of 237
when unsupported 244
%Script; 50
scripting language
default 239
local declaration 239
specification of 239
search engine
and links 145
helping 315, 60
search robot
helping 316
security
notes on 325
of password control 213
server-side image map 162, 167
click coordinates 167
SGML
application 23
catalog for HTML 248
declaration 24

364
Index

declaration of HTML 4.0 249


document character set 37
document type definition (DTD) 24
document validation 247
element type declaration 24
features with limited support 313, 313
implementation notes 311
introduction to 23
treatment of line breaks 311
soft hyphen 88
start tag 24
omitted 24
strict DTD
declaration of 54
definition of 251
style sheet
alternate 178
and bidirection 79
cascading 179
comments to hide 181
data 51
external 177
external through links 144
inline rules 174
introduction to 171
persistent 178
preferred 178
rules in HEAD 175
specification of external 178
specification of preferred 179
target media for 177
used with DIV and SPAN 176
style sheet language
default 173
submit button 209
successful control 232
summary
of table contents 106

tabbing navigation 228


tabbing order 228
table
algorithm to find heading 131
alignment of contents 121
borders and rules of 119
caption for 106
categorization of cells 128

365
Index

cell margins 124


cells that span several rows/columns 117
column group in 108
data cells 116
directionality of 105
header cells 116
incremental display notes 318
incremental rendering of 104
layout algorithms for 319
non-visual rendering of 125
not for formatting pages 21
number of columns 111
number of rows 104
row group in 107
speaking cell data 131
summary of contents 106
visual rendering of 119
width of columns 112
target frame
algorithm 324
default 201
reserved names 51
semantics of 202
specification of 200
text
direction of 73
floating 186
markup for inserted and deleted 91
preformatted 89
quoted 85
wrapping in paragraph 90
text input control 209
multi-line 222
single-line 213
text/css 47
text/html 35
%Text; 44
time
format of 47
title
available to user 56
of a document 56
used to annotate elements 57
transitional DTD
declaration of 54
definition of 267

366
Index

Unicode bidirectional algorithm 74


universal character set 37
Universal Resource Identifier (see URI) 17
URI
case of 45
non-ASCII characters in attribute values 310
relative 18
resolution of relative 18, 147
specifying base 146
uses of in HTML 18
%URI; 45
URL
relationship to URI 18
user 33
user agent 33
and error conditions 310, 34
and script data 245
and style data 181
conforming 33
handling image maps 164
processing script and style data 44
UTF-1 39
UTF-16 39

white space 81
around frame 198
around images and objects 168
around table contents 124
character 81
collapsed 82
preserved in PRE 89
World Wide Web (Web) 17
wrapping text 90

367
$ERXWWKH:RUOG:LGH:HE&RQVRUWLXP>:&@ KWWSZZZZRUJ&RQVRUWLXP

$ERXW7KH:RUOG:LGH:HE&RQVRUWLXP
/HDGLQJWKH:HEWRLWV)XOO3RWHQWLDO

>0HPEHUVKLS6HUYLFHV3URFHVV)XUWKHULQIRUPDWLRQ@

7KH:&ZDVIRXQGHGLQ2FWREHUWROHDGWKH:RUOG:LGH:HEWRLWVIXOOSRWHQWLDOE\
GHYHORSLQJFRPPRQSURWRFROVWKDWSURPRWHLWVHYROXWLRQDQGHQVXUHLWVLQWHURSHUDELOLW\:H
DUHDQLQWHUQDWLRQDOLQGXVWU\FRQVRUWLXPMRLQWO\KRVWHGE\WKH0DVVDFKXVHWWV,QVWLWXWHRI
7HFKQRORJ\/DERUDWRU\IRU&RPSXWHU6FLHQFH>0,7/&6@LQWKH8QLWHG6WDWHVWKH,QVWLWXW
1DWLRQDOGH5HFKHUFKHHQ,QIRUPDWLTXHHWHQ$XWRPDWLTXH>,15,$@LQ(XURSHDQGWKH.HLR
8QLYHUVLW\6KRQDQ)XMLVDZD&DPSXVLQ-DSDQ6HUYLFHVSURYLGHGE\WKH&RQVRUWLXP
LQFOXGHDUHSRVLWRU\RILQIRUPDWLRQDERXWWKH:RUOG:LGH:HEIRUGHYHORSHUVDQGXVHUV
UHIHUHQFHFRGHLPSOHPHQWDWLRQVWRHPERG\DQGSURPRWHVWDQGDUGVDQGYDULRXVSURWRW\SH
DQGVDPSOHDSSOLFDWLRQVWRGHPRQVWUDWHXVHRIQHZWHFKQRORJ\,QLWLDOO\WKH:&ZDV
HVWDEOLVKHGLQFROODERUDWLRQZLWK&(51ZKHUHWKH:HERULJLQDWHGZLWKVXSSRUWIURP
'$53$DQGWKH(XURSHDQ&RPPLVVLRQ)RUGHWDLOVRQWKHMRLQWLQLWLDWLYHDQGWKH
FRQWULEXWLRQVRI&(51,15,$DQG0,7SOHDVHVHHWKHVWDWHPHQWRQWKHMRLQW:RUOG:LGH
:HE,QLWLDWLYH

7KH&RQVRUWLXPLVOHGE\7LP%HUQHUV/HH'LUHFWRUDQGFUHDWRURIWKH:RUOG:LGH:HE
DQG-HDQ)UDQoRLV$EUDPDWLF&KDLUPDQ:&LVIXQGHGE\0HPEHURUJDQL]DWLRQVDQGLV
YHQGRUQHXWUDOZRUNLQJZLWKWKHJOREDOFRPPXQLW\WRSURGXFHVSHFLILFDWLRQVDQGUHIHUHQFH
VRIWZDUHWKDWLVPDGHIUHHO\DYDLODEOHWKURXJKRXWWKHZRUOG

:&0HPEHUVKLS
0HPEHUVKLSLVRSHQWRDQ\RUJDQL]DWLRQZKLFKVLJQVDPHPEHUVKLSDJUHHPHQW
,I\RXURUJDQL]DWLRQZRXOGOLNHWREHFRPHDPHPEHURIWKH:&SOHDVHVHH

+RZWR-RLQ:&
7KH:RUOG:LGH:HE&RQVRUWLXP3URVSHFWXV

:HDUHVRUU\WKDWWKH:&FDQQRWWDNHLQGLYLGXDOPHPEHUVKLSWKRVHLQWHUHVWHGLQ:&
DFWLYLWLHVDUHHQFRXUDJHGWRVXEVFULEHWRWKH:RUOG:LGH:HE-RXUQDOWKHRIILFLDO-RXUQDO
RI:&

7ROHDUQDERXW:&0HPEHURUJDQL]DWLRQVDQGYLVLWWKHLU:RUOG:LGH:HEVLWHVVHHWKH
0HPEHUOLVW

:&6HUYLFHV
)RUPHPEHUVWKH&RQVRUWLXPSURYLGHVDSODFHWRPHHWWRGLVFXVDQGWRUHDFKDJUHHPHQW
RQFRPPRQVSHFLILFDWLRQV:&VWDIIKHOSE\

RI 30
$ERXWWKH:RUOG:LGH:HE&RQVRUWLXP>:&@ KWWSZZZZRUJ&RQVRUWLXP

2UJDQL]LQJPHHWLQJVRIYDULRXVIRUPV
)DFLOLWDWLQJGLVFXVVLRQDQGDUULYDODWFRQVHQVXV
3URYLGLQJH[SHUWHGLWLQJDQGZULWLQJVNLOOV
+HOSLQJWRSODQDDUFKLWHFWXUDOO\FRQVLVWHQWDQGWLPHO\ZD\IRUZDUG

7KH&RQVRUWLXPSURYLGHVDQXPEHURISXEOLFVHUYLFHV

$UHSRVLWRU\RILQIRUPDWLRQDERXWWKH:RUOG:LGH:HEIRUGHYHORSHUVDQGXVHUV
HVSHFLDOO\VSHFLILFDWLRQVDERXWWKH:HE
$VDPSOHFRGHLPSOHPHQWDWLRQWRHPERG\DQGSURPRWHVWDQGDUGV
9DULRXVSURWRW\SHDQGVDPSOHDSSOLFDWLRQVWRGHPRQVWUDWHXVHRIQHZWHFKQRORJ\

$OOSURGXFWVRIWKH&RQVRUWLXPDUHDYDLODEOHGXULQJGHYHORSPHQWDQGRQLQLWLDOUHOHDVHWR
0HPEHUV2QHPRQWKDIWHUIRUPDOLQWHUQDOUHOHDVHDOOVRIWZDUHSURGXFHGE\RURIILFLDOO\
FRQWULEXWHGWRWKH:&LVDYDLODEOHIRUJHQHUDOSXEOLFXVHFRPPHUFLDORURWKHUZLVH

:&3URFHVV
7KH&RQVRUWLXPDWWHPSWVWRILQGFRPPRQVSHFLILFDWLRQVIRUWKH:HEVRWKDWWKURXJK
GUDPDWLFDQGUDSLGHYROXWLRQPDQ\RUJDQL]DWLRQVFDQZRUNLQWKHLURZQILHOGVWRH[SORLW
DQGEXLOGRQWRSRIWKHJOREDOLQIRUPDWLRQVSDFHZKLFKLVWKHZHE7KHWHFKQRORJLHV
LQYROYHGLQWKHZHEDUHFKDQJLQJYHU\UDSLGO\DQGVRWKH&RQVRUWLXPPXVWKDYHERWK
HIILFLHQF\DQGIOH[LELOLW\LQLWVSURFHVVWREHDEOHWRUHVSRQGWRWKHQHHGVRIWKHFRPPXQLW\
LQDWLPHO\PDQQHU$WWKHVDPHWLPHLWPXVWEHFOHDUWKDWWKH&RQVRUWLXPLVQHXWUDO
IRUXPDQGQRPHPEHUKDVDSULRULDJUHDWHUVD\WKDQDQRWKHU

)XUWKHULQIRUPDWLRQ
:&%DFNJURXQGHU
+HOSZDQWHGFRPHDQGZRUNZLWKWKH:&7HDPDW0,7RU,15,$
3HRSOHRIWKH:&
)UHTXHQWO\$VNHG4XHVWLRQVDERXW:&
+RZWRFRQWDFW:&
3UHVV,QIRUPDWLRQ

7LP%/
:HEPDVWHU
'DWH

&RS\ULJKW‹:& 0,7,15,$.HLR $OO5LJKWV5HVHUYHG:&OLDELOLW\WUDGHPDUNGRFXPHQWXVHDQG


VRIWZDUHOLFHQVLQJUXOHVDSSO\<RXULQWHUDFWLRQVZLWKWKLVVLWHDUHLQDFFRUGDQFHZLWKRXU SXEOLFDQG0HPEHU
SULYDF\VWDWHPHQWV 

RI 30

You might also like